Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= K10B3_6
         (7284 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17569483|ref|NP_508537.1| spectrin (spc-1) [Caenorhabditis el...  4681   0.0
gi|39597692|emb|CAE68383.1| Hypothetical protein CBG14139 [Caeno...  4576   0.0
gi|31218879|ref|XP_316724.1| ENSANGP00000002653 [Anopheles gambi...  3031   0.0
gi|17136504|ref|NP_476739.1| CG1977-PA [Drosophila melanogaster]...  3030   0.0
gi|103399|pir||A33733 spectrin alpha chain - fruit fly (Drosophi...  3028   0.0
gi|47477769|gb|AAH70885.1| Spna2 protein [Rattus norvegicus]         2854   0.0
gi|31565122|gb|AAH53521.1| SPTAN1 protein [Homo sapiens]             2848   0.0
gi|17380501|sp|P16086|SPCN_RAT Spectrin alpha chain, brain (Spec...  2845   0.0
gi|31543764|ref|NP_741984.2| alpha-spectrin 2; alpha-fodrin; noe...  2838   0.0
gi|50757376|ref|XP_415495.1| PREDICTED: similar to spectrin alph...  2836   0.0
gi|134800|sp|P07751|SPCN_CHICK Spectrin alpha chain, brain (Spec...  2832   0.0
gi|1805280|gb|AAB41498.1| alpha II spectrin [Homo sapiens]           2830   0.0
gi|4507191|ref|NP_003118.1| spectrin, alpha, non-erythrocytic 1 ...  2821   0.0
gi|1334744|emb|CAA32663.1| spectrin alpha chain [Gallus gallus]      2806   0.0
gi|34852958|ref|XP_346648.1| hypothetical protein XP_346647 [Rat...  2640   0.0
gi|38074607|ref|XP_207079.2| spectrin alpha 2 [Mus musculus]         2144   0.0
gi|47211130|emb|CAF90368.1| unnamed protein product [Tetraodon n...  2141   0.0
gi|1174412|sp|P02549|SPCA_HUMAN Spectrin alpha chain, erythrocyt...  2004   0.0
gi|4507189|ref|NP_003117.1| spectrin, alpha, erythrocytic 1 (ell...  2001   0.0
gi|19526481|ref|NP_035595.2| spectrin alpha 1; alpha-spectrin 1,...  1996   0.0
gi|17380523|sp|P08032|SPCA_MOUSE Spectrin alpha chain, erythrocy...  1993   0.0
gi|33303718|gb|AAQ02378.1| erythroid spectrin alpha [Rattus norv...  1919   0.0
gi|34880958|ref|XP_222913.2| similar to erythroid alpha-spectrin...  1893   0.0
gi|46577681|sp|P16546|SPCN_MOUSE Spectrin alpha chain, brain (Sp...  1727   0.0
gi|20380003|gb|AAH27791.1| Spna2 protein [Mus musculus]              1618   0.0
gi|7512790|pir||T14790 hypothetical protein DKFZp564P0562.1 - hu...  1536   0.0
gi|92758|pir||A32612 spectrin alpha chain, nonerythroid - rat (f...  1220   0.0
gi|17862818|gb|AAL39886.1| LP06350p [Drosophila melanogaster]        1115   0.0
gi|178426|gb|AAA51702.1| alpha-fodrin >gnl|BL_ORD_ID|114424 gi|5...  1031   0.0
gi|47211129|emb|CAF90367.1| unnamed protein product [Tetraodon n...   921   0.0
gi|7441355|pir||S61217 spectrin alpha II chain - rat (fragment)       883   0.0
gi|12847774|dbj|BAB27703.1| unnamed protein product [Mus musculus]    802   0.0
gi|836669|gb|AAB60364.1| alpha II spectrin [Homo sapiens]             774   0.0
gi|31209523|ref|XP_313728.1| ENSANGP00000017034 [Anopheles gambi...   766   0.0
gi|161334|gb|AAA30008.1| alpha-spectrin                               759   0.0
gi|45552921|ref|NP_995987.1| CG12008-PC [Drosophila melanogaster...   756   0.0
gi|45552923|ref|NP_995988.1| CG12008-PB [Drosophila melanogaster...   756   0.0
gi|24656802|ref|NP_523900.1| CG12008-PA [Drosophila melanogaster...   756   0.0
gi|38075498|ref|XP_359378.1| similar to Spectrin alpha chain, br...   709   0.0
gi|38051869|gb|AAH60504.1| Spna2 protein [Mus musculus]               665   0.0
gi|39592126|emb|CAE75346.1| Hypothetical protein CBG23326 [Caeno...   662   0.0
gi|38074605|ref|XP_355324.1| similar to Spectrin alpha chain, br...   652   0.0
gi|7506776|pir||T23630 hypothetical protein R31.1 - Caenorhabdit...   652   0.0
gi|50748191|ref|XP_421149.1| PREDICTED: similar to Spectrin beta...   652   0.0
gi|25155104|ref|NP_741632.1| SMAll body size SMA-1, betaH chain ...   652   0.0
gi|5902122|ref|NP_008877.1| spectrin, beta, non-erythrocytic 2 [...   598   e-169
gi|7106421|ref|NP_033286.1| spectrin beta 2 isoform 2; beta-spec...   592   e-167
gi|34879632|ref|XP_240072.2| similar to Spectrin beta chain, bra...   581   e-164
gi|50738496|ref|XP_419291.1| PREDICTED: similar to Spectrin beta...   578   e-163
gi|48136657|ref|XP_396777.1| similar to ENSANGP00000017034 [Apis...   574   e-161
gi|47227240|emb|CAG00602.1| unnamed protein product [Tetraodon n...   573   e-161
gi|7706190|ref|NP_057726.1| spectrin, beta, non-erythrocytic 5; ...   568   e-160
gi|448251|prf||1916380A beta spectrin (beta fodrin)                   567   e-159
gi|4507195|ref|NP_003119.1| spectrin, beta, non-erythrocytic 1 i...   560   e-157
gi|30315658|ref|NP_842565.1| spectrin, beta, non-erythrocytic 1 ...   560   e-157
gi|30348966|ref|NP_787030.1| spectrin beta 2 isoform 1; beta-spe...   559   e-157
gi|85771|pir||S01092 fodrin alpha chain (clone alpha-2) - Africa...   555   e-156
gi|15213122|gb|AAK85734.1| beta-G spectrin [Brugia malayi]            544   e-152
gi|48101779|ref|XP_395212.1| similar to ENSANGP00000012507 [Apis...   541   e-152
gi|33303722|gb|AAQ02380.1| non-erythroid spectrin beta [Rattus n...   540   e-151
gi|88622|pir||B27671 spectrin alpha chain, nonerythroid - human ...   539   e-151
gi|189071|gb|AAA59904.1| alpha-spectrin                               537   e-150
gi|92757|pir||A27671 spectrin alpha chain, nonerythroid - rat (f...   537   e-150
gi|17647191|ref|NP_523388.1| CG5870-PA [Drosophila melanogaster]...   537   e-150
gi|423777|pir||A46147 spectrin beta chain - fruit fly (Drosophil...   537   e-150
gi|39594389|emb|CAE71967.1| Hypothetical protein CBG19038 [Caeno...   536   e-150
gi|7505762|pir||T29140 hypothetical protein K11C4.3 - Caenorhabd...   535   e-150
gi|17976528|gb|AAK77612.2| Uncoordinated protein 70, isoform b [...   535   e-150
gi|5734146|gb|AAD49858.1| beta-G spectrin [Caenorhabditis elegans]    535   e-150
gi|17562506|ref|NP_504748.1| beta-G spectrin, UNCoordinated loco...   535   e-150
gi|25154697|ref|NP_504749.2| beta-G spectrin, UNCoordinated loco...   535   e-150
gi|2119257|pir||I50420 nonerythroid alpha-spectrin - chicken (fr...   532   e-149
gi|829111|emb|CAA60503.1| alpha-spectrin [Homo sapiens]               531   e-148
gi|31201697|ref|XP_309796.1| ENSANGP00000012507 [Anopheles gambi...   528   e-148
gi|31201699|ref|XP_309797.1| ENSANGP00000023406 [Anopheles gambi...   528   e-148
gi|27413156|ref|NP_000338.2| spectrin, beta, erythrocytic (inclu...   523   e-146
gi|338440|gb|AAA60578.1| spectrin Rouen (beta-220-218) mutant co...   523   e-146
gi|134798|sp|P11277|SPCB_HUMAN Spectrin beta chain, erythrocyte ...   523   e-146
gi|11066461|gb|AAG28596.1| spectrin-like protein GTRAP41 [Rattus...   520   e-145
gi|103502|pir||A37792 spectrin beta-H chain - fruit fly (Drosoph...   516   e-144
gi|5640028|emb|CAB51571.1| putative alpha-spectrin [Gallus gallus]    516   e-144
gi|7655|emb|CAA37939.1| betaH spectrin [Drosophila melanogaster]      515   e-144
gi|50300486|ref|NP_038703.2| spectrin beta 1; beta-spectrin 1; s...   507   e-141
gi|11992162|gb|AAG42473.1| spectrin beta IV [Homo sapiens]            506   e-141
gi|17368942|sp|Q9H254|SPCQ_HUMAN Spectrin beta chain, brain 3 (S...   506   e-141
gi|10047361|dbj|BAB13468.1| KIAA1642 protein [Homo sapiens]           506   e-141
gi|11602890|gb|AAF93173.1| betaIV spectrin isoform sigma4 [Homo ...   505   e-141
gi|13435161|ref|NP_079489.1| spectrin, beta, non-erythrocytic 4 ...   504   e-141
gi|47058982|ref|NP_997687.1| erythroid spectrin beta [Rattus nor...   504   e-140
gi|30794220|ref|NP_115999.1| spectrin beta 4; beta-spectrin 4; q...   500   e-139
gi|34866100|ref|XP_234322.2| similar to Spectrin beta chain, ery...   499   e-139
gi|16117405|gb|AAK38731.1| beta4-spectrin [Mus musculus] >gnl|BL...   499   e-139
gi|18859423|ref|NP_571600.1| spectrin, beta, erythrocytic; beta-...   498   e-139
gi|34855389|ref|XP_218364.2| similar to betaIV-spectrin sigma1 [...   497   e-138
gi|40353204|ref|NP_066022.1| spectrin, beta, non-erythrocytic 4 ...   496   e-138
gi|476928|pir||A47213 beta-fodrin - human (fragment) >gnl|BL_ORD...   495   e-138
gi|21429122|gb|AAM50280.1| LP04011p [Drosophila melanogaster]         493   e-137
gi|47209542|emb|CAF96656.1| unnamed protein product [Tetraodon n...   488   e-136
gi|2506246|sp|P15508|SPCB_MOUSE Spectrin beta chain, erythrocyte...   486   e-135
gi|47210379|emb|CAF95574.1| unnamed protein product [Tetraodon n...   482   e-134
gi|38075670|ref|XP_141326.3| similar to Spectrin beta chain, bra...   481   e-133
gi|50510447|dbj|BAD32209.1| mKIAA0302 protein [Mus musculus]          479   e-133
gi|38084794|ref|XP_129130.3| spectrin beta 3 [Mus musculus]           479   e-133
gi|17367415|sp|Q9QWN8|SPCP_RAT Spectrin beta chain, brain 2 (Spe...   465   e-129
gi|9507135|ref|NP_062040.1| beta-spectrin 3 [Rattus norvegicus] ...   461   e-127
gi|34856723|ref|XP_238278.2| similar to Spectrin beta chain, bra...   452   e-125
gi|2655084|gb|AAB87867.1| beta-H spectrin [Drosophila melanogaster]   445   e-123
gi|338409|gb|AAA60575.1| alpha-I spectrin                             431   e-118
gi|33340563|gb|AAQ14859.1| beta spectrin IV [Homo sapiens]            428   e-118
gi|6446579|gb|AAA21249.2| beta-heavy-spectrin [Drosophila melano...   405   e-111
gi|109842|pir||A43769 fodrin alpha chain - mouse (fragment)           394   e-107
gi|930145|emb|CAA31289.1| alpha-fodrin (382 AA) [Mus musculus]        394   e-107
gi|47221201|emb|CAG13137.1| unnamed protein product [Tetraodon n...   389   e-106
gi|85770|pir||S01091 fodrin alpha chain (clone alpha-1) - Africa...   383   e-104
gi|40216167|gb|AAR82828.1| AT24411p [Drosophila melanogaster]         375   e-102
gi|29893185|gb|AAP03079.1| antigen [Taenia cellulosae]                372   e-101
gi|47221024|emb|CAG12718.1| unnamed protein product [Tetraodon n...   367   2e-99
gi|26351911|dbj|BAC39592.1| unnamed protein product [Mus musculus]    349   7e-94
gi|338330|gb|AAA63259.1| muscle beta spectrin                         338   1e-90
gi|544668|gb|AAB29442.1| alpha-spectrin [Drosophila melanogaster]     336   6e-90
gi|47124694|gb|AAH70594.1| MGC81191 protein [Xenopus laevis]          311   2e-82
gi|32449722|gb|AAH43995.2| ACTN1 protein [Xenopus laevis]             307   2e-81
gi|13124665|sp|P05094|AAC1_CHICK Alpha-actinin 1 (Alpha-actinin ...   306   4e-81
gi|539494|pir||A42162 alpha-actinin 1 - chicken >gnl|BL_ORD_ID|5...   306   4e-81
