Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K08F4_10
(384 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17541380|ref|NP_501849.1| major Sperm Protein MSP-38, Major S... 269 8e-72
gi|17535289|ref|NP_494898.1| major Sperm Protein MSP-31, major S... 263 5e-70
gi|17542416|ref|NP_501742.1| major Sperm Protein MSP-78, Major S... 263 6e-70
gi|17543834|ref|NP_501464.1| major Sperm Protein (4J335) [Caenor... 262 1e-69
gi|17535285|ref|NP_494858.1| major Sperm Protein MSP-3, major Sp... 262 1e-69
gi|17535293|ref|NP_494888.1| major Sperm Protein MSP-33, major S... 262 1e-69
gi|17535313|ref|NP_494901.1| major Sperm Protein MSP-152, major ... 262 1e-69
gi|17541646|ref|NP_501781.1| major Sperm Protein MSP-77, Major S... 262 1e-69
gi|17543816|ref|NP_500755.1| major Sperm Protein (14.5 kD) (4G15... 261 2e-69
gi|21730213|pdb|1GRW|A Chain A, C. Elegans Major Sperm Protein >... 261 2e-69
gi|17535301|ref|NP_494970.1| major Sperm Protein MSP-49, major S... 261 2e-69
gi|17535305|ref|NP_495143.1| major Sperm Protein MSP-63, major S... 260 4e-69
gi|17537885|ref|NP_494906.1| predicted CDS, major Sperm Protein ... 260 5e-69
gi|17541634|ref|NP_500711.1| major Sperm Protein MSP-55, Major S... 260 5e-69
gi|17541624|ref|NP_501760.1| major Sperm Protein MSP-10, Major S... 259 9e-69
gi|39589839|emb|CAE60837.1| Hypothetical protein CBG04546 [Caeno... 259 1e-68
gi|39590724|emb|CAE65094.1| Hypothetical protein CBG09953 [Caeno... 258 2e-68
gi|156376|gb|AAA28115.1| major sperm protein 257 3e-68
gi|39596870|emb|CAE59097.1| Hypothetical protein CBG02389 [Caeno... 256 6e-68
gi|39597263|emb|CAE59491.1| Hypothetical protein CBG02876 [Caeno... 256 6e-68
gi|156378|gb|AAA28116.1| major sperm protein 255 1e-67
gi|39592203|emb|CAE75424.1| Hypothetical protein CBG23417 [Caeno... 254 3e-67
gi|39596998|emb|CAE59225.1| Hypothetical protein CBG02544 [Caeno... 253 8e-67
gi|17535291|ref|NP_494891.1| predicted CDS, major Sperm Protein ... 246 8e-65
gi|127353|sp|P13263|MSP2_ONCVO Major sperm protein 2 (MSP2) >gnl... 229 1e-59
gi|3183538|sp|P27440|MSP2_ASCSU Major sperm protein, isoform bet... 229 1e-59
gi|127350|sp|P13262|MSP1_ONCVO Major sperm protein 1 (MSP1) >gnl... 227 4e-59
gi|42627274|emb|CAF29504.1| major sperm protein [Oesophagostomum... 227 4e-59
gi|42627270|emb|CAF29502.1| major sperm protein [Oesophagostomum... 226 1e-58
gi|42627268|emb|CAF29501.1| major sperm protein [Oesophagostomum... 224 2e-58
gi|2506876|sp|P27439|MSP1_ASCSU Major sperm protein, isoform alp... 223 7e-58
gi|42627276|emb|CAF29505.1| major sperm protein [Oesophagostomum... 223 7e-58
gi|39589838|emb|CAE60836.1| Hypothetical protein CBG04545 [Caeno... 223 9e-58
gi|1942980|pdb|1MSP|A Chain A, Major Sperm Protein, Alpha Isofor... 221 3e-57
gi|39589556|emb|CAE66791.1| Hypothetical protein CBG12151 [Caeno... 219 1e-56
gi|255455|gb|AAB23264.1| major sperm protein alpha isoform, alph... 218 2e-56
gi|3114299|pdb|2MSP|A Chain A, Major Sperm Protein, Beta Isoform... 218 2e-56
gi|39597192|emb|CAE59419.1| Hypothetical protein CBG02788 [Caeno... 206 1e-52
gi|39585146|emb|CAE57389.1| Hypothetical protein CBG00337 [Caeno... 162 3e-50
gi|12055875|emb|CAC20742.1| major sperm protein [Onchocerca volv... 192 2e-48
gi|12055873|emb|CAC20741.1| major sperm protein [Onchocerca volv... 191 3e-48
gi|12055879|emb|CAC20709.1| major sperm protein [Mansonella ozza... 190 6e-48
gi|12055871|emb|CAC20740.1| major sperm protein [Onchocerca volv... 189 8e-48
gi|12055867|emb|CAC20738.1| major sperm protein [Onchocerca volv... 189 8e-48
gi|12055899|emb|CAC20719.1| major sperm protein [Mansonella ozza... 189 1e-47
gi|12055895|emb|CAC20717.1| major sperm protein [Mansonella ozza... 188 2e-47
gi|12055887|emb|CAC20713.1| major sperm protein [Mansonella ozza... 188 2e-47
gi|12055877|emb|CAC20708.1| major sperm protein [Mansonella ozza... 187 3e-47
gi|12055869|emb|CAC20739.1| major sperm protein [Onchocerca volv... 187 5e-47
