Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K07D4_8
(939 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535703|ref|NP_494712.1| proteasome Regulatory Particle, Non... 586 e-166
gi|39579429|emb|CAE56296.1| Hypothetical protein CBG23950 [Caeno... 573 e-162
gi|19920728|ref|NP_608905.1| CG18174-PA [Drosophila melanogaster... 452 e-126
gi|10946952|ref|NP_067501.1| proteasome (prosome, macropain) 26S... 450 e-125
gi|34854852|ref|XP_215745.2| similar to 26S proteasome-associate... 450 e-125
gi|5031981|ref|NP_005796.1| 26S proteasome-associated pad1 homol... 450 e-125
gi|31211487|ref|XP_314713.1| ENSANGP00000013055 [Anopheles gambi... 449 e-125
gi|50750529|ref|XP_422035.1| PREDICTED: similar to Psmd14-prov p... 449 e-125
gi|2345100|gb|AAC02298.1| Pad1 homolog [Schistosoma mansoni] 441 e-122
gi|14041178|emb|CAC38755.1| putative multidrug resistance protei... 439 e-122
gi|14041710|emb|CAC38781.1| putative multidrug resistance protei... 427 e-118
gi|14034117|emb|CAC38736.1| potential multidrug resistance prote... 427 e-118
gi|15237785|ref|NP_197745.1| 26S proteasome regulatory subunit, ... 421 e-116
gi|34903124|ref|NP_912909.1| unnamed protein product [Oryza sati... 420 e-116
gi|21592398|gb|AAM64349.1| 26S proteasome non-ATPase regulatory ... 419 e-116
gi|32409045|ref|XP_325003.1| hypothetical protein [Neurospora cr... 401 e-110
gi|38106424|gb|EAA52730.1| hypothetical protein MG05858.4 [Magna... 400 e-110
gi|46107796|ref|XP_380957.1| conserved hypothetical protein [Gib... 397 e-109
gi|12848428|dbj|BAB27949.1| unnamed protein product [Mus musculus] 397 e-109
gi|49094336|ref|XP_408629.1| conserved hypothetical protein [Asp... 392 e-108
gi|50556996|ref|XP_505906.1| hypothetical protein [Yarrowia lipo... 390 e-107
gi|50309165|ref|XP_454588.1| unnamed protein product [Kluyveromy... 388 e-107
gi|19114926|ref|NP_594014.1| pad1 protein; 26S proteasome subuni... 388 e-107
gi|50260903|gb|EAL23553.1| hypothetical protein CNBA2000 [Crypto... 388 e-106
gi|11281515|pir||T44427 hypothetical protein - fission yeast (Sc... 385 e-106
gi|46436667|gb|EAK96026.1| hypothetical protein CaO19.7264 [Cand... 382 e-105
gi|50425673|ref|XP_461433.1| unnamed protein product [Debaryomyc... 382 e-105
gi|14318526|ref|NP_116659.1| Metalloprotease subunit of the 19S ... 380 e-104
gi|50293523|ref|XP_449173.1| unnamed protein product [Candida gl... 379 e-104
gi|26280369|gb|AAN77865.1| 26S proteasome regulatory subunit [Sa... 378 e-104
gi|45201101|ref|NP_986671.1| AGR006Wp [Eremothecium gossypii] >g... 377 e-103
gi|28829583|gb|AAO52100.1| similar to Dictyostelium discoideum (... 373 e-102
gi|49069734|ref|XP_399156.1| hypothetical protein UM01541.1 [Ust... 370 e-101
gi|2104757|gb|AAB57823.1| sks1 multidrug resistance protein homo... 367 e-100
gi|32398904|emb|CAD98369.1| Mov34/MPN/PAD-1 family proteasome re... 362 9e-99