gi|63389|emb|CAA32079.1| fibroblast alpha actinin [Gallus gallus]     306   6e-81
gi|18147604|dbj|BAB83244.1| betaIV-spectrin sigma6-A [Mus muscul...   305   1e-80
gi|13591902|ref|NP_112267.1| actinin, alpha 1; non-muscle alpha-...   304   2e-80
gi|4501891|ref|NP_001093.1| actinin, alpha 1 [Homo sapiens] >gnl...   303   4e-80
gi|30585329|gb|AAP36937.1| Homo sapiens actinin, alpha 1 [synthe...   303   4e-80
gi|45383852|ref|NP_989458.1| actinin, alpha 1 [Gallus gallus] >g...   303   5e-80
gi|47169151|pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Giz...   303   5e-80
gi|46395721|sp|Q7TPR4|AAC1_MOUSE Alpha-actinin 1 (Alpha-actinin ...   302   7e-80
gi|41054603|ref|NP_955880.1| actinin alpha 4; wu:fb53f05 [Danio ...   301   1e-79
gi|625303|pir||FAHUAA alpha-actinin 1 - human >gnl|BL_ORD_ID|674...   301   2e-79
gi|49256643|gb|AAH74001.1| Actn1 protein [Rattus norvegicus]          300   3e-79
gi|28723|emb|CAA38970.1| alpha-actinin [Homo sapiens]                 299   6e-79
gi|38018016|gb|AAR08137.1| brain-specific alpha actinin 1 isofor...   295   1e-77
gi|31242389|ref|XP_321625.1| ENSANGP00000023605 [Anopheles gambi...   293   6e-77
gi|31242387|ref|XP_321624.1| ENSANGP00000011796 [Anopheles gambi...   293   6e-77
gi|24639238|ref|NP_477484.2| CG4376-PA [Drosophila melanogaster]...   290   3e-76
gi|24639240|ref|NP_726784.1| CG4376-PB [Drosophila melanogaster]...   290   3e-76
gi|13124689|sp|P18091|AACT_DROME Alpha-actinin, sarcomeric (F-ac...   290   3e-76
gi|17137758|ref|NP_477485.1| CG4376-PC [Drosophila melanogaster]...   290   3e-76
gi|39594084|emb|CAE70194.1| Hypothetical protein CBG16668 [Caeno...   290   4e-76
gi|34876265|ref|XP_214499.2| similar to actinin, alpha 2 [Rattus...   290   5e-76
gi|31981445|ref|NP_150371.2| actinin alpha 2 [Mus musculus] >gnl...   290   5e-76
gi|45384104|ref|NP_990457.1| alpha-actinin [Gallus gallus] >gnl|...   289   6e-76
gi|1070611|pir||FAFFAA alpha-actinin - fruit fly (Drosophila mel...   288   1e-75
gi|13123947|sp|Q9JI91|AAC2_MOUSE Alpha-actinin 2 (Alpha actinin ...   288   1e-75
gi|8186|emb|CAA36042.1| unnamed protein product [Drosophila mela...   288   2e-75
gi|11230802|ref|NP_068695.1| actinin alpha 4 [Mus musculus] >gnl...   287   2e-75
gi|4501893|ref|NP_001094.1| actinin, alpha 2 [Homo sapiens] >gnl...   287   3e-75
gi|2804273|dbj|BAA24447.1| alpha actinin 4 [Homo sapiens]             286   4e-75
gi|12025678|ref|NP_004915.2| actinin, alpha 4 [Homo sapiens] >gn...   286   4e-75
gi|33874637|gb|AAH15620.2| ACTN4 protein [Homo sapiens]               286   4e-75
gi|38197444|gb|AAH61788.1| Actn4 protein [Rattus norvegicus]          286   7e-75
gi|34855625|ref|XP_346542.1| hypothetical protein XP_346541 [Rat...   286   7e-75
gi|13123941|sp|Q9QXQ0|AAC4_RAT Alpha-actinin 4 (Non-muscle alpha...   284   2e-74
gi|13384169|gb|AAK21296.1| alpha actinin 4 [Rattus norvegicus]        284   2e-74
gi|50418010|gb|AAH77918.1| Unknown (protein for MGC:80841) [Xeno...   284   2e-74
gi|49903350|gb|AAH76687.1| Unknown (protein for MGC:79707) [Xeno...   282   8e-74
gi|45387533|ref|NP_991107.1| Unknown (protein for MGC:77243); wu...   281   2e-73
gi|25992501|gb|AAN77132.1| alpha-actinin [Danio rerio] >gnl|BL_O...   281   2e-73
gi|46048687|ref|NP_990654.1| alpha-actinin [Gallus gallus] >gnl|...   280   3e-73
gi|13928936|ref|NP_113863.1| alpha actinin 4; alpha actinin 4, b...   279   6e-73
gi|49903986|gb|AAH76640.1| Unknown (protein for MGC:78775) [Xeno...   278   1e-72
gi|47212235|emb|CAF96202.1| unnamed protein product [Tetraodon n...   278   1e-72
gi|50803149|ref|XP_424262.1| PREDICTED: similar to spectrin, bet...   275   9e-72
gi|47224786|emb|CAG06356.1| unnamed protein product [Tetraodon n...   275   2e-71
gi|50417651|gb|AAH77752.1| Unknown (protein for MGC:79035) [Xeno...   273   5e-71
gi|47939926|gb|AAH72105.1| MGC79034 protein [Xenopus laevis] >gn...   271   1e-70
gi|32766313|gb|AAH54911.1| Zgc:63559 protein [Danio rerio]            271   1e-70
gi|49899924|gb|AAH76938.1| Unknown (protein for MGC:89234) [Xeno...   270   3e-70
gi|37362178|gb|AAQ91217.1| actinin, alpha 2 [Danio rerio]             270   4e-70
gi|7304855|ref|NP_038484.1| actinin alpha 3 [Mus musculus] >gnl|...   268   2e-69
gi|19173800|ref|NP_596915.1| actinin alpha 3 [Rattus norvegicus]...   267   3e-69
gi|29179635|gb|AAH48851.1| Similar to beta-spectrin 3 [Mus muscu...   267   3e-69
gi|20853961|gb|AAM26632.1| truncated alpha-actinin [Rattus norve...   266   7e-69
gi|6716516|gb|AAF26672.1| nonerythroid alpha-spectrin [Homo sapi...   265   1e-68
gi|4557241|ref|NP_001095.1| skeletal muscle specific actinin, al...   261   1e-67
gi|48123513|ref|XP_393253.1| similar to Alpha-actinin, sarcomeri...   260   3e-67
gi|224115|prf||1010302A spectrin alpha fragment                       259   9e-67
gi|13096866|gb|AAH03232.1| Actn1 protein [Mus musculus]               257   3e-66
gi|3157976|gb|AAC17470.1| alpha actinin [Homo sapiens]                250   3e-64
gi|444793|prf||1908227A beta spectrin                                 250   4e-64
gi|18481635|gb|AAL73492.1| beta I spectrin form betaI sigma3 [Ho...   249   5e-64
gi|420115|pir||S29854 spectrin beta chain - dog (fragment) >gnl|...   246   5e-63
gi|11992164|gb|AAG42474.1| spectrin beta IV [Homo sapiens]            244   3e-62
gi|47218151|emb|CAG10071.1| unnamed protein product [Tetraodon n...   233   4e-59
gi|39592275|emb|CAE75496.1| Hypothetical protein CBG23504 [Caeno...   230   4e-58
gi|17552674|ref|NP_498787.1| spectrin repeat and Calcium-binding...   230   4e-58
gi|477205|pir||A48403 alpha-actinin - Caenorhabditis elegans (fr...   229   6e-58
gi|17565036|ref|NP_506127.1| actinin (107.2 kD) (atn-1) [Caenorh...   229   6e-58
gi|17565034|ref|NP_506128.1| actinin (104.1 kD) (atn-1) [Caenorh...   229   6e-58
gi|28277312|gb|AAH46267.1| LOC398511 protein [Xenopus laevis]         229   1e-57
gi|11602888|gb|AAF93172.1| betaIV spectrin isoform sigma3 [Homo ...   229   1e-57
gi|6137376|pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 A...   221   3e-55
gi|25021548|ref|XP_110503.2| microtubule-actin crosslinking fact...   220   5e-55
gi|14285343|sp|Q9QXZ0|MACF_MOUSE Microtubule-actin crosslinking ...   216   5e-54
gi|30407952|gb|AAP30027.1| cardiomyocyte alpha-spectrin [Canis f...   213   7e-53
gi|555419|gb|AAA48566.1| alpha-actinin                                213   7e-53
gi|2345081|gb|AAC02791.1| beta-spectrin [Homo sapiens]                212   1e-52
gi|23394914|gb|AAN31639.1| alpha-actinin [Biomphalaria glabrata]      209   6e-52
gi|91302|pir||A05283 spectrin alpha chain - mouse (fragment) >gn...   209   8e-52
gi|112957|sp|P05095|AACT_DICDI Alpha-actinin, non-muscular (F-ac...   208   1e-51
gi|42656943|ref|XP_293669.4| similar to actinin, alpha 4 [Homo s...   208   2e-51
gi|50747531|ref|XP_426369.1| PREDICTED: similar to unc93 homolog...   205   1e-50
gi|6273778|gb|AAF06360.1| trabeculin-alpha [Homo sapiens]             203   6e-50
gi|553648|gb|AAA60569.1| erythrocyte alpha-spectrin                   202   8e-50
gi|14285345|sp|Q9UPN3|MACF_HUMAN Microtubule-actin crosslinking ...   200   5e-49
gi|5821434|dbj|BAA83821.1| actin binding protein ABP620 [Homo sa...   200   5e-49
gi|33188445|ref|NP_036222.3| microfilament and actin filament cr...   200   5e-49
gi|33188443|ref|NP_149033.2| microfilament and actin filament cr...   200   5e-49
gi|11137614|emb|CAC15920.1| dJ562N20.1.1 (trabeculin alpha (acti...   200   5e-49
gi|30316105|sp|Q96PK2|MAC4_HUMAN Microtubule-actin crosslinking ...   199   6e-49
gi|6690788|gb|AAF24343.1| Short stop/Kakapo long isoform [Drosop...   199   8e-49
gi|7511874|pir||T13734 groovin gene protein - fruit fly (Drosoph...   199   8e-49
gi|24653491|ref|NP_725337.1| CG18076-PE [Drosophila melanogaster...   197   2e-48
gi|24653495|ref|NP_725338.1| CG18076-PC [Drosophila melanogaster...   197   2e-48
gi|24653487|ref|NP_725335.1| CG18076-PG [Drosophila melanogaster...   197   2e-48
gi|24653497|ref|NP_725339.1| CG18076-PH [Drosophila melanogaster...   197   2e-48
gi|24653493|ref|NP_523733.2| CG18076-PA [Drosophila melanogaster...   197   2e-48
gi|24653489|ref|NP_725336.1| CG18076-PB [Drosophila melanogaster...   197   2e-48
gi|47208193|emb|CAF95915.1| unnamed protein product [Tetraodon n...   197   3e-48
gi|47206713|emb|CAF90950.1| unnamed protein product [Tetraodon n...   196   7e-48
gi|11602887|gb|AAF93171.1| betaIV spectrin isoform sigma2 [Homo ...   193   5e-47
gi|17426164|gb|AAL39000.1| macrophin 1 isoform 2 [Homo sapiens]       192   1e-46
gi|17426161|gb|AAL38997.1| macrophin 1 isoform 4 [Homo sapiens]       192   1e-46
gi|630573|pir||S44621 C50C3.2 protein - Caenorhabditis elegans        190   4e-46
gi|34328014|dbj|BAA32310.3| KIAA0465 protein [Homo sapiens]           185   1e-44
gi|47228910|emb|CAG09425.1| unnamed protein product [Tetraodon n...   185   1e-44
gi|31227672|ref|XP_317924.1| ENSANGP00000011363 [Anopheles gambi...   182   8e-44
gi|19882219|ref|NP_598594.1| dystonin isoform a; bullous pemphig...   180   4e-43
gi|19882221|ref|NP_604443.1| dystonin isoform b; bullous pemphig...   180   4e-43
gi|226515|prf||1516310A beta spectrin                                 180   5e-43
gi|48095516|ref|XP_392311.1| similar to Short stop/Kakapo long i...   178   2e-42
gi|4699902|gb|AAB29441.2| alpha-spectrin [Drosophila melanogaster]    177   3e-42
gi|14719556|pdb|1HCI|A Chain A, Crystal Structure Of The Rod Dom...   168   2e-39
gi|34304490|gb|AAQ63199.1| alpha-spectrin [Canis familiaris]          167   3e-39
gi|34577049|ref|NP_056363.2| bullous pemphigoid antigen 1 isofor...   163   7e-38
gi|34577047|ref|NP_899236.1| bullous pemphigoid antigen 1 isofor...   163   7e-38
gi|50744842|ref|XP_419901.1| PREDICTED: similar to Bullous pemph...   160   4e-37
gi|27923958|sp|O94833|BPEA_HUMAN Bullous pemphigoid antigen 1, i...   158   2e-36
gi|18157651|gb|AAL62061.1| bullous pemphigoid antigen 1 eA [Homo...   158   2e-36
gi|17865660|sp|O97592|DMD_CANFA Dystrophin >gnl|BL_ORD_ID|139613...   158   2e-36
gi|12834317|dbj|BAB22865.1| unnamed protein product [Mus musculus]    156   8e-36
gi|7512993|pir||T00079 hypothetical protein KIAA0465 - human (fr...   154   3e-35
gi|5032287|ref|NP_004000.1| dystrophin Dp427p1 isoform; dystroph...   154   4e-35
gi|5032285|ref|NP_003998.1| dystrophin Dp427l isoform; dystrophi...   154   4e-35