gi|12055891|emb|CAC20715.1| major sperm protein [Mansonella ozza... 187 5e-47
gi|12055907|emb|CAC20723.1| major sperm protein [Mansonella ozza... 186 7e-47
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza... 186 7e-47
gi|12055905|emb|CAC20722.1| major sperm protein [Mansonella ozza... 186 9e-47
gi|39590722|emb|CAE65092.1| Hypothetical protein CBG09951 [Caeno... 163 2e-43
gi|17544364|ref|NP_502908.1| major Sperm Protein family member (... 169 1e-41
gi|1709138|sp|P53022|MSP2_GLORO Major sperm protein 2 >gnl|BL_OR... 167 3e-41
gi|17541610|ref|NP_502824.1| major Sperm Protein family member (... 166 1e-40
gi|1709136|sp|P53021|MSP1_GLORO Major sperm protein 1 >gnl|BL_OR... 165 2e-40
gi|17534493|ref|NP_494960.1| major Sperm Protein (8.7 kD) (2F448... 165 2e-40
gi|1709139|sp|P53023|MSP3_GLORO Major sperm protein 3 >gnl|BL_OR... 163 6e-40
gi|451224|gb|AAB27962.1| diagnostic antigen [Dictyocaulus vivipa... 105 1e-36
gi|39593483|emb|CAE61775.1| Hypothetical protein CBG05735 [Caeno... 141 3e-33
gi|17538101|ref|NP_495165.1| major Sperm Protein family member (... 138 3e-32
gi|1373359|gb|AAB02251.1| major sperm protein 137 4e-32
gi|17544384|ref|NP_502992.1| predicted CDS, major Sperm Protein ... 134 3e-31
gi|17544392|ref|NP_502995.1| major Sperm Protein (4R769) [Caenor... 134 3e-31
gi|1373308|gb|AAB02239.1| major sperm protein >gnl|BL_ORD_ID|869... 130 5e-30
gi|39583946|emb|CAE64036.1| Hypothetical protein CBG08633 [Caeno... 130 5e-30
gi|1373357|gb|AAB02250.1| major sperm protein 127 7e-29
gi|17565914|ref|NP_506636.1| predicted CDS, major Sperm Protein ... 120 6e-27
gi|1373312|gb|AAB02241.1| major sperm protein 119 1e-26
gi|1373355|gb|AAB02249.1| major sperm protein 117 4e-26
gi|1373314|gb|AAB02242.1| major sperm protein 113 1e-24
gi|39589548|emb|CAE66783.1| Hypothetical protein CBG12140 [Caeno... 98 4e-20
gi|39579270|emb|CAE56957.1| Hypothetical protein CBG24807 [Caeno... 97 6e-20
gi|39594774|emb|CAE70642.1| Hypothetical protein CBG17343 [Caeno... 83 1e-15
gi|17539072|ref|NP_502434.1| major Sperm Protein family member (... 82 2e-15
gi|39587522|emb|CAE58460.1| Hypothetical protein CBG01600 [Caeno... 80 7e-15
gi|39593170|emb|CAE64639.1| Hypothetical protein CBG09401 [Caeno... 74 7e-13
gi|39585546|emb|CAE65306.1| Hypothetical protein CBG10225 [Caeno... 69 2e-11
gi|2499127|sp|Q16943|VP33_APLCA Vesicle-associated membrane prot... 55 3e-07
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U... 54 7e-07
gi|48138819|ref|XP_393426.1| similar to vesicle-associated membr... 51 5e-06
gi|39595297|emb|CAE60334.1| Hypothetical protein CBG03926 [Caeno... 50 1e-05
gi|42734418|ref|NP_956212.2| Unknown (protein for MGC:65776); wu... 49 2e-05
gi|38303797|gb|AAH61951.1| Zgc:77382 protein [Danio rerio] 49 2e-05
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s... 48 4e-05
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom... 48 4e-05
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein... 48 4e-05
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein... 48 4e-05
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein... 47 1e-04
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt... 47 1e-04
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,... 46 2e-04
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu... 46 2e-04
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb... 45 3e-04
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_... 45 3e-04
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus] 45 3e-04
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus] 45 3e-04
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus] 44 6e-04
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n... 44 7e-04
gi|17538762|ref|NP_501084.1| putative protein (4H777) [Caenorhab... 42 0.002
gi|27371213|gb|AAH41550.1| MGC53868 protein [Xenopus laevis] 40 0.008
gi|17507123|ref|NP_491704.1| VAMP-associated protein (26.9 kD) (... 39 0.024