gi|23619601|ref|NP_705563.1| proteasome regulatory subunit, puta... 353 2e-96
gi|23490958|gb|EAA22608.1| Mov34/MPN/PAD-1 family, putative [Pla... 351 2e-95
gi|39594009|emb|CAE70119.1| Hypothetical protein CBG16572 [Caeno... 334 1e-90
gi|17553290|ref|NP_498470.1| proteasome regulatory (3H799) [Caen... 333 3e-90
gi|6752672|gb|AAF27818.1| yippee interacting protein 5 [Drosophi... 331 1e-89
gi|19074857|ref|NP_586363.1| PROTEASOME REGULATORY SUBUNIT 11 (R... 330 2e-89
gi|48141588|ref|XP_393559.1| similar to ENSANGP00000013055 [Apis... 290 4e-77
gi|18463065|gb|AAL72634.1| proteasome regulatory non-ATP-ase sub... 287 3e-76
gi|47230598|emb|CAF99791.1| unnamed protein product [Tetraodon n... 255 1e-66
gi|13812378|ref|NP_113496.1| 26S proteasome regulatory subunit [... 218 1e-55
gi|2345102|gb|AAC02299.1| trans-spliced variant protein [Schisto... 211 2e-53
gi|9367753|emb|CAB97491.1| non ATPase subunit MPR1 of 26S protea... 193 5e-48
gi|29250286|gb|EAA41782.1| GLP_111_4773_5777 [Giardia lamblia AT... 193 5e-48
gi|39594015|emb|CAE70125.1| Hypothetical protein CBG16582 [Caeno... 180 4e-44
gi|31206161|ref|XP_312032.1| ENSANGP00000018752 [Anopheles gambi... 147 4e-34
gi|34395065|dbj|BAC84727.1| putative 26S proteasome non-ATPase r... 143 6e-33
gi|17137694|ref|NP_477442.1| CG14884-PA [Drosophila melanogaster... 142 1e-32
gi|28317149|gb|AAD27862.2| LD14392p [Drosophila melanogaster] 142 1e-32
gi|4732109|gb|AAD28608.1| COP9 signalosome subunit 5 CSN5 [Droso... 139 9e-32
gi|50423867|ref|XP_460518.1| unnamed protein product [Debaryomyc... 137 3e-31
gi|34866044|ref|XP_232615.2| similar to COP9 (constitutive photo... 135 1e-30
gi|2360943|gb|AAD03468.1| 38 kDa Mov34 homolog [Homo sapiens] 135 1e-30
gi|7304971|ref|NP_038743.1| COP9 signalosome subunit 5; Jun coac... 135 1e-30
gi|38027923|ref|NP_006828.2| COP9 signalosome subunit 5; Jun act... 135 1e-30
gi|30585175|gb|AAP36860.1| Homo sapiens COP9 constitutive photom... 135 1e-30
gi|47213973|emb|CAG00664.1| unnamed protein product [Tetraodon n... 135 1e-30
gi|41152279|ref|NP_957019.1| hypothetical protein MGC73130 [Dani... 135 2e-30
gi|45360867|ref|NP_989109.1| COP9 signalosome subunit 5 [Xenopus... 135 2e-30
gi|49258066|gb|AAH74434.1| Unknown (protein for MGC:84682) [Xeno... 135 2e-30
gi|7513098|pir||S71820 JUN-activation-domain-binding protein 1 -... 134 4e-30
gi|49074486|ref|XP_401374.1| hypothetical protein UM03759.1 [Ust... 132 9e-30
gi|38048687|gb|AAR10246.1| similar to Drosophila melanogaster CS... 131 2e-29
gi|25349983|pir||T52180 constitutive photomorphogenic 9 complex ... 130 3e-29
gi|42571599|ref|NP_973890.1| COP9 signalosome subunit 5B / CSN s... 129 9e-29
gi|21593104|gb|AAM65053.1| putative JUN kinase activator protein... 129 9e-29
gi|15219970|ref|NP_173705.1| COP9 signalosome subunit 5B / CSN s... 129 9e-29
gi|7489491|pir||T02934 JUN-activation-domain-binding protein hom... 129 9e-29