gi|5032281|ref|NP_000100.2| dystrophin Dp427c isoform; dystrophi...   154   4e-35
gi|5032283|ref|NP_003997.1| dystrophin Dp427m isoform; dystrophi...   154   4e-35
gi|34874618|ref|XP_237042.2| similar to bullous pemphigoid antig...   154   4e-35
gi|20521141|dbj|BAA34448.2| KIAA0728 protein [Homo sapiens]           153   5e-35
gi|34870961|ref|XP_342907.1| similar to macrophin 1 isoform 4 [R...   153   7e-35
gi|30846|emb|CAA32479.1| unnamed protein product [Homo sapiens]       152   9e-35
gi|87340|pir||A27605 dystrophin, muscle - human >gnl|BL_ORD_ID|8...   151   2e-34
gi|1314716|gb|AAA99797.1| alpha-spectrin                              150   4e-34
gi|50742570|ref|XP_419679.1| PREDICTED: similar to Nesprin 1 (Nu...   150   6e-34
gi|11276931|pir||T42694 hypothetical protein DKFZp434J0328.1 - h...   149   1e-33
gi|118685|sp|P11532|DMD_HUMAN Dystrophin                              149   1e-33
gi|26346759|dbj|BAC37028.1| unnamed protein product [Mus musculus]    147   4e-33
gi|45384284|ref|NP_990630.1| dystrophin [Gallus gallus] >gnl|BL_...   147   5e-33
gi|47155480|dbj|BAD18922.1| alpha 2 actinin [Equus caballus]          145   2e-32
gi|6681203|ref|NP_031894.1| dystrophin, muscular dystrophy; Duch...   141   2e-31
gi|39104621|dbj|BAC65573.2| mKIAA0465 protein [Mus musculus]          141   2e-31
gi|1169358|sp|P11531|DMD_MOUSE Dystrophin >gnl|BL_ORD_ID|327534 ...   141   3e-31
gi|32450315|gb|AAH53828.1| Unknown (protein for IMAGE:6873085) [...   138   2e-30
gi|24581873|ref|NP_524924.2| CG18251-PB [Drosophila melanogaster...   138   2e-30
gi|45552221|ref|NP_995633.1| CG18251-PC [Drosophila melanogaster...   138   2e-30
gi|871044|emb|CAA48702.1| alpha-actinin [Gallus gallus]               137   3e-30
gi|5032291|ref|NP_004003.1| dystrophin Dp260-2 isoform; dystroph...   137   5e-30
gi|5032289|ref|NP_004002.1| dystrophin Dp260-1 isoform; dystroph...   137   5e-30
gi|33300472|emb|CAD90188.2| Hypothetical protein ZK1151.1c [Caen...   136   9e-30
gi|7510926|pir||T26964 hypothetical protein ZK1151.2b - Caenorha...   136   9e-30
gi|27763989|emb|CAD44324.1| VAB-10B protein [Caenorhabditis eleg...   136   9e-30
gi|17511189|ref|NP_492995.1| VAB-10B protein family member, Vari...   136   9e-30
gi|7510925|pir||T26963 hypothetical protein ZK1151.2a - Caenorha...   136   9e-30
gi|17511187|ref|NP_492996.1| VAB-10B protein family member, Vari...   136   9e-30
gi|26342072|dbj|BAC34698.1| unnamed protein product [Mus musculus]    135   1e-29
gi|30315803|emb|CAD67584.1| putative dystrophin [Takifugu rubripes]   135   2e-29
gi|41281987|ref|NP_892006.1| nesprin 1 longest; synaptic nuclei ...   135   2e-29
gi|29839561|sp|Q8NF91|SNE1_HUMAN Nesprin 1 (Nuclear envelope spe...   135   2e-29
gi|48120804|ref|XP_393229.1| similar to CG18251-PB [Apis mellifera]   134   4e-29
gi|239922|gb|AAB20540.1| beta-spectrin subunit [mice, brain, Pep...   132   1e-28
gi|23097308|ref|NP_149062.1| nesprin 1 isoform longer; synaptic ...   132   1e-28
gi|48094523|ref|XP_392136.1| similar to CG18214-PA [Apis mellifera]   131   2e-28
gi|480073|pir||S36394 alpha-actinin 2, skeletal muscle splice fo...   131   3e-28
gi|50470589|emb|CAH04759.1| Hypothetical protein ZK1151.1g [Caen...   130   4e-28
gi|47213754|emb|CAF96419.1| unnamed protein product [Tetraodon n...   129   1e-27
gi|20521662|dbj|BAA34516.2| KIAA0796 protein [Homo sapiens]           128   2e-27
gi|19526753|ref|NP_056108.1| nesprin 1 isoform beta; synaptic nu...   127   4e-27
gi|28195689|gb|AAO27774.1| nesprin-1 beta 2 [Homo sapiens]            127   4e-27
gi|34849883|tpg|DAA01060.1| TPA: spectrin-like protein of the nu...   127   4e-27
gi|50759868|ref|XP_417820.1| PREDICTED: similar to Microtubule-a...   126   7e-27
gi|576411|pdb|2SPC|A Chain A, Spectrin (One Repeat Unit) >gnl|BL...   126   7e-27
gi|37360066|dbj|BAC98011.1| mKIAA0728 protein [Mus musculus]          125   1e-26
gi|47224004|emb|CAG12833.1| unnamed protein product [Tetraodon n...   125   2e-26
gi|47155482|dbj|BAD18923.1| alpha 3 actinin [Equus caballus]          124   3e-26
gi|6005938|ref|NP_009055.1| utrophin; dystrophin-related protein...   124   4e-26
gi|34870957|ref|XP_216526.2| similar to microtubule-actin crossl...   123   8e-26
gi|2345080|gb|AAC02790.1| beta-spectrin [Homo sapiens]                123   8e-26
gi|47550975|ref|NP_999661.1| dystrophin-like protein [Strongyloc...   123   8e-26
gi|50798042|ref|XP_428326.1| PREDICTED: similar to Spectrin beta...   120   4e-25
gi|2392151|pdb|1AJ3|  Solution Structure Of The Spectrin Repeat,...   120   4e-25
gi|45439359|ref|NP_009049.2| triple functional domain (PTPRF int...   120   6e-25
gi|13430206|gb|AAK25769.1| non-erythrocyte beta-spectrin [Rattus...   120   6e-25
gi|27370625|gb|AAH35585.1| Similar to triple functional domain (...   120   6e-25
gi|5822388|pdb|1QUU|A Chain A, Crystal Structure Of Two Central ...   119   1e-24
gi|27801760|emb|CAD44516.1| VAB-10B protein [Caenorhabditis eleg...   118   2e-24
gi|21756268|dbj|BAC04848.1| unnamed protein product [Homo sapiens]    118   2e-24
gi|3522970|gb|AAC34245.1| Trio [Homo sapiens]                         117   3e-24
gi|8928460|sp|O75962|TRIO_HUMAN Triple functional domain protein...   117   3e-24
gi|31202361|ref|XP_310129.1| ENSANGP00000019967 [Anopheles gambi...   117   5e-24
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n...   117   5e-24
gi|16549862|dbj|BAB70870.1| unnamed protein product [Homo sapiens]    117   5e-24
gi|6708476|gb|AAF25952.1| Rho family guanine nucleotide exchange...   116   9e-24
gi|24654944|ref|NP_651960.2| CG18214-PA [Drosophila melanogaster...   116   9e-24
gi|47168509|pdb|1OWA|A Chain A, Solution Structural Studies On H...   116   9e-24
gi|19705491|ref|NP_599208.1| nesprin-1 [Rattus norvegicus] >gnl|...   115   1e-23
gi|34854901|ref|XP_226888.2| similar to Triple functional domain...   115   2e-23
gi|50807536|ref|XP_428917.1| PREDICTED: similar to betaIV-spectr...   115   2e-23
gi|10880799|gb|AAG24393.1| Syne-1B [Mus musculus]                     114   3e-23
gi|8096219|dbj|BAA96093.1| Trio [Drosophila melanogaster]             114   3e-23
gi|482422|pir||A45929 spectrin beta chain - mouse (fragment)          113   6e-23
gi|224116|prf||1010302B spectrin beta fragment                        112   1e-22
gi|554276|gb|AAA40126.1| beta-spectrin                                112   2e-22
gi|47229500|emb|CAF99488.1| unnamed protein product [Tetraodon n...   111   2e-22
gi|6981696|ref|NP_037202.1| utrophin; utrophin (homologous to dy...   111   3e-22
gi|10799514|emb|CAC12899.1| dJ361I14.2 (novel protein (similar t...   111   3e-22
gi|50809216|ref|XP_429009.1| PREDICTED: similar to Spectrin beta...   110   4e-22
gi|443265|pdb|1SHG|  Alpha Spectrin (Sh3 Domain) >gnl|BL_ORD_ID|...   110   5e-22
gi|32408715|ref|XP_324838.1| hypothetical protein [Neurospora cr...   109   9e-22
gi|338334|gb|AAA60572.1| erythrocyte beta-spectrin                    109   9e-22
gi|2984657|gb|AAC07988.1| centrosomal Nek2-associated protein 1 ...   109   1e-21
gi|21735548|ref|NP_009117.2| centrosomal protein 2; centrosome a...   109   1e-21
gi|16974921|pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant     109   1e-21
gi|5107624|pdb|1PWT|  Thermodynamic Analysis Of Alpha-Spectrin S...   108   2e-21
gi|14195007|sp|Q15149|PLE1_HUMAN Plectin 1 (PLTN) (PCN) (Hemides...   108   2e-21
gi|28373998|pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-...   108   2e-21
gi|46575908|ref|NP_035812.2| utrophin; G-utrophin [Mus musculus]...   107   3e-21
gi|29497|emb|CAA42098.1| beta-spectrin [Homo sapiens]                 107   6e-21
gi|2511779|gb|AAC79502.1| beta III spectrin [Homo sapiens]            107   6e-21
gi|7650388|gb|AAF66018.1| Kalirin-9a [Rattus norvegicus]              106   7e-21
gi|3024052|sp|P97924|HAPI_RAT Huntingtin-associated protein-inte...   106   7e-21
gi|14091744|ref|NP_114451.1| huntingtin-associated protein inter...   106   7e-21
gi|7514039|pir||T32732 PAM C-terminal interactor protein, clone ...   106   7e-21
gi|7767545|gb|AAF69144.1| Kalirin-7c isoform [Rattus norvegicus]      106   7e-21
gi|10120877|pdb|1QKW|A Chain A, Alpha-Spectrin Src Homology 3 Do...   106   7e-21
gi|46015861|pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48...   106   1e-20
gi|16975441|pdb|1E6H|A Chain A, A-Spectrin Sh3 Domain A11v, M25i...   105   1e-20
gi|12084430|pdb|1QKX|A Chain A, Alpha-Spectrin Src Homology 3 Do...   105   1e-20
gi|41322914|ref|NP_958785.1| plectin 1 isoform 10; hemidesmosoma...   105   2e-20
gi|41322908|ref|NP_958781.1| plectin 1 isoform 3; hemidesmosomal...   105   2e-20
gi|47607492|ref|NP_000436.2| plectin 1 isoform 1; hemidesmosomal...   105   2e-20
gi|41322912|ref|NP_958780.1| plectin 1 isoform 2; hemidesmosomal...   105   2e-20
gi|41322919|ref|NP_958784.1| plectin 1 isoform 8; hemidesmosomal...   105   2e-20
gi|41322923|ref|NP_958786.1| plectin 1 isoform 11; hemidesmosoma...   105   2e-20
gi|41322910|ref|NP_958783.1| plectin 1 isoform 7; hemidesmosomal...   105   2e-20
gi|41322916|ref|NP_958782.1| plectin 1 isoform 6; hemidesmosomal...   105   2e-20
gi|16975418|pdb|1E6G|A Chain A, A-Spectrin Sh3 Domain A11v, V23l...   104   3e-20
gi|31615297|pdb|1E7O|A Chain A, A-Spectrin Sh3 Domain A11v, V23l...   104   3e-20
gi|21465587|pdb|1H8K|A Chain A, A-Spectrin Sh3 Domain A11v, V23l...   103   5e-20
gi|4558122|pdb|1BK2|  A-Spectrin Sh3 Domain D48g Mutant               103   6e-20
gi|182243|gb|AAA53103.1| erythrocyte alpha-spectrin                   103   8e-20
gi|26336791|dbj|BAC32078.1| unnamed protein product [Mus musculus]    103   8e-20
gi|4504335|ref|NP_003938.1| huntingtin-associated protein intera...   102   1e-19
gi|7512342|pir||T08621 centrosome associated protein CEP250 - hu...   102   2e-19
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ...   101   3e-19
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus]             101   3e-19
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus]              101   3e-19
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL...   101   3e-19
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus]              101   3e-19
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus]              101   3e-19
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus]              101   3e-19