gi|17510227|ref|NP_493034.1| heat shock factor 2 (1M562) [Caenor... 37 0.091
gi|39595373|emb|CAE60411.1| Hypothetical protein CBG04017 [Caeno... 37 0.091
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba] 36 0.16
gi|1373413|gb|AAB02262.1| Ppmsp-4 36 0.16
gi|50762142|ref|XP_424948.1| PREDICTED: similar to inhibitor of ... 36 0.20
gi|11994635|dbj|BAB02787.1| unnamed protein product [Arabidopsis... 33 1.0
gi|15232143|ref|NP_189369.1| zinc finger (C3HC4-type RING finger... 33 1.0
gi|29247880|gb|EAA39429.1| GLP_762_1744_6912 [Giardia lamblia AT... 33 1.3
gi|3023615|sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase ... 33 1.7
gi|34896104|ref|NP_909396.1| P0701D05.6 [Oryza sativa (japonica ... 32 2.2
gi|15229546|ref|NP_189036.1| dehydratase family [Arabidopsis tha... 32 2.2
gi|14532594|gb|AAK64025.1| putative dihydroxyacid dehydratase [A... 32 2.2
gi|50549933|ref|XP_502438.1| hypothetical protein [Yarrowia lipo... 32 2.2
gi|13475700|ref|NP_107267.1| hypothetical protein mll6838 [Mesor... 32 2.9
gi|18415696|ref|NP_567627.1| vesicle-associated membrane family ... 32 2.9
gi|29832266|ref|NP_826900.1| putative acyl-CoA synthetase, long-... 32 2.9
gi|38078986|ref|XP_357397.1| similar to MGC33414 protein [Mus mu... 32 2.9
gi|38102501|gb|EAA49335.1| hypothetical protein MG00993.4 [Magna... 32 2.9
gi|42661013|ref|XP_377407.1| similar to hypothetical protein 473... 32 2.9
gi|42572975|ref|NP_974584.1| vesicle-associated membrane family ... 32 2.9
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo... 32 3.8
gi|50255293|gb|EAL18028.1| hypothetical protein CNBK0490 [Crypto... 32 3.8
gi|37536644|ref|NP_922624.1| putative membrane protein [Oryza sa... 32 3.8
gi|24379245|ref|NP_721200.1| putative transcriptional regulator ... 31 5.0
gi|13542304|ref|NP_111992.1| Uncharacterized conserved protein [... 31 5.0
gi|34901800|ref|NP_912246.1| hypothetical protein [Oryza sativa ... 31 5.0
gi|6319930|ref|NP_010011.1| Hypothetical ORF; Ycr087c-ap [Saccha... 31 5.0
gi|49093614|ref|XP_408268.1| hypothetical protein AN4131.2 [Aspe... 31 5.0
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane... 31 5.0
gi|14325739|dbj|BAB60642.1| TVG1550926 [Thermoplasma volcanium G... 31 5.0
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane... 31 5.0
gi|46441608|gb|EAL00904.1| hypothetical protein CaO19.14089 [Can... 31 6.5
gi|46138877|ref|XP_391129.1| predicted protein [Gibberella zeae ... 31 6.5
gi|15232012|ref|NP_187519.1| glycine-rich protein [Arabidopsis t... 31 6.5
gi|1346572|sp|P48968|MPI3_MESAU M-phase inducer phosphatase 3 (D... 31 6.5
gi|32472559|ref|NP_865553.1| conserved hypothetical protein [Pir... 31 6.5
gi|16127790|ref|NP_422354.1| response regulator/sensor histidine... 30 8.5
gi|26249623|ref|NP_755663.1| Hypothetical outer membrane usher p... 30 8.5
gi|48095982|ref|XP_394578.1| similar to ENSANGP00000020300 [Apis... 30 8.5
gi|21242040|ref|NP_641622.1| aldose 1-epimerase [Xanthomonas axo... 30 8.5
>gi|17541380|ref|NP_501849.1| major Sperm Protein MSP-38, Major
Sperm Protein (14.2 kD) (msp-38) [Caenorhabditis
elegans]
gi|1709107|sp|P53020|MS38_CAEEL Major sperm protein 38 (MSP)
gi|7505574|pir||T23486 hypothetical protein K08F4.8 -
Caenorhabditis elegans
gi|3878382|emb|CAA93089.1| Hypothetical protein K08F4.8
[Caenorhabditis elegans]
Length = 127
Score = 269 bits (688), Expect = 8e-72
Identities = 127/127 (100%), Positives = 127/127 (100%)
Frame = -1
Query: 384 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTDHIKVINSSARRIGYGIKTTNMKRLGVDPPC 205
MAQSVPPGDIQTQPGTKIVFNAPYDDKHTDHIKVINSSARRIGYGIKTTNMKRLGVDPPC
Sbjct: 1 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTDHIKVINSSARRIGYGIKTTNMKRLGVDPPC 60
Query: 204 GVFDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 25
GVFDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
Sbjct: 61 GVFDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 120
Query: 24 LPIEYNP 4
LPIEYNP
Sbjct: 121 LPIEYNP 127