gi|7488743|pir||T09261 JUN kinase-activation-domain-binding prot... 129 1e-28
gi|15224003|ref|NP_177279.1| COP9 signalosome subunit 5A / CSN s... 128 2e-28
gi|25349981|pir||T52042 constitutive photomorphogenic 9 complex ... 127 3e-28
gi|50552169|ref|XP_503559.1| hypothetical protein [Yarrowia lipo... 127 4e-28
gi|32403880|ref|XP_322553.1| hypothetical protein [Neurospora cr... 127 4e-28
gi|38106249|gb|EAA52582.1| hypothetical protein MG05274.4 [Magna... 127 5e-28
gi|12002865|gb|AAG43411.1| JAB [Lycopersicon esculentum] 127 5e-28
gi|49089006|ref|XP_406266.1| hypothetical protein AN2129.2 [Aspe... 125 2e-27
gi|46111405|ref|XP_382760.1| hypothetical protein FG02584.1 [Gib... 125 2e-27
gi|17538322|ref|NP_500841.1| constitutive photomorphogenic COP9 ... 124 2e-27
gi|39588322|emb|CAE72673.1| Hypothetical protein CBG19889 [Caeno... 124 4e-27
gi|15207967|dbj|BAB63008.1| hypothetical protein [Macaca fascicu... 122 1e-26
gi|19114043|ref|NP_593131.1| COP9/signalosome complex subunit 5 ... 119 7e-26
gi|50255738|gb|EAL18470.1| hypothetical protein CNBJ1120 [Crypto... 119 1e-25
gi|38048441|gb|AAR10123.1| similar to Drosophila melanogaster Rp... 116 6e-25
gi|39545724|emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa (japon... 116 8e-25
gi|46432930|gb|EAK92391.1| hypothetical protein CaO19.10880 [Can... 115 2e-24
gi|46432906|gb|EAK92368.1| hypothetical protein CaO19.3372 [Cand... 110 6e-23
gi|45185084|ref|NP_982801.1| ABL146Cp [Eremothecium gossypii] >g... 106 7e-22
gi|16306916|gb|AAH09524.1| PSMD14 protein [Homo sapiens] 102 9e-21
gi|50306931|ref|XP_453441.1| unnamed protein product [Kluyveromy... 98 2e-19
gi|50288359|ref|XP_446608.1| unnamed protein product [Candida gl... 91 5e-17
gi|6319985|ref|NP_010065.1| subunit of COP9 signalosome (CSN); R... 90 6e-17
gi|50802168|ref|XP_424216.1| PREDICTED: similar to 38 kDa Mov34 ... 79 2e-13
gi|27687907|ref|XP_237593.1| similar to C6.1A [Rattus norvegicus] 65 2e-09
gi|47214302|emb|CAG00968.1| unnamed protein product [Tetraodon n... 65 3e-09
gi|45361565|ref|NP_989359.1| hypothetical protein MGC75580 [Xeno... 63 8e-09
gi|13236583|ref|NP_077308.1| c6.1A [Homo sapiens] >gnl|BL_ORD_ID... 63 1e-08
gi|7709922|gb|AAB29005.2| c6.1A [Homo sapiens] 63 1e-08
gi|12848275|dbj|BAB27894.1| unnamed protein product [Mus musculus] 62 1e-08
gi|22165366|ref|NP_666068.1| c6.1a protein; 6.1A protein [Mus mu... 62 1e-08
gi|2135176|pir||I38167 hypothetical CpG-island associated protei... 62 2e-08
gi|50762987|ref|XP_422885.1| PREDICTED: similar to RIKEN cDNA 17... 61 3e-08
gi|47224079|emb|CAG12908.1| unnamed protein product [Tetraodon n... 60 9e-08
gi|45361707|ref|NP_988991.1| C6.1A-like [Mus musculus] >gnl|BL_O... 59 2e-07
gi|26353442|dbj|BAC40351.1| unnamed protein product [Mus musculus] 59 2e-07
gi|18079341|ref|NP_542366.1| eukaryotic translation initiation f... 59 2e-07
gi|27718221|ref|XP_235109.1| similar to putative C6.1A-like prot... 57 5e-07