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus]              101   3e-19
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus]              101   3e-19
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus]             101   3e-19
gi|3758911|emb|CAA09870.1| Kakapo [Drosophila melanogaster]           100   4e-19
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...   100   4e-19
gi|7511951|pir||T13714 kakapo gene protein - fruit fly (Drosophi...   100   4e-19
gi|15238181|ref|NP_198994.1| COP1-interactive protein 1 / CIP1 [...   100   5e-19
gi|2345082|gb|AAC02792.1| beta-spectrin [Homo sapiens]                100   7e-19
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap...   100   7e-19
gi|47218355|emb|CAG04187.1| unnamed protein product [Tetraodon n...   100   9e-19
gi|34881930|ref|XP_347351.1| similar to dystrophin major muscle ...    99   2e-18
gi|34880638|ref|XP_229016.2| similar to dystrophin major muscle ...    99   2e-18
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL...    99   2e-18
gi|24584806|ref|NP_609835.2| CG5020-PA [Drosophila melanogaster]...    98   3e-18
gi|45552035|ref|NP_788072.2| CG5020-PD [Drosophila melanogaster]...    98   3e-18
gi|28574245|ref|NP_724047.2| CG5020-PB [Drosophila melanogaster]...    98   3e-18
gi|24584810|ref|NP_724048.1| CG5020-PC [Drosophila melanogaster]...    98   3e-18
gi|17552086|ref|NP_499140.1| calcium-binding EF-hand containing ...    97   4e-18
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi...    97   4e-18
gi|49068184|ref|XP_398381.1| hypothetical protein UM00766.1 [Ust...    97   6e-18
gi|4502443|ref|NP_001714.1| bullous pemphigoid antigen 1 isoform...    97   6e-18
gi|29561802|emb|CAD87820.1| SI:dZ230D15.1 (novel protein similar...    97   8e-18
gi|23508159|ref|NP_700829.1| liver stage antigen, putative [Plas...    97   8e-18
gi|47224100|emb|CAG12929.1| unnamed protein product [Tetraodon n...    96   1e-17
gi|32411607|ref|XP_326284.1| hypothetical protein [Neurospora cr...    96   1e-17
gi|7442004|pir||G02520 plectin - human >gnl|BL_ORD_ID|215627 gi|...    96   1e-17
gi|48425543|pdb|1S35|A Chain A, Crystal Structure Of Repeats 8 A...    96   2e-17
gi|2119533|pir||I52300 giantin - human >gnl|BL_ORD_ID|1705043 gi...    95   3e-17
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic...    95   3e-17
gi|34880575|ref|XP_229019.2| similar to dystrophin major muscle ...    94   4e-17
gi|31227668|ref|XP_317923.1| ENSANGP00000011373 [Anopheles gambi...    94   4e-17
gi|31873814|emb|CAD97849.1| hypothetical protein [Homo sapiens]        94   6e-17
gi|4758454|ref|NP_004478.1| golgi autoantigen, golgin subfamily ...    93   8e-17
gi|46125813|ref|XP_387460.1| hypothetical protein FG07284.1 [Gib...    92   1e-16
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl...    92   2e-16
gi|31216104|ref|XP_316167.1| ENSANGP00000020328 [Anopheles gambi...    92   2e-16
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc...    91   3e-16
gi|38344252|emb|CAE04334.2| OSJNBa0008M17.5 [Oryza sativa (japon...    91   4e-16
gi|47202533|emb|CAF87908.1| unnamed protein product [Tetraodon n...    91   5e-16
gi|3986196|dbj|BAA34955.1| myosin heavy chain [Dugesia japonica]       90   9e-16
gi|27477057|ref|NP_598541.2| translocated promoter region protei...    89   1e-15
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy...    89   2e-15
gi|1827866|pdb|1TUC|  Alpha-Spectrin Src Homology 3 Domain, Circ...    89   2e-15
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa...    88   4e-15
gi|13549164|gb|AAK29675.1| alpha-spectrin [Gallus gallus]              87   5e-15
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom...    86   1e-14
gi|28193204|emb|CAD62344.1| unnamed protein product [Homo sapiens]     86   1e-14
gi|50796692|ref|XP_428221.1| PREDICTED: similar to beta4-spectri...    86   1e-14
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle...    86   1e-14
gi|49111879|ref|XP_411844.1| hypothetical protein AN7707.2 [Aspe...    86   2e-14
gi|15193244|gb|AAK91740.1| axoneme-associated protein GASP-180 [...    85   2e-14
gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens]            85   2e-14
gi|5032313|ref|NP_004014.1| dystrophin Dp140bc isoform; dystroph...    85   2e-14
gi|109322|pir||A41604 myosin heavy chain, smooth muscle, long sp...    85   2e-14
gi|1346644|sp|P35748|MYHB_RABIT Myosin heavy chain, smooth muscl...    85   2e-14
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11...    85   2e-14
gi|5032307|ref|NP_004011.1| dystrophin Dp140c isoform; dystrophi...    85   2e-14
gi|5032311|ref|NP_004013.1| dystrophin Dp140ab isoform; dystroph...    85   2e-14
gi|5032309|ref|NP_004012.1| dystrophin Dp140b isoform; dystrophi...    85   2e-14
gi|7416982|gb|AAF62394.1| myosin heavy chain cardiac muscle spec...    85   2e-14
gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial)...    85   2e-14
gi|13124875|ref|NP_074035.1| smooth muscle myosin heavy chain 11...    85   2e-14
gi|5032293|ref|NP_004004.1| dystrophin Dp140 isoform; dystrophin...    85   2e-14
gi|50734763|ref|XP_419004.1| PREDICTED: similar to triple functi...    85   2e-14
gi|1408194|gb|AAB03661.1| myosin heavy chain [Placopecten magell...    85   3e-14
gi|17227154|gb|AAL38031.1| myocyte inner nuclear membrane protei...    85   3e-14
gi|11276951|pir||A59287 myosin heavy chain - fluke (Schistosoma ...    84   4e-14
gi|497653|gb|AAC46490.1| myosin heavy chain >gnl|BL_ORD_ID|76853...    84   5e-14
gi|7416979|gb|AAF62391.1| myosin heavy chain striated muscle spe...    84   5e-14
gi|7416983|gb|AAF62395.1| myosin heavy chain cardiac muscle spec...    84   5e-14
gi|7416980|gb|AAF62392.1| myosin heavy chain catch (smooth) musc...    84   5e-14
gi|1408192|gb|AAB03660.1| myosin heavy chain [Placopecten magell...    84   5e-14
gi|127773|sp|P24733|MYS_AEQIR Myosin heavy chain, striated muscl...    84   5e-14
gi|236789|gb|AAB19995.1| myosin heavy chain=rod region [Aequipec...    84   5e-14
gi|48143056|ref|XP_397404.1| similar to dystrophin-like protein ...    84   7e-14
gi|10863905|ref|NP_004230.1| thyroid hormone receptor interactor...    84   7e-14
gi|50744838|ref|XP_419899.1| PREDICTED: similar to bullous pemph...    83   9e-14
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus]          83   1e-13
gi|20070691|gb|AAH26142.1| Myh11 protein [Mus musculus]                83   1e-13
gi|127743|sp|P02566|MYSB_CAEEL Myosin heavy chain B (MHC B) >gnl...    82   1e-13
gi|38110842|gb|EAA56504.1| hypothetical protein MG06475.4 [Magna...    82   1e-13
gi|1304604|gb|AAB01089.1| alpha-actinin                                82   1e-13
gi|17509401|ref|NP_493596.1| UNCoordinated locomotion UNC-54, en...    82   1e-13
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica]       82   2e-13
gi|1827865|pdb|1TUD|  Alpha-Spectrin Src Homology 3 Domain, Circ...    82   2e-13
gi|32441707|emb|CAD67583.1| putative utrophin [Takifugu rubripes]      82   2e-13
gi|2253417|gb|AAD09135.1| Trip230 [Homo sapiens]                       82   3e-13
gi|47224613|emb|CAG03597.1| unnamed protein product [Tetraodon n...    82   3e-13
gi|18652658|gb|AAD28718.2| myosin heavy chain A [Schmidtea medit...    81   3e-13
gi|20891813|ref|XP_147228.1| myosin heavy chain 11, smooth muscl...    81   4e-13
gi|50510675|dbj|BAD32323.1| mKIAA0866 protein [Mus musculus]           81   4e-13
gi|21754039|dbj|BAC04449.1| unnamed protein product [Homo sapiens]     81   4e-13
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut...    81   4e-13
gi|49523259|gb|AAH75407.1| Unknown (protein for MGC:89159) [Xeno...    80   6e-13
gi|44890896|dbj|BAD12120.1| SPTAN1 [Sus scrofa]                        80   1e-12
gi|47219799|emb|CAG03426.1| unnamed protein product [Tetraodon n...    80   1e-12
gi|13431707|sp|Q28641|MYH4_RABIT Myosin heavy chain, skeletal mu...    80   1e-12
gi|29351639|gb|AAH49289.1| SYNE1 protein [Xenopus laevis]              79   1e-12
gi|20357504|ref|NP_065121.2| bullous pemphigoid antigen 1 isofor...    79   1e-12
gi|41350836|gb|AAH65536.1| DST protein [Homo sapiens]                  79   1e-12
gi|39588011|emb|CAE57242.1| Hypothetical protein CBG00120 [Caeno...    79   2e-12
gi|1777305|dbj|BAA19070.1| myosin heavy chain [Theragra chalcogr...    79   2e-12
gi|382658|prf||1819485A CENP-E protein                                 79   2e-12
gi|3041707|sp|P13535|MYH8_HUMAN Myosin heavy chain, skeletal mus...    79   2e-12
gi|2119300|pir||I38055 myosin heavy chain, perinatal skeletal mu...    79   2e-12
gi|4505301|ref|NP_002463.1| myosin, heavy polypeptide 8, skeleta...    79   2e-12
gi|50740550|ref|XP_419492.1| PREDICTED: similar to Spectrin beta...    79   2e-12
gi|30315935|sp|Q8WXK8|BPEB_HUMAN Bullous pemphigoid antigen 1, i...    79   2e-12
gi|2345079|gb|AAC02789.1| beta-spectrin [Homo sapiens]                 78   3e-12
gi|27803037|emb|CAD60740.1| unnamed protein product [Podospora a...    78   3e-12
gi|28972888|dbj|BAC65860.1| mKIAA3005 protein [Mus musculus]           78   4e-12
gi|20302065|ref|NP_620240.1| golgi-associated protein GCP360 [Ra...    78   4e-12
gi|33598964|ref|NP_780469.1| myosin heavy chain 10, non-muscle; ...    78   4e-12
gi|20521726|dbj|BAA76855.2| KIAA1011 protein [Homo sapiens]            78   4e-12
gi|47208995|emb|CAF91401.1| unnamed protein product [Tetraodon n...    77   5e-12
gi|32407187|ref|XP_324183.1| hypothetical protein [Neurospora cr...    77   5e-12
gi|33624848|ref|NP_055995.3| synaptic nuclei expressed gene 2 is...    77   5e-12
gi|24417711|gb|AAN60443.1| nesprin-2 [Homo sapiens]                    77   5e-12
gi|4417214|dbj|BAA36971.1| smooth muscle myosin heavy chain [Hom...    77   5e-12
gi|17861384|gb|AAL33802.1| nesprin-2 gamma [Homo sapiens]              77   5e-12
gi|47216758|emb|CAG03762.1| unnamed protein product [Tetraodon n...    77   5e-12
gi|47208842|emb|CAF94383.1| unnamed protein product [Tetraodon n...    77   5e-12
gi|17016967|gb|AAL33548.1| NUANCE [Homo sapiens]                       77   5e-12
gi|29839588|sp|Q8WXH0|SNE2_HUMAN Nesprin 2 (Nuclear envelope spe...    77   5e-12
gi|11276954|pir||A59234 slow myosin heavy chain 3 - quail >gnl|B...    77   5e-12
gi|33624879|ref|NP_878918.1| synaptic nuclei expressed gene 2 is...    77   5e-12


