Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= K07F5_3
         (384 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17541624|ref|NP_501760.1| major Sperm Protein MSP-10, Major S...   268   1e-71
gi|39589839|emb|CAE60837.1| Hypothetical protein CBG04546 [Caeno...   268   2e-71
gi|39590724|emb|CAE65094.1| Hypothetical protein CBG09953 [Caeno...   267   3e-71
gi|156376|gb|AAA28115.1| major sperm protein                          266   5e-71
gi|39596870|emb|CAE59097.1| Hypothetical protein CBG02389 [Caeno...   266   9e-71
gi|39597263|emb|CAE59491.1| Hypothetical protein CBG02876 [Caeno...   266   9e-71
gi|156378|gb|AAA28116.1| major sperm protein                          265   2e-70
gi|17535289|ref|NP_494898.1| major Sperm Protein MSP-31, major S...   265   2e-70
gi|17542416|ref|NP_501742.1| major Sperm Protein MSP-78, Major S...   264   3e-70
gi|17543834|ref|NP_501464.1| major Sperm Protein (4J335) [Caenor...   263   5e-70
gi|39592203|emb|CAE75424.1| Hypothetical protein CBG23417 [Caeno...   263   5e-70
gi|17535285|ref|NP_494858.1| major Sperm Protein MSP-3, major Sp...   263   5e-70
gi|17535293|ref|NP_494888.1| major Sperm Protein MSP-33, major S...   263   6e-70
gi|17535313|ref|NP_494901.1| major Sperm Protein MSP-152, major ...   263   6e-70
gi|17541646|ref|NP_501781.1| major Sperm Protein MSP-77, Major S...   263   6e-70
gi|17543816|ref|NP_500755.1| major Sperm Protein (14.5 kD) (4G15...   263   8e-70
gi|21730213|pdb|1GRW|A Chain A, C. Elegans Major Sperm Protein >...   263   8e-70
gi|17535301|ref|NP_494970.1| major Sperm Protein MSP-49, major S...   262   1e-69
gi|39596998|emb|CAE59225.1| Hypothetical protein CBG02544 [Caeno...   262   1e-69
gi|17535305|ref|NP_495143.1| major Sperm Protein MSP-63, major S...   261   2e-69
gi|17537885|ref|NP_494906.1| predicted CDS, major Sperm Protein ...   261   2e-69
gi|17541634|ref|NP_500711.1| major Sperm Protein MSP-55, Major S...   261   2e-69
gi|17541380|ref|NP_501849.1| major Sperm Protein MSP-38, Major S...   259   9e-69
gi|17535291|ref|NP_494891.1| predicted CDS, major Sperm Protein ...   247   3e-65
gi|127353|sp|P13263|MSP2_ONCVO Major sperm protein 2 (MSP2) >gnl...   232   1e-60
gi|3183538|sp|P27440|MSP2_ASCSU Major sperm protein, isoform bet...   232   1e-60
gi|127350|sp|P13262|MSP1_ONCVO Major sperm protein 1 (MSP1) >gnl...   230   4e-60
gi|2506876|sp|P27439|MSP1_ASCSU Major sperm protein, isoform alp...   229   1e-59
gi|42627270|emb|CAF29502.1| major sperm protein [Oesophagostomum...   229   1e-59
gi|42627274|emb|CAF29504.1| major sperm protein [Oesophagostomum...   228   2e-59
gi|39589838|emb|CAE60836.1| Hypothetical protein CBG04545 [Caeno...   227   5e-59
gi|1942980|pdb|1MSP|A Chain A, Major Sperm Protein, Alpha Isofor...   227   5e-59
gi|42627268|emb|CAF29501.1| major sperm protein [Oesophagostomum...   226   1e-58
gi|39589556|emb|CAE66791.1| Hypothetical protein CBG12151 [Caeno...   224   2e-58
gi|42627276|emb|CAF29505.1| major sperm protein [Oesophagostomum...   224   3e-58
gi|255455|gb|AAB23264.1| major sperm protein alpha isoform, alph...   224   3e-58
gi|3114299|pdb|2MSP|A Chain A, Major Sperm Protein, Beta Isoform...   221   2e-57
gi|39597192|emb|CAE59419.1| Hypothetical protein CBG02788 [Caeno...   215   2e-55
gi|39585146|emb|CAE57389.1| Hypothetical protein CBG00337 [Caeno...   171   3e-52
gi|12055875|emb|CAC20742.1| major sperm protein [Onchocerca volv...   195   2e-49
gi|12055873|emb|CAC20741.1| major sperm protein [Onchocerca volv...   194   3e-49
gi|12055879|emb|CAC20709.1| major sperm protein [Mansonella ozza...   193   8e-49
gi|12055871|emb|CAC20740.1| major sperm protein [Onchocerca volv...   192   1e-48
gi|12055867|emb|CAC20738.1| major sperm protein [Onchocerca volv...   192   1e-48