gi|4503515|ref|NP_003747.1| eukaryotic translation initiation fa... 57 8e-07
gi|38454242|ref|NP_942046.1| eukaryotic translation initiation f... 56 1e-06
gi|49095594|ref|XP_409258.1| hypothetical protein AN5121.2 [Aspe... 55 2e-06
gi|3986482|gb|AAC84044.1| translation initiation factor eIF3 p40... 55 2e-06
gi|7717235|gb|AAB30469.2| T-cell receptor alpha chain-c6.1A fusi... 54 4e-06
gi|49086776|ref|XP_405407.1| hypothetical protein AN1270.2 [Aspe... 54 7e-06
gi|32416314|ref|XP_328635.1| hypothetical protein [Neurospora cr... 53 1e-05
gi|47211086|emb|CAF95202.1| unnamed protein product [Tetraodon n... 52 1e-05
gi|15218589|ref|NP_172530.1| mov34 family protein [Arabidopsis t... 52 2e-05
gi|46931320|gb|AAT06464.1| At1g10600 [Arabidopsis thaliana] 52 2e-05
gi|49068894|ref|XP_398736.1| hypothetical protein UM01121.1 [Ust... 52 2e-05
gi|50745674|ref|XP_420195.1| PREDICTED: similar to C6.1A [Gallus... 52 3e-05
gi|41107461|ref|XP_055481.3| KIAA1915 protein [Homo sapiens] 51 3e-05
gi|15620889|dbj|BAB67808.1| KIAA1915 protein [Homo sapiens] 51 3e-05
gi|20147355|gb|AAM10390.1| At1g80210/F18B13_28 [Arabidopsis thal... 51 4e-05
gi|18391211|ref|NP_563880.1| eukaryotic translation initiation f... 50 6e-05
gi|12407660|gb|AAG53614.1| eukaryotic initiation factor 3H1 subu... 50 6e-05
gi|19715647|gb|AAL91643.1| AT3g06820/F3E22_4 [Arabidopsis thalia... 50 6e-05
gi|34869835|ref|XP_216460.2| similar to KIAA1915 protein [Rattus... 50 7e-05
gi|50511185|dbj|BAD32578.1| mKIAA1915 protein [Mus musculus] 50 1e-04
gi|32415013|ref|XP_327986.1| hypothetical protein ( (AF028783) p... 49 1e-04
gi|38346118|emb|CAE04596.2| OSJNBb0006N15.13 [Oryza sativa (japo... 49 2e-04
gi|2582351|gb|AAB82533.1| unknown [Dictyostelium discoideum] 49 2e-04
gi|50751668|ref|XP_422504.1| PREDICTED: similar to KIAA1915 prot... 49 2e-04
gi|46138447|ref|XP_390914.1| hypothetical protein FG10738.1 [Gib... 48 3e-04
gi|50551151|ref|XP_503049.1| hypothetical protein [Yarrowia lipo... 48 3e-04
gi|38102580|gb|EAA49401.1| hypothetical protein MG01059.4 [Magna... 48 4e-04
gi|2599117|gb|AAB84057.1| proteasome regulatory subunit 12 [Hypo... 48 4e-04
gi|49389061|dbj|BAD26301.1| putative associated molecule with th... 47 5e-04
gi|19115685|ref|NP_594773.1| similarity to human amsh protein [S... 47 5e-04
gi|31873936|emb|CAD97896.1| hypothetical protein [Homo sapiens] 47 6e-04
gi|29841006|gb|AAP06019.1| similar to NM_010817 26S proteasome r... 47 6e-04
gi|41054245|ref|NP_956083.1| proteasome (prosome, macropain) 26S... 47 8e-04
gi|50425129|ref|XP_461156.1| unnamed protein product [Debaryomyc... 47 8e-04
gi|46436167|gb|EAK95534.1| hypothetical protein CaO19.3168 [Cand... 47 8e-04
gi|46436306|gb|EAK95670.1| hypothetical protein CaO19.10677 [Can... 47 8e-04
gi|50731883|ref|XP_418401.1| PREDICTED: similar to eukaryotic tr... 47 8e-04