>gi|17569483|ref|NP_508537.1| spectrin (spc-1) [Caenorhabditis
            elegans]
 gi|7441356|pir||T16613 hypothetical protein K10B3.10 - Caenorhabditis
            elegans
 gi|1206048|gb|AAB53876.1| Spectrin protein 1 [Caenorhabditis elegans]
          Length = 2427

 Score = 4681 bits (12142), Expect = 0.0
 Identities = 2370/2427 (97%), Positives = 2370/2427 (97%)
 Frame = -1

Query: 7284 MADSNDTHAXXXXXXXXXXPQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA 7105
            MADSNDTHA          PQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA
Sbjct: 1    MADSNDTHAPPEPVLEVPPPQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA 60

Query: 7104 RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD 6925
            RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD
Sbjct: 61   RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD 120

Query: 6924 KTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILY 6745
            KTGNAMIQHNHFASEHIKKRLEELHALW         KGIKLQQALKLLHFIRQCDEILY
Sbjct: 121  KTGNAMIQHNHFASEHIKKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEILY 180

Query: 6744 WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 6565
            WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH
Sbjct: 181  WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 240

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY
Sbjct: 241  DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 300

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
            GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW
Sbjct: 301  GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 360

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
            NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH
Sbjct: 361  NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 420

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
            QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY
Sbjct: 421  QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 480

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
            EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI
Sbjct: 481  EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 540

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
            NALDEFATKLIQGQHYAADDVAE                  RGNALKESYKRQTFDRDCD
Sbjct: 541  NALDEFATKLIQGQHYAADDVAERRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCD 600

Query: 5484 EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 5305
            EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH
Sbjct: 601  EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 660

Query: 5304 FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 5125
            FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS
Sbjct: 661  FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 720

Query: 5124 EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 4945
            EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ
Sbjct: 721  EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 780

Query: 4944 QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 4765
            QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI
Sbjct: 781  QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 840

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 4585
            KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR
Sbjct: 841  KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 900

Query: 4584 TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 4405
            TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK
Sbjct: 901  TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 960