gi|12055899|emb|CAC20719.1| major sperm protein [Mansonella ozza...   192   2e-48
gi|12055895|emb|CAC20717.1| major sperm protein [Mansonella ozza...   191   3e-48
gi|12055887|emb|CAC20713.1| major sperm protein [Mansonella ozza...   191   3e-48
gi|12055877|emb|CAC20708.1| major sperm protein [Mansonella ozza...   191   4e-48
gi|12055869|emb|CAC20739.1| major sperm protein [Onchocerca volv...   190   6e-48
gi|12055891|emb|CAC20715.1| major sperm protein [Mansonella ozza...   190   6e-48
gi|12055907|emb|CAC20723.1| major sperm protein [Mansonella ozza...   189   8e-48
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza...   189   8e-48
gi|12055905|emb|CAC20722.1| major sperm protein [Mansonella ozza...   189   1e-47
gi|39590722|emb|CAE65092.1| Hypothetical protein CBG09951 [Caeno...   172   8e-46
gi|1709138|sp|P53022|MSP2_GLORO Major sperm protein 2 >gnl|BL_OR...   175   2e-43
gi|17541610|ref|NP_502824.1| major Sperm Protein family member (...   170   5e-42
gi|17544364|ref|NP_502908.1| major Sperm Protein family member (...   170   7e-42
gi|1709136|sp|P53021|MSP1_GLORO Major sperm protein 1 >gnl|BL_OR...   169   9e-42
gi|1709139|sp|P53023|MSP3_GLORO Major sperm protein 3 >gnl|BL_OR...   168   3e-41
gi|17534493|ref|NP_494960.1| major Sperm Protein (8.7 kD) (2F448...   166   8e-41
gi|451224|gb|AAB27962.1| diagnostic antigen [Dictyocaulus vivipa...   113   2e-37
gi|1373359|gb|AAB02251.1| major sperm protein                         143   9e-34
gi|39593483|emb|CAE61775.1| Hypothetical protein CBG05735 [Caeno...   143   9e-34
gi|17544384|ref|NP_502992.1| predicted CDS, major Sperm Protein ...   139   1e-32
gi|17544392|ref|NP_502995.1| major Sperm Protein (4R769) [Caenor...   139   1e-32
gi|1373308|gb|AAB02239.1| major sperm protein >gnl|BL_ORD_ID|869...   136   1e-31
gi|17538101|ref|NP_495165.1| major Sperm Protein family member (...   136   1e-31
gi|1373357|gb|AAB02250.1| major sperm protein                         132   2e-30
gi|39583946|emb|CAE64036.1| Hypothetical protein CBG08633 [Caeno...   132   2e-30
gi|1373312|gb|AAB02241.1| major sperm protein                         124   3e-28
gi|1373355|gb|AAB02249.1| major sperm protein                         123   1e-27
gi|17565914|ref|NP_506636.1| predicted CDS, major Sperm Protein ...   122   2e-27
gi|1373314|gb|AAB02242.1| major sperm protein                         118   2e-26
gi|39589548|emb|CAE66783.1| Hypothetical protein CBG12140 [Caeno...    98   4e-20
gi|39579270|emb|CAE56957.1| Hypothetical protein CBG24807 [Caeno...    97   6e-20
gi|39587522|emb|CAE58460.1| Hypothetical protein CBG01600 [Caeno...    87   6e-17
gi|17539072|ref|NP_502434.1| major Sperm Protein family member (...    87   6e-17
gi|39594774|emb|CAE70642.1| Hypothetical protein CBG17343 [Caeno...    83   1e-15
gi|39593170|emb|CAE64639.1| Hypothetical protein CBG09401 [Caeno...    75   3e-13
gi|39585546|emb|CAE65306.1| Hypothetical protein CBG10225 [Caeno...    73   2e-12
gi|2499127|sp|Q16943|VP33_APLCA Vesicle-associated membrane prot...    57   1e-07
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U...    54   7e-07
gi|48138819|ref|XP_393426.1| similar to vesicle-associated membr...    53   2e-06
gi|39595297|emb|CAE60334.1| Hypothetical protein CBG03926 [Caeno...    53   2e-06
gi|42734418|ref|NP_956212.2| Unknown (protein for MGC:65776); wu...    49   2e-05
gi|38303797|gb|AAH61951.1| Zgc:77382 protein [Danio rerio]             49   2e-05
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein...    47   9e-05
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt...    47   9e-05
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s...    47   1e-04
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom...    47   1e-04
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein...    47   1e-04