gi|7549631|gb|AAF63816.1| unknown protein [Arabidopsis thaliana] 47 8e-04
gi|47219752|emb|CAG03379.1| unnamed protein product [Tetraodon n... 46 0.001
gi|21536814|gb|AAM61146.1| unknown [Arabidopsis thaliana] 46 0.001
gi|18402358|ref|NP_564533.1| mov34 family protein [Arabidopsis t... 46 0.001
gi|46122473|ref|XP_385790.1| hypothetical protein FG05614.1 [Gib... 46 0.001
gi|12597822|gb|AAG60133.1| hypothetical protein [Arabidopsis tha... 46 0.001
gi|48097859|ref|XP_391960.1| similar to ENSANGP00000013949 [Apis... 46 0.001
gi|50547607|ref|XP_501273.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|24762618|ref|NP_523845.2| CG3416-PA [Drosophila melanogaster]... 45 0.002
gi|31239957|ref|XP_320392.1| ENSANGP00000013949 [Anopheles gambi... 45 0.002
gi|37779116|gb|AAP20218.1| translation initiation factor 3 [Pagr... 45 0.002
gi|38106114|gb|EAA52464.1| hypothetical protein MG05156.4 [Magna... 45 0.002
gi|50556142|ref|XP_505479.1| hypothetical protein [Yarrowia lipo... 45 0.003
gi|25777615|ref|NP_002802.2| proteasome 26S non-ATPase subunit 7... 45 0.003
gi|38107490|gb|EAA53655.1| hypothetical protein MG07932.4 [Magna... 45 0.003
gi|31200405|ref|XP_309150.1| ENSANGP00000018550 [Anopheles gambi... 45 0.003
gi|2134660|pir||S65491 26S proteasome regulatory chain 12 - huma... 45 0.003
gi|6754724|ref|NP_034947.1| proteasome (prosome, macropain) 26S ... 45 0.003
gi|33875323|gb|AAH00338.1| PSMD7 protein [Homo sapiens] 45 0.003
gi|34851726|ref|XP_226439.2| similar to 26S proteasome non-ATPas... 45 0.003
gi|26326937|dbj|BAC27212.1| unnamed protein product [Mus musculus] 45 0.003
gi|19075303|ref|NP_587803.1| 26S proteasome regulatory subunit 1... 44 0.005
gi|50417591|gb|AAH77668.1| Unknown (protein for IMAGE:7027546) [... 44 0.005
gi|50257989|gb|EAL20683.1| hypothetical protein CNBE0480 [Crypto... 44 0.005
gi|1709802|sp|P26270|PSD7_DROME 26S proteasome non-ATPase regula... 44 0.007
gi|45360673|ref|NP_989010.1| hypothetical protein MGC75962 [Xeno... 44 0.007
gi|50257519|gb|EAL20224.1| hypothetical protein CNBF0360 [Crypto... 44 0.007
gi|49256468|gb|AAH74422.1| Unknown (protein for MGC:84444) [Xeno... 44 0.007
gi|46249570|gb|AAH68799.1| MGC81376 protein [Xenopus laevis] 44 0.007
gi|42563565|ref|NP_187338.3| mov34 family protein [Arabidopsis t... 43 0.009
gi|34894964|ref|NP_908807.1| B1088D01.3 [Oryza sativa (japonica ... 43 0.009
gi|38015922|dbj|BAD00167.1| ALM beta [Mus musculus] 43 0.012
gi|38015920|dbj|BAD00166.1| ALM alpha [Mus musculus] >gnl|BL_ORD... 43 0.012
gi|31981348|ref|NP_083958.2| AMSH-family protein [Mus musculus] ... 43 0.012
gi|18000291|gb|AAL54907.1| AMSH-like [Lapemis hardwickii] 42 0.015
gi|17508685|ref|NP_491319.1| proteasome Regulatory Particle, Non... 42 0.020
gi|33147080|ref|NP_065850.1| associated molecule with the SH3 do... 42 0.020
gi|46229483|gb|EAK90301.1| 26S proteasome regulatory subunit, in... 42 0.020