Query: 4404 GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW 4225
            GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW
Sbjct: 961  GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW 1020

Query: 4224 WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK 4045
            WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK
Sbjct: 1021 WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK 1080

Query: 4044 LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR 3865
            LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR
Sbjct: 1081 LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR 1140

Query: 3864 LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRD 3685
            LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRAL         QLGSAHEVQRFHRD
Sbjct: 1141 LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQRFHRD 1200

Query: 3684 VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ 3505
            VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ
Sbjct: 1201 VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ 1260

Query: 3504 SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL 3325
            SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL
Sbjct: 1261 SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL 1320

Query: 3324 VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 3145
            VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ
Sbjct: 1321 VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 1380

Query: 3144 GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL 2965
            GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL
Sbjct: 1381 GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL 1440

Query: 2964 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
            IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK
Sbjct: 1441 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 1500

Query: 2784 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS 2605
            RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS
Sbjct: 1501 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS 1560

Query: 2604 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 2425
            DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF
Sbjct: 1561 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 1620

Query: 2424 MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADS 2245
            MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADS
Sbjct: 1621 MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADS 1680

Query: 2244 LLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK 2065
            LLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK
Sbjct: 1681 LLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK 1740

Query: 2064 KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ 1885
            KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ
Sbjct: 1741 KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ 1800

Query: 1884 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE 1705
            IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE
Sbjct: 1801 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE 1860

Query: 1704 NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE 1525
            NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE
Sbjct: 1861 NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE 1920

Query: 1524 IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1345
            IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA
Sbjct: 1921 IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1980

Query: 1344 FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXX 1165
            FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARR
Sbjct: 1981 FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRQKLL 2040

Query: 1164 XXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL 985
                   QIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL
Sbjct: 2041 KMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL 2100

Query: 984  SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQ 805
            SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQ
Sbjct: 2101 SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQ 2160

Query: 804  EENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIE 625
            EENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIE
Sbjct: 2161 EENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIE 2220

Query: 624  EKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALR 445
            EKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALR
Sbjct: 2221 EKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALR 2280

Query: 444  EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV 265
            EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV
Sbjct: 2281 EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV 2340

Query: 264  TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMK 85
            TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMK
Sbjct: 2341 TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMK 2400

Query: 84   PYMDAISGRSIQGGLDYEQFVHALFQS 4
            PYMDAISGRSIQGGLDYEQFVHALFQS
Sbjct: 2401 PYMDAISGRSIQGGLDYEQFVHALFQS 2427


>gi|39597692|emb|CAE68383.1| Hypothetical protein CBG14139
            [Caenorhabditis briggsae]
          Length = 2427

 Score = 4576 bits (11869), Expect = 0.0
 Identities = 2312/2427 (95%), Positives = 2340/2427 (96%)
 Frame = -1

Query: 7284 MADSNDTHAXXXXXXXXXXPQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA 7105
            MADSNDTHA          PQEIRILETADDI QRRQEVLGHYS+FKDHSQTKRDRLEEA
Sbjct: 1    MADSNDTHAPPEPVLEVPPPQEIRILETADDIQQRRQEVLGHYSLFKDHSQTKRDRLEEA 60

Query: 7104 RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD 6925
            RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD
Sbjct: 61   RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD 120

Query: 6924 KTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILY 6745
            KTGNAMIQHNHFAS+HIK+RLEELHALW         KGIKLQQALKLLHFIRQCDE+LY
Sbjct: 121  KTGNAMIQHNHFASDHIKRRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEVLY 180

Query: 6744 WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 6565
            WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKEL NHQYRINEIN AADKLVEEGHSEH
Sbjct: 181  WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELNNHQYRINEINGAADKLVEEGHSEH 240

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            DQIYKKRDDVNDAWHRLNTLA TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY
Sbjct: 241  DQIYKKRDDVNDAWHRLNTLAVTRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 300

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
            GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEA KLAETHPDR EAIHQKND T++AW
Sbjct: 301  GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAVKLAETHPDRGEAIHQKNDSTRSAW 360

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
            NALK KAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH
Sbjct: 361  NALKNKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 420

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
            QEHKGEIDARADSFNQTA+AGQKLVEMGIPESPEV+EKLEKL+ EKSSLLGLWEERRILY
Sbjct: 421  QEHKGEIDARADSFNQTAAAGQKLVEMGIPESPEVREKLEKLEAEKSSLLGLWEERRILY 480

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
            EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI
Sbjct: 481  EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 540

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
            NALDEFATKLIQGQHYAADDVA+                  RGNALKESYKRQTFDRDCD
Sbjct: 541  NALDEFATKLIQGQHYAADDVAKRRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCD 600

Query: 5484 EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 5305
            EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQEL+ANENRLDDIRSTGEQII+SGH
Sbjct: 601  EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELRANENRLDDIRSTGEQIIESGH 660

Query: 5304 FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 5125
            FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVE WLSELEGQVAS
Sbjct: 661  FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVELWLSELEGQVAS 720

Query: 5124 EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 4945
            EDYGKDLVSVQNLQKKIGL+ESDFNAHNDRVDGI+ LAQQF +EEHFNAPVI+RKQE LQ
Sbjct: 721  EDYGKDLVSVQNLQKKIGLLESDFNAHNDRVDGIRNLAQQFHQEEHFNAPVIIRKQEALQ 780

Query: 4944 QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 4765
            QRYNALRDPLEKRKRKLGES QGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI
Sbjct: 781  QRYNALRDPLEKRKRKLGESLQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 840

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 4585
            KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR
Sbjct: 841  KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 900

Query: 4584 TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 4405
             +LDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK
Sbjct: 901  GELDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 960

Query: 4404 GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW 4225
            GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASN+DW
Sbjct: 961  GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNKDW 1020

Query: 4224 WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK 4045
            WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK
Sbjct: 1021 WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK 1080

Query: 4044 LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR 3865
            LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR
Sbjct: 1081 LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR 1140

Query: 3864 LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRD 3685
            LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRAL         QLGSAHEVQRFHRD
Sbjct: 1141 LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQRFHRD 1200

Query: 3684 VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ 3505
            VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ
Sbjct: 1201 VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ 1260

Query: 3504 SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL 3325
            SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL
Sbjct: 1261 SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL 1320

Query: 3324 VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 3145
            VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ
Sbjct: 1321 VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 1380

Query: 3144 GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL 2965
            GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL
Sbjct: 1381 GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL 1440

Query: 2964 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
            IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK
Sbjct: 1441 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 1500

Query: 2784 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS 2605
            R KLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS
Sbjct: 1501 RSKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS 1560

Query: 2604 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 2425
            DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF
Sbjct: 1561 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 1620

Query: 2424 MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADS 2245
            MAAVKDLEFWLGEVEILLQS DYGKDLASVENLLKKHSLLEADI AHQDRVGEMNEQADS
Sbjct: 1621 MAAVKDLEFWLGEVEILLQSADYGKDLASVENLLKKHSLLEADITAHQDRVGEMNEQADS 1680

Query: 2244 LLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK 2065
            LLENDQFQGQQIAERRKLIADRYDGVKKMA DRRDKLSKALNVHQFFRDIDDEESWIKEK
Sbjct: 1681 LLENDQFQGQQIAERRKLIADRYDGVKKMAADRRDKLSKALNVHQFFRDIDDEESWIKEK 1740

Query: 2064 KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ 1885
            KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ
Sbjct: 1741 KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ 1800

Query: 1884 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE 1705
            IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFG+
Sbjct: 1801 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGD 1860

Query: 1704 NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE 1525
            NMAGVQGLLKKHDTFQVDLELHKQRVADLI KGD LI NGNHHAPHI+QRCDQLRARL+E
Sbjct: 1861 NMAGVQGLLKKHDTFQVDLELHKQRVADLIGKGDDLIQNGNHHAPHIRQRCDQLRARLVE 1920

Query: 1524 IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1345
            IESMAE RLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA
Sbjct: 1921 IESMAEKRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1980

Query: 1344 FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXX 1165
            FDAGLNAFEHEGIQRITELKDQLV S HQQSPAIEKRHTNVIQRWQNLL+HSEARR
Sbjct: 1981 FDAGLNAFEHEGIQRITELKDQLVHSSHQQSPAIEKRHTNVIQRWQNLLSHSEARRQKLL 2040

Query: 1164 XXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL 985
                   QIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAH EFQRSL
Sbjct: 2041 KMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHAEFQRSL 2100

Query: 984  SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQ 805
            SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELA+EHQRQ
Sbjct: 2101 SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAKEHQRQ 2160

Query: 804  EENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIE 625
            EENDKLRREFAKLANAFH WLTNTRQEMMEAGGTLEEQLDAVE+KAKEIKANK QLRQIE
Sbjct: 2161 EENDKLRREFAKLANAFHTWLTNTRQEMMEAGGTLEEQLDAVEKKAKEIKANKVQLRQIE 2220

Query: 624  EKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALR 445
            +KGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGV+EEALR
Sbjct: 2221 DKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVTEEALR 2280

Query: 444  EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV 265
            EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV
Sbjct: 2281 EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV 2340

Query: 264  TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMK 85
            TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCI+RMK
Sbjct: 2341 TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIKRMK 2400

Query: 84   PYMDAISGRSIQGGLDYEQFVHALFQS 4
            PY D ISGR+IQGGLDYEQFVHALFQS
Sbjct: 2401 PYTDTISGRAIQGGLDYEQFVHALFQS 2427


>gi|31218879|ref|XP_316724.1| ENSANGP00000002653 [Anopheles gambiae]
 gi|21299655|gb|EAA11800.1| ENSANGP00000002653 [Anopheles gambiae str.
            PEST]
          Length = 2417

 Score = 3031 bits (7858), Expect = 0.0
 Identities = 1499/2414 (62%), Positives = 1873/2414 (77%), Gaps = 7/2414 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEK 7045
            +E+RILE+A+DI +RR +VL  YS FK  ++ KR++LE++R+FQYFKRD+DEL  WI EK
Sbjct: 7    KEVRILESAEDIQERRDQVLNRYSEFKLETRQKREKLEDSRRFQYFKRDSDELESWINEK 66

Query: 7044 LQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKR 6865
            LQ A EE++RDP+NLQAKIQKH+AFEAEV AH+  I  LD TG  MI   HFASE I++R
Sbjct: 67   LQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVVLDNTGQEMINQGHFASETIQRR 126

Query: 6864 LEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEH 6685
            LEEL  LW         KG+KLQQAL L+ F+R C+E+++WI++KE +VTA++ G DLEH
Sbjct: 127  LEELQRLWELLLSRLAEKGMKLQQALVLVQFLRHCEEVMFWIKDKEAFVTADEFGQDLEH 186