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,...    47   1e-04
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu...    47   1e-04
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein...    47   1e-04
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_...    46   2e-04
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n...    44   6e-04
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb...    44   6e-04
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus]      44   7e-04
gi|17538762|ref|NP_501084.1| putative protein (4H777) [Caenorhab...    44   7e-04
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus]     44   7e-04
gi|45360485|ref|NP_988905.1| hypothetical protein MGC76271 [Xeno...    44   0.001
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus]     43   0.001
gi|7677066|gb|AAF67013.1| VAMP-associated 33 kDa protein [Homo s...    43   0.002
gi|17507123|ref|NP_491704.1| VAMP-associated protein (26.9 kD) (...    42   0.003
gi|47086745|ref|NP_997812.1| vesicle-associated membrane protein...    41   0.005
gi|31543940|ref|NP_062780.2| vesicle-associated membrane protein...    41   0.005
gi|11177880|ref|NP_068619.1| VAMP-associated protein B; vesicle-...    41   0.005
gi|24638341|sp|Q9QY76|VAPB_MOUSE Vesicle-associated membrane pro...    41   0.006
gi|27371213|gb|AAH41550.1| MGC53868 protein [Xenopus laevis]           41   0.006
gi|47220459|emb|CAG03239.1| unnamed protein product [Tetraodon n...    40   0.011
gi|1373413|gb|AAB02262.1| Ppmsp-4                                      40   0.011
gi|39595373|emb|CAE60411.1| Hypothetical protein CBG04017 [Caeno...    40   0.014
gi|49328137|gb|AAT58835.1| 'unknown protein, contains major sper...    40   0.014
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba]                  38   0.054
gi|50762142|ref|XP_424948.1| PREDICTED: similar to inhibitor of ...    36   0.20
gi|17510227|ref|NP_493034.1| heat shock factor 2 (1M562) [Caenor...    35   0.45
gi|42761338|dbj|BAD11591.1| 27k vesicle-associated membrane prot...    35   0.45
gi|11994635|dbj|BAB02787.1| unnamed protein product [Arabidopsis...    33   1.0
gi|18415696|ref|NP_567627.1| vesicle-associated membrane family ...    33   1.0
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo...    33   1.0
gi|15238034|ref|NP_199529.1| vesicle-associated membrane family ...    33   1.0
gi|15232143|ref|NP_189369.1| zinc finger (C3HC4-type RING finger...    33   1.0
gi|37536644|ref|NP_922624.1| putative membrane protein [Oryza sa...    33   1.0
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ...    33   1.0
gi|42572975|ref|NP_974584.1| vesicle-associated membrane family ...    33   1.0
gi|29247880|gb|EAA39429.1| GLP_762_1744_6912 [Giardia lamblia AT...    33   1.3
gi|42661013|ref|XP_377407.1| similar to hypothetical protein 473...    33   1.3
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane...    33   1.3
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane...    33   1.3
gi|3023615|sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase ...    33   1.7
gi|34896104|ref|NP_909396.1| P0701D05.6 [Oryza sativa (japonica ...    32   2.2
gi|8809582|dbj|BAA97133.1| membrane associated protein [Arabidop...    32   2.2
gi|1373417|gb|AAB02264.1| Ppmsp-6                                      32   2.2
gi|18423592|ref|NP_568804.1| vesicle-associated membrane family ...    32   2.2
gi|16127790|ref|NP_422354.1| response regulator/sensor histidine...    32   2.9
gi|24660611|ref|NP_524657.2| CG7919-PA [Drosophila melanogaster]...    32   2.9
gi|50549933|ref|XP_502438.1| hypothetical protein [Yarrowia lipo...    32   2.9
gi|46321091|ref|ZP_00221471.1| COG0611: Thiamine monophosphate k...    32   3.8
gi|50759754|ref|XP_417766.1| PREDICTED: similar to glutamate rec...    31   5.0