gi|34905406|ref|NP_914050.1| B1111E11.23 [Oryza sativa (japonica... 42 0.020
gi|7243127|dbj|BAA92611.1| KIAA1373 protein [Homo sapiens] 42 0.020
gi|14789993|gb|AAH10846.1| Unknown (protein for MGC:8774) [Homo ... 42 0.020
gi|24651395|ref|NP_651796.1| CG2224-PA [Drosophila melanogaster]... 42 0.026
gi|18447170|gb|AAL68176.1| AT31826p [Drosophila melanogaster] 42 0.026
gi|45184708|ref|NP_982426.1| AAL116Wp [Eremothecium gossypii] >g... 42 0.026
gi|1085272|pir||JC4154 26S proteasome regulatory chain, p40 - hu... 41 0.034
gi|49091358|ref|XP_407140.1| hypothetical protein AN3003.2 [Aspe... 41 0.034
gi|50749486|ref|XP_421657.1| PREDICTED: similar to associated mo... 41 0.034
gi|39595364|emb|CAE60401.1| Hypothetical protein CBG04003 [Caeno... 41 0.034
gi|45269968|gb|AAS56365.1| YOR261C [Saccharomyces cerevisiae] 41 0.044
gi|39586329|emb|CAE66740.1| Hypothetical protein CBG12090 [Caeno... 41 0.044
gi|6324835|ref|NP_014904.1| Essential, non-ATPase regulatory sub... 40 0.058
gi|50292347|ref|XP_448606.1| unnamed protein product [Candida gl... 40 0.058
gi|17540448|ref|NP_501236.1| predicted CDS, putative protein (4I... 40 0.058
gi|15229710|ref|NP_187736.1| 26S proteasome non-ATPase regulator... 40 0.058
gi|5091556|gb|AAD39585.1| T10O24.25 [Arabidopsis thaliana] 40 0.075
gi|46441559|gb|EAL00855.1| hypothetical protein CaO19.14040 [Can... 40 0.075
gi|50305325|ref|XP_452622.1| unnamed protein product [Kluyveromy... 40 0.098
gi|5453545|ref|NP_006454.1| STAM binding protein; associated mol... 39 0.13
gi|7497273|pir||T28786 hypothetical protein C41D11.2 - Caenorhab... 39 0.13
gi|32413491|ref|XP_327225.1| hypothetical protein [Neurospora cr... 39 0.13
gi|17505955|ref|NP_491370.1| eukaryotic Initiation Factor (41.0 ... 39 0.13
gi|47226623|emb|CAG07782.1| unnamed protein product [Tetraodon n... 39 0.13
gi|50754041|ref|XP_414229.1| PREDICTED: similar to 26S proteasom... 39 0.17
gi|49067048|ref|XP_397814.1| hypothetical protein UM00199.1 [Ust... 39 0.17
gi|47213008|emb|CAF95400.1| unnamed protein product [Tetraodon n... 39 0.17
gi|4581544|emb|CAB40145.1| AMSH-like protein [Trichuris trichiura] 39 0.22
gi|17941277|ref|NP_077201.1| Stam binding protein; associated mo... 39 0.22
gi|19924065|ref|NP_612540.1| associated molecule with the SH3 do... 39 0.22
gi|46138893|ref|XP_391137.1| hypothetical protein FG10961.1 [Gib... 39 0.22
gi|50765160|ref|XP_422963.1| PREDICTED: similar to STAM binding ... 38 0.29
gi|37681729|gb|AAQ97742.1| associated molecule with the SH3 doma... 38 0.29
gi|41053858|ref|NP_956792.1| hypothetical protein MGC66147 [Dani... 38 0.29
gi|30584931|gb|AAP36731.1| Homo sapiens eukaryotic translation i... 38 0.37
gi|26353564|dbj|BAC40412.1| unnamed protein product [Mus musculus] 38 0.37
gi|29731731|ref|XP_290345.1| similar to eukaryotic translation i... 38 0.37
gi|21313620|ref|NP_079620.1| eukaryotic translation initiation f... 38 0.37
gi|34858904|ref|XP_215037.2| similar to eukaryotic translation i... 38 0.37
gi|21754858|dbj|BAC04577.1| unnamed protein product [Homo sapiens] 38 0.37
gi|4503519|ref|NP_003745.1| eukaryotic translation initiation fa... 38 0.37
gi|50749406|ref|XP_421624.1| PREDICTED: similar to eukaryotic tr... 38 0.37
gi|15239230|ref|NP_196197.1| 26S proteasome non-ATPase regulator... 37 0.49
gi|48101263|ref|XP_392659.1| similar to AT31826p [Apis mellifera] 37 0.49
gi|15225611|ref|NP_181528.1| eukaryotic translation initiation f... 37 0.49
gi|17064960|gb|AAL32634.1| 26S proteasome regulatory subunit [Ar... 37 0.49
gi|23613648|ref|NP_704669.1| 26S proteasome regulatory subunit, ... 37 0.83
gi|21758154|dbj|BAC05256.1| unnamed protein product [Homo sapiens] 37 0.83
gi|9247092|gb|AAF86279.1| Ras related small G protein RAL-A [Xen... 36 1.1
gi|23508594|ref|NP_701263.1| malaria antigen [Plasmodium falcipa... 36 1.1
gi|50312015|ref|XP_456039.1| unnamed protein product [Kluyveromy... 36 1.4
gi|50424137|ref|XP_460655.1| unnamed protein product [Debaryomyc... 35 1.9
gi|23488517|gb|EAA21339.1| hypothetical protein [Plasmodium yoel... 35 1.9
gi|28627546|gb|AAL82571.1| Jun activation domain binding protein... 35 2.4
gi|19703540|ref|NP_603102.1| Dipeptide transport ATP-binding pro... 35 2.4
gi|16554503|ref|NP_444227.1| Uncharacterized conserved protein [... 35 2.4
gi|17297979|dbj|BAB78487.1| 26S proteasome regulatory particle n... 35 2.4
gi|23480006|gb|EAA16684.1| hypothetical protein [Plasmodium yoel... 35 3.2
gi|32422373|ref|XP_331630.1| predicted protein [Neurospora crass... 35 3.2
gi|47226905|emb|CAG05797.1| unnamed protein product [Tetraodon n... 35 3.2
gi|23510034|ref|NP_702700.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|23097903|ref|NP_691369.1| amino acid ABC transporter ATP-bind... 34 4.1
gi|42518878|ref|NP_964808.1| NifS/IcsS protein-like protein [Lac... 34 4.1
gi|31076066|emb|CAD68971.1| cysteine sulfinate desulfinase/cyste... 34 4.1
gi|24212891|ref|NP_710372.1| hypothetical protein LA0191 [Leptos... 34 4.1
gi|21909868|ref|NP_664136.1| 67 kDa Myosin-crossreactive strepto... 34 4.1
gi|28896437|ref|NP_802787.1| 67kDa Myosin-crossreactive streptoc... 34 4.1
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 34 4.1
gi|23120263|ref|ZP_00103001.1| COG0367: Asparagine synthase (glu... 34 4.1
gi|18418410|ref|NP_568356.1| co-chaperone grpE family protein [A... 34 5.4
gi|15668902|ref|NP_247706.1| acetylornithine aminotransferase (a... 34 5.4
gi|48863554|ref|ZP_00317448.1| COG4992: Ornithine/acetylornithin... 34 5.4
gi|34861819|ref|XP_219698.2| similar to sperm ion channel [Rattu... 34 5.4
gi|30686476|ref|NP_850840.1| co-chaperone grpE family protein [A... 34 5.4
gi|15674587|ref|NP_268761.1| 67 kDa Myosin-crossreactive strepto... 34 5.4
gi|19745594|ref|NP_606730.1| 67 kDa Myosin-crossreactive strepto... 34 5.4
gi|23481225|gb|EAA17566.1| hypothetical protein [Plasmodium yoel... 34 5.4
gi|16119238|ref|NP_395944.1| AGR_pAT_9p [Agrobacterium tumefacie... 33 7.0
gi|38346065|emb|CAE04833.2| OSJNBa0084K01.5 [Oryza sativa (japon... 33 7.0
gi|19074119|ref|NP_584725.1| 26S PROTEASOME REGULATORY SUBUNIT 1... 33 7.0
gi|47682703|gb|AAH70473.1| Eukaryotic translation initiation fac... 33 7.0
gi|50417768|gb|AAH78052.1| Unknown (protein for MGC:82825) [Xeno... 33 7.0
gi|23509629|ref|NP_702296.1| hypothetical protein [Plasmodium fa... 33 7.0
gi|13324600|gb|AAK18803.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|13324576|gb|AAK18791.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|48730014|ref|ZP_00263763.1| COG0642: Signal transduction hist... 33 9.2
gi|48825542|ref|ZP_00286788.1| COG0225: Peptide methionine sulfo... 33 9.2
gi|13324596|gb|AAK18801.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|41117725|ref|XP_372917.1| similar to Cerebellar-degeneration-... 33 9.2
gi|15594555|ref|NP_212344.1| surface-located membrane protein 1 ... 33 9.2
gi|13324594|gb|AAK18800.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|13324588|gb|AAK18797.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|13324592|gb|AAK18799.1| LMP1 [Borrelia burgdorferi] 33 9.2
gi|422615|pir||A47297 myosin heavy chain form B, nonmuscle - Afr... 33 9.2
gi|13324580|gb|AAK18793.1| LMP1 [Borrelia burgdorferi] 33 9.2
>gi|17535703|ref|NP_494712.1| proteasome Regulatory Particle,
Non-ATPase-like, S13 (34.6 kD) (rpn-11) [Caenorhabditis
elegans]
gi|7505445|pir||T33344 hypothetical protein K07D4.3 -
Caenorhabditis elegans
gi|3319432|gb|AAC26287.1| Proteasome regulatory particle,
non-atpase-like protein 11 [Caenorhabditis elegans]
Length = 312
Score = 586 bits (1511), Expect = e-166
Identities = 294/294 (100%), Positives = 294/294 (100%)
Frame = -1
Query: 885 ANPQDSNQVDTSETVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMP 706
ANPQDSNQVDTSETVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMP
Sbjct: 19 ANPQDSNQVDTSETVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMP 78
Query: 705 QSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEAL 526
QSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEAL
Sbjct: 79 QSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEAL 138
Query: 525 SDRAVAVVVDPIQSVKGKVVIDAFRTINPQSMALNQEPRQTTSNLGHLQKPSIQALIHGL 346
SDRAVAVVVDPIQSVKGKVVIDAFRTINPQSMALNQEPRQTTSNLGHLQKPSIQALIHGL
Sbjct: 139 SDRAVAVVVDPIQSVKGKVVIDAFRTINPQSMALNQEPRQTTSNLGHLQKPSIQALIHGL 198
Query: 345 NRHYYSIPIAYRTHDLEQKMLLNLNKLSWMDAVSVENYSKCGEQNKEHLKAMLKLAKNYK 166
NRHYYSIPIAYRTHDLEQKMLLNLNKLSWMDAVSVENYSKCGEQNKEHLKAMLKLAKNYK
Sbjct: 199 NRHYYSIPIAYRTHDLEQKMLLNLNKLSWMDAVSVENYSKCGEQNKEHLKAMLKLAKNYK 258
Query: 165 KALEDEKNMTDQELAIKNVGKMDPKRHIADEVSKMLNDNIVQSLAGMMATTSLQ 4
KALEDEKNMTDQELAIKNVGKMDPKRHIADEVSKMLNDNIVQSLAGMMATTSLQ
Sbjct: 259 KALEDEKNMTDQELAIKNVGKMDPKRHIADEVSKMLNDNIVQSLAGMMATTSLQ 312