Query: 6684 VEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTL 6505
            VE+LQRKFD+F K++ + +YR+ E+N+ ADKL+  GH E + I +K++++N+AW RL  L
Sbjct: 187  VEVLQRKFDEFQKDMASQEYRVTEVNELADKLLFGGHPERETITRKKEELNEAWQRLKQL 246

Query: 6504 AATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERD 6325
            A  R+E LFGAH++QRFNRDADET+AWI EKD+ LSSDDYGRDL +VQALQRKHEG ERD
Sbjct: 247  AILRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERD 306

Query: 6324 LAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQL 6145
            LAALE K+  L  EA +L   H D +E I +K  +  A W +L  KA+ RK  L+ S+ L
Sbjct: 307  LAALEDKVAALGTEAGRLCSIHADHSEQIREKQAEIAAYWQSLTAKAKERKQKLDESYFL 366

Query: 6144 HRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASA 5965
            HRFLAD+RDL+SWI  MKA+I ADELAKDVAGAEALLE HQEHKGEIDAR DSF  T  A
Sbjct: 367  HRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDARVDSFKLTTEA 426

Query: 5964 GQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWM 5785
            G++L+E     + EVQEKL  L+++KSSLL LWE+RRILYEQCMDLQLFYRDTEQA+TWM
Sbjct: 427  GRQLLEREHYAAAEVQEKLAALENDKSSLLVLWEDRRILYEQCMDLQLFYRDTEQADTWM 486

Query: 5784 NKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADD 5605
             KQEAFLAN DLGDSLDSVE LIKKHEDFEKSLAAQEEKI ALD FATKLI GQHYAADD
Sbjct: 487  AKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDVFATKLIDGQHYAADD 546

Query: 5604 VAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLD 5425
            VA+                  R   L++S   Q F+RDCDE   WI+EKL  A DDSYLD
Sbjct: 547  VAQRRAMLLARRSALQEKSSVRQKLLEDSNALQQFERDCDETKGWISEKLKFATDDSYLD 606

Query: 5424 PTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
            PTN+ GK+QKH NFE EL AN++R++DI +TG+++    H+AAD +  R++++  LW  L
Sbjct: 607  PTNLNGKVQKHTNFEHELTANKSRIEDITATGQELATKEHYAADKVNARMQEIVTLWESL 666

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
            V A++KKG KL+EA  +QQFNR +ED+E WLSE+EGQ+ SEDYGKDL SVQNLQKK  L+
Sbjct: 667  VRASDKKGCKLQEASQQQQFNRTVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKQALL 726

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
            E+D  AH DR++GIK  A +F E  HF+A  I  K+  L +RY AL +P+  RK++L +S
Sbjct: 727  EADVMAHQDRIEGIKVAANKFVESGHFDADNIRAKEAALSKRYAALAEPMSIRKQRLLDS 786

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
             Q  QLFRD+EDE AWIREKE VA STNRGRDLIGVQNLIKK QA++AEI NH+S+   V
Sbjct: 787  LQVQQLFRDLEDEAAWIREKEPVAASTNRGRDLIGVQNLIKKHQAVLAEINNHESRCAGV 846

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
             S    M+ +    + EI+ +L  L+D W  LK K+ +R+ DL+DSLQAHQY +DANEA+
Sbjct: 847  ISNGEQMLNEQPTASEEIKLRLDALKDQWNSLKEKSNQRKQDLEDSLQAHQYFADANEAE 906

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM 4345
            +WM EKEPIV + DYGKDEDS+EALLKKH AL+SDLEAF  TI+ L++QA  C+ QE P+
Sbjct: 907  SWMREKEPIVSNQDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPV 966

Query: 4344 GQL-GRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKR 4168
              + G++CV+ALYDY EKSPREVSMKK DVLTLLN++N+DWWKVEVNDRQGFVPAAY+K+
Sbjct: 967  VDITGKECVMALYDYTEKSPREVSMKKNDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKK 1026

Query: 4167 IEPG-TAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
            I+PG +A Q      +SI  +Q++I  +Y  L+ L   R+ KL E  K Y L+REA DLA
Sbjct: 1027 IDPGLSASQQNLIDGHSIAKRQTQINSQYDNLLALARERQNKLNETVKAYVLVREAADLA 1086

Query: 3990 EWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTE 3811
             WIK +E+ A  +++G DLE+VEVLQKKFDDF  DLKANEVRL ++N+IA  LTS+GQTE
Sbjct: 1087 AWIKDKESHAQIKDVGEDLEEVEVLQKKFDDFNDDLKANEVRLAKLNEIAIQLTSLGQTE 1146

Query: 3810 TAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSE 3631
             A++I+ QI+ LN  W  L         QLGSAHEVQRFHRDVDET+DWI EK++AL+++
Sbjct: 1147 AALKIKTQIQTLNEEWATLQTITQERASQLGSAHEVQRFHRDVDETKDWIAEKENALNND 1206

Query: 3630 DFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNE 3451
            + G+DLR VQ LQRKHEG+ERDLAAL DKI+ LDE ANRL QSHP+ AEQ Y  Q+E+NE
Sbjct: 1207 ELGKDLRGVQTLQRKHEGLERDLAALQDKIRQLDETANRLMQSHPDTAEQTYAKQKEINE 1266

Query: 3450 QWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLE 3271
            +W ++ +KA  RKEKLLDSYD QRFLSDYRDL  WI+SM  LV+S+ELANDVTGAEAL+E
Sbjct: 1267 EWQQVVTKAQQRKEKLLDSYDLQRFLSDYRDLSAWISSMMGLVTSEELANDVTGAEALIE 1326

Query: 3270 RHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRN 3091
            RHQE+RTE+D+RA TF AF+QFGN+LL ++HYAA +I+ +++ +N+AR+ LE AW ARR
Sbjct: 1327 RHQEHRTEVDARAGTFSAFEQFGNELLQANHYAAPEIQEKIENLNKAREELERAWTARRL 1386

Query: 3090 ILDQCLELQLFYRDCEQADTWMSAREAFLAQE--DPSGDNVESLIKKHEDFDKAINTQEE 2917
             LDQ L+LQL+ RDCEQA+ WMSAREAFL  E  D  GDNVE+LIKKHEDFDKAIN  EE
Sbjct: 1387 QLDQNLDLQLYLRDCEQAENWMSAREAFLNAEEVDSKGDNVEALIKKHEDFDKAINGHEE 1446

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            KI  L++ A+ LI   HY    +  KR ++LDRW  LKE LI+KR +LG+ QTLQQFSRD
Sbjct: 1447 KIGALQVLADQLIAQEHYAGRLIDAKRQEVLDRWRHLKEDLIEKRSRLGDEQTLQQFSRD 1506

Query: 2736 ADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIEN 2557
            ADEIENW+ EK Q+A EE+Y+DP NIQ KHQK QAFEAEL AN+DRI++++  G+NLI+
Sbjct: 1507 ADEIENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRISSVLAMGSNLIDR 1566

Query: 2556 AKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEI 2377
             +C G E AV  RL  + DQW+ L + TTEKS +LKEANKQ++++AAVKDL+FWLGEVE
Sbjct: 1567 NQCSGSEEAVQKRLTQIADQWEYLTQKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVES 1626

Query: 2376 LLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            LL SED GKDLASV+NL+KKH L+EADI AH+DR+ +MN QADSL+E+ QF    I E+R
Sbjct: 1627 LLTSEDAGKDLASVQNLMKKHQLVEADIHAHEDRIKDMNSQADSLVESGQFDSAGIQEKR 1686

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
            + I +RY+ ++ +A  R+ +L++A  +HQFFRDI DEESWIKEKKLLV SDDYGRDL GV
Sbjct: 1687 QSINERYERIRNLAAHRQARLNEANTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGV 1746

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
            QNL++KH+R++ ELASHEP +  V+  GE+L+  +    +G  +I++R++ L Q+W +++
Sbjct: 1747 QNLKKKHKRLEAELASHEPAIQAVQEAGEKLMDVS---NLGVPEIEQRLKALNQAWTELK 1803

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
             L   R Q+LDES  +Q FL  VEEEEAW+ EKQQ+L  +++G++MA VQGL+KKHD F+
Sbjct: 1804 GLAATRGQKLDESLIYQQFLAKVEEEEAWITEKQQLLSVEDYGDSMAAVQGLMKKHDAFE 1863

Query: 1656 VDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNS 1477
             D  +H+ R +D+ + G TL+ N NHH   I QRC QL  +L  ++++A  R   L DN
Sbjct: 1864 TDFAVHRDRCSDIRDHGQTLVTNNNHHGDSISQRCVQLDKKLENLQALATRRKTALMDNF 1923

Query: 1476 AYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRI 1297
            AYLQFMWK DVVESWIA+KE  V+SE+FGRDLS+VQ LLTKQE FDAGL+AFEHEGI  I
Sbjct: 1924 AYLQFMWKADVVESWIADKENHVKSEEFGRDLSTVQTLLTKQETFDAGLSAFEHEGIHNI 1983

Query: 1296 TELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAF 1117
            T LKDQL+++ H QS AI KRH +V+ RWQ L A SEAR+           QIE+LYL F
Sbjct: 1984 TALKDQLINANHAQSAAILKRHEDVLTRWQKLRADSEARKYRLLNMQDQFRQIEDLYLTF 2043

Query: 1116 AKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRR 937
            AKKAS FNSWFENAEEDLTDPVRCNS+EEI+ALR+AH  FQ SLSSA+ DF+ L  LD++
Sbjct: 2044 AKKASAFNSWFENAEEDLTDPVRCNSIEEIKALREAHAAFQASLSSAQVDFQALAALDQK 2103

Query: 936  IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANA 757
            IKSFNVGPNPYTWFTM+ALEDTWRNLQ+II+ER+ ELA+E  RQEENDKLR+EFAK AN
Sbjct: 2104 IKSFNVGPNPYTWFTMEALEDTWRNLQKIIEERDAELAKEVHRQEENDKLRKEFAKHANL 2163

Query: 756  FHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY 577
            FH WLT TR  +M+  G+LEEQ +A+  KA EI+A +G L++IEE GA LE +LILDNRY
Sbjct: 2164 FHQWLTETRTSLMDGSGSLEEQFEALCHKANEIRARRGDLKKIEELGATLEEHLILDNRY 2223

Query: 576  TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGR 397
            TEHSTVG+AQ WDQLDQLAMRMQHNL+QQIQARNQSGVSE++L+EFSMMFKHFDK+K+G+
Sbjct: 2224 TEHSTVGLAQQWDQLDQLAMRMQHNLKQQIQARNQSGVSEDSLKEFSMMFKHFDKDKSGK 2283

Query: 396  LDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETEN 217
            L+HQ+FKSCLRALGYDLPMV+EGQP+PEF+ IL++VDPNRDG V+LQEY+AFMISKETEN
Sbjct: 2284 LNHQEFKSCLRALGYDLPMVEEGQPDPEFEEILNVVDPNRDGQVSLQEYIAFMISKETEN 2343

Query: 216  IQSSEEIEMAFRALSKEF---RPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQG 46
            +QS EEIE AFRA++      RPYVT EELY+NLT + A++C++RMKPY D  +G  I G
Sbjct: 2344 VQSFEEIENAFRAITASDPRPRPYVTKEELYSNLTKDMADYCVQRMKPYNDPKTGHPITG 2403

Query: 45   GLDYEQFVHALFQS 4
             LDY +F   LFQ+
Sbjct: 2404 ALDYVEFTRTLFQN 2417


>gi|17136504|ref|NP_476739.1| CG1977-PA [Drosophila melanogaster]
 gi|14424461|sp|P13395|SPCA_DROME Spectrin alpha chain
 gi|7292157|gb|AAF47569.1| CG1977-PA [Drosophila melanogaster]
          Length = 2415

 Score = 3030 bits (7855), Expect = 0.0
 Identities = 1498/2412 (62%), Positives = 1870/2412 (77%), Gaps = 5/2412 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEK 7045
            +E++ILET +DI +RR++VL  Y+ FK  ++ KR++LE++R+FQYFKRDADEL  WI EK
Sbjct: 7    KEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEK 66

Query: 7044 LQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKR 6865
            LQ A EE++RDP+NLQAKIQKH+AFEAEV AH+  I +LD TG  MI   HFASE I+ R
Sbjct: 67   LQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVR 126

Query: 6864 LEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEH 6685
            L+ELH LW         KG+KLQQAL L+ F+RQC+E+++WI++KET+VTA++ G DLEH
Sbjct: 127  LDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEH 186

Query: 6684 VEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTL 6505
            VE+LQRKFD+F K++ + +YR+ E+NQ ADKLV++GH E D I K+++++N+AW RL  L
Sbjct: 187  VEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQL 246

Query: 6504 AATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERD 6325
            A  R+E LFGAH++QRFNRDADET+AWI EKD+ LSSDDYGRDL +VQALQRKHEG ERD
Sbjct: 247  AIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERD 306

Query: 6324 LAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQL 6145
            LAALE K+  L  EA +L   H D ++ I  K  +    W +L  KA+ RK  L+ S+ L
Sbjct: 307  LAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYL 366

Query: 6144 HRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASA 5965
            HRFLAD+RDL+SWI  MKA+I ADELAKDVAGAEALLE HQEHKGEIDAR DSF  T  +
Sbjct: 367  HRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTES 426

Query: 5964 GQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWM 5785
            GQKL+E     + E+QEKL  L+++KSSLL LWE+RRILYEQCMDLQLFYRDTEQA+TWM
Sbjct: 427  GQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWM 486

Query: 5784 NKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADD 5605
             KQEAFLAN DLGDSLDSVE LIKKHEDFEKSLAAQEEKI ALD FATKLI GQHYAADD
Sbjct: 487  AKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADD 546

Query: 5604 VAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLD 5425
            VA+                  R   L++S + Q F+RDCDE   WI+EKL  A DDSYLD
Sbjct: 547  VAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLD 606

Query: 5424 PTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
            PTN+ GK+QKH NFE EL AN++R++DI + G ++I+  H+AAD I  R++++  LW  L
Sbjct: 607  PTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETL 666

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
            V A++KKG KL EA  +QQFNR IED+E WLSE+EGQ+ SED+GKDL SVQNLQKK  L+
Sbjct: 667  VQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALL 726

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
            E+D  AH DR++ IK  A +F E  HF+A  I  K+ NL  RY AL  P+ +RK+ L +S
Sbjct: 727  EADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDS 786

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
             Q  QLFRD+EDE AWIREKE +A STNRGRDLIGVQNLIKK QA++AEI NH++++ +V
Sbjct: 787  LQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNV 846

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
             S+  +M++   F + +IR +L  L++ W  LK K+ +R+ DLDDSLQAHQY +DANEA+
Sbjct: 847  ISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAE 906

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM 4345
            +WM EKEPI   +DYGKDEDS+EALLKKH AL+SDLEAF  TI+ L++QA  C+ QE P+
Sbjct: 907  SWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPV 966

Query: 4344 GQL-GRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKR 4168
              + G++CV+ALYDY EKSPREVSMKKGDVLTLLN++N+DWWKVEVNDRQGFVPAAY+K+
Sbjct: 967  VDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKK 1026

Query: 4167 IEPG-TAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
            I+ G +A Q      +SI  +Q++I  +Y  L+ L   R+ KL E  K Y L+REA DLA
Sbjct: 1027 IDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLA 1086

Query: 3990 EWIKSREAVAAQQEI-GTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQT 3814
            +WI+ +E  A   ++ G DLE+VEVLQKKFDDF  DLKANEVRL  MN+IA  LTS+GQT
Sbjct: 1087 QWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQT 1146

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
            E A++I+ Q++DLN +W  L         QLGSAHEVQRFHRD+DET+DWI EK +AL++
Sbjct: 1147 EAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNN 1206

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
            +D G+DLRSVQ LQRKHEGVERDLAAL DKI+ LDE ANRL QSHP+ AEQ Y  Q+E+N
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W+++ +K+  RKEKLLDSYD QRFLSDYRDL+ WI SM  LV+S ELANDVTGAEAL+
Sbjct: 1267 EMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALI 1326

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+RTEID+RA TF AF+QFGN+LL ++HYA+ +I+ +++ + +AR+ LE AW  RR
Sbjct: 1327 ERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERR 1386

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPS--GDNVESLIKKHEDFDKAINTQE 2920
              L+Q L+LQL+ RDCE A++WMSAREAFL  +D +  G NVE+LIKKHEDFDKAIN  E
Sbjct: 1387 LQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHE 1446

Query: 2919 EKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSR 2740
            +KI  L+  A+ LI  NHY S  V  KR Q+L+RW  LKE LI+KR +LG+ QTLQQFSR
Sbjct: 1447 QKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSR 1506

Query: 2739 DADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIE 2560
            DADEIENW+ EK Q+A EE+Y+DP NIQ KHQK QAFEAEL AN+DRI +++  G NLI+
Sbjct: 1507 DADEIENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLID 1566

Query: 2559 NAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVE 2380
              +C G E AV  RL  + DQW+ L   TTEKS +LKEANKQ++++AAVKDL+FWLGEVE
Sbjct: 1567 KKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVE 1626

Query: 2379 ILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAER 2200
             LL +ED GKDLASV+NL+KKH L+EADIVAH+DR+ +MN QADSL+E+ QF    I E+
Sbjct: 1627 SLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEK 1686

Query: 2199 RKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPG 2020
            R+ I +RY+ +  +A  R+ +L++AL +HQFFRDI DEESWIKEKKLLV SDDYGRDL G
Sbjct: 1687 RQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTG 1746

Query: 2019 VQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQI 1840
            VQNL++KH+R++ EL SHEP +  V+  GE+L+  +    +G  +I++R++ L Q+W ++
Sbjct: 1747 VQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVS---NLGVPEIEQRLKALNQAWAEL 1803

Query: 1839 RDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTF 1660
            ++L   R Q+LDES  +Q FL  VEEEEAW+ EKQQ+L  +++G++MA VQGLLKKHD F
Sbjct: 1804 KNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAF 1863

Query: 1659 QVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDN 1480
            + D   HK R + + ++G  L+   NHH   I QRC QLR +L  + ++A  R   L DN
Sbjct: 1864 ETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDN 1923

Query: 1479 SAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQR 1300
            SAYLQFMWK DVVESWI +KE  VRS++FGRDLS+VQ LLTKQE FDAGLNAFE EGI
Sbjct: 1924 SAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHN 1983

Query: 1299 ITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA 1120
            IT LKDQL+++ H QSPAI KRH +VI RWQ L   S  R+           QIEELYL
Sbjct: 1984 ITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLT 2043

Query: 1119 FAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDR 940
            FAKKAS FNSWFENAEEDLTDPVRCNS+EEIRALRDAH +FQ SLSSAE DF+ L  LD+
Sbjct: 2044 FAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQ 2103

Query: 939  RIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +IKSFNVGPNPYTWFTM+ALE+TWRNLQ+II+ER+ ELA+E +RQEENDKLR+EFAK AN
Sbjct: 2104 KIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHAN 2163

Query: 759  AFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNR 580
             FH WLT TR  MME  G+LE+QL+A+  KA E++A +  L++IEE GA+LE +LILDNR
Sbjct: 2164 LFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNR 2223

Query: 579  YTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTG 400
            YTEHSTVG+AQ WDQLDQL+MRMQHNLEQQIQARN SGVSE++L+EFSMMFKHFDK+K+G
Sbjct: 2224 YTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSG 2283

Query: 399  RLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETE 220
            +L+HQ+FKSCLRALGYDLPMV+EGQP+PEF+ ILD+VDPNRDGYV+LQEY+AFMISKETE
Sbjct: 2284 KLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETE 2343

Query: 219  NIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGL 40
            N+QS EEIE AFRA++   RPYVT EELY NLT + A++C++RMKP+ +  SG+ I+  L
Sbjct: 2344 NVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDAL 2403

Query: 39   DYEQFVHALFQS 4
            DY  F   LFQ+
Sbjct: 2404 DYIDFTRTLFQN 2415


>gi|103399|pir||A33733 spectrin alpha chain - fruit fly (Drosophila
            melanogaster)
 gi|158489|gb|AAA28907.1| alpha-spectrin
          Length = 2415

 Score = 3028 bits (7851), Expect = 0.0
 Identities = 1497/2412 (62%), Positives = 1870/2412 (77%), Gaps = 5/2412 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEK 7045
            +E++ILET +DI +RR++VL  Y+ FK  ++ KR++LE++R+FQYFKRDADEL  WI EK
Sbjct: 7    KEVKILETVEDIQERREQVLSRYNDFKIETRQKREKLEDSRRFQYFKRDADELESWIHEK 66

Query: 7044 LQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKR 6865
            LQ A EE++RDP+NLQAKIQKH+AFEAEV AH+  I +LD TG  MI   HFASE I+ R
Sbjct: 67   LQAASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVR 126

Query: 6864 LEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEH 6685
            L+ELH LW         KG+KLQQAL L+ F+RQC+E+++WI++KET+VTA++ G DLEH
Sbjct: 127  LDELHKLWELLLSRLAEKGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEH 186

Query: 6684 VEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTL 6505
            VE+LQRKFD+F K++ + +YR+ E+NQ ADKLV++GH E D I K+++++N+AW RL  L
Sbjct: 187  VEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRKEELNEAWQRLKQL 246

Query: 6504 AATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERD 6325
            A  R+E LFGAH++QRFNRDADET+AWI EKD+ LSSDDYGRDL +VQALQRKHEG ERD
Sbjct: 247  AIVRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERD 306

Query: 6324 LAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQL 6145
            LAALE