gi|19552739|ref|NP_600741.1| ABC-type transporter, ATPase compon...    31   5.0
gi|24379245|ref|NP_721200.1| putative transcriptional regulator ...    31   5.0
gi|46314906|ref|ZP_00215490.1| COG3938: Proline racemase [Burkho...    31   5.0
gi|13542304|ref|NP_111992.1| Uncharacterized conserved protein [...    31   5.0
gi|34901800|ref|NP_912246.1| hypothetical protein [Oryza sativa ...    31   5.0
gi|6319930|ref|NP_010011.1| Hypothetical ORF; Ycr087c-ap [Saccha...    31   5.0
gi|14325739|dbj|BAB60642.1| TVG1550926 [Thermoplasma volcanium G...    31   5.0
gi|47228829|emb|CAG07561.1| unnamed protein product [Tetraodon n...    31   5.0
gi|37675744|ref|NP_936140.1| hypothetical protein VVA0084 [Vibri...    31   6.5
gi|1346572|sp|P48968|MPI3_MESAU M-phase inducer phosphatase 3 (D...    31   6.5
gi|49093614|ref|XP_408268.1| hypothetical protein AN4131.2 [Aspe...    31   6.5
gi|33589601|gb|AAQ22567.1| GH22222p [Drosophila melanogaster]          30   8.5
gi|50549925|ref|XP_502434.1| hypothetical protein [Yarrowia lipo...    30   8.5
gi|41017498|sp|Q8WNM1|PGHD_GORGO Prostaglandin-H2 D-isomerase pr...    30   8.5
gi|24660591|ref|NP_648171.1| CG7565-PA [Drosophila melanogaster]...    30   8.5
gi|13475700|ref|NP_107267.1| hypothetical protein mll6838 [Mesor...    30   8.5
gi|7485721|pir||T05153 hypothetical protein F18E5.70 - Arabidops...    30   8.5
gi|29832266|ref|NP_826900.1| putative acyl-CoA synthetase, long-...    30   8.5
gi|38102501|gb|EAA49335.1| hypothetical protein MG00993.4 [Magna...    30   8.5
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >...    30   8.5
gi|26249623|ref|NP_755663.1| Hypothetical outer membrane usher p...    30   8.5


>gi|17541624|ref|NP_501760.1| major Sperm Protein MSP-10, Major
           Sperm Protein (14.2 kD) (msp-10) [Caenorhabditis
           elegans]
 gi|17541628|ref|NP_501834.1| major Sperm Protein MSP-36, Major
           Sperm Protein (14.2 kD) (msp-36) [Caenorhabditis
           elegans]
 gi|17541636|ref|NP_501762.1| major Sperm Protein MSP-56, Major
           Sperm Protein (14.2 kD) (msp-56) [Caenorhabditis
           elegans]
 gi|17541644|ref|NP_501722.1| major Sperm Protein MSP-76, Major
           Sperm Protein (14.2 kD) (msp-76) [Caenorhabditis
           elegans]
 gi|24638464|sp|P05634|MS10_CAEEL Major sperm protein 10/36/56/76
           (MSP)
 gi|25344656|pir||F88801 protein C04G2.4 [imported] - Caenorhabditis
           elegans
 gi|3873901|emb|CAA94674.1| Hypothetical protein C04G2.4
           [Caenorhabditis elegans]
 gi|3878311|emb|CAA94278.1| C. elegans MSP-56 protein (corresponding
           sequence K07F5.3) [Caenorhabditis elegans]
 gi|3878317|emb|CAA94283.1| C. elegans MSP-10 protein (corresponding
           sequence K07F5.2) [Caenorhabditis elegans]
 gi|3881518|emb|CAA92502.1| Hypothetical protein ZK1251.6
           [Caenorhabditis elegans]
 gi|39597184|emb|CAE59411.1| Hypothetical protein CBG02775
           [Caenorhabditis briggsae]
 gi|39597206|emb|CAE59433.1| Hypothetical protein CBG02806
           [Caenorhabditis briggsae]
 gi|39597264|emb|CAE59492.1| Hypothetical protein CBG02877
           [Caenorhabditis briggsae]
          Length = 127

 Score =  268 bits (686), Expect = 1e-71
 Identities = 127/127 (100%), Positives = 127/127 (100%)
 Frame = +1

Query: 1   MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 180
           MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
Sbjct: 1   MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 60

Query: 181 GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 360
           GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
Sbjct: 61  GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 120

Query: 361 LPIEYNP 381
           LPIEYNP
Sbjct: 121 LPIEYNP 127




[DB home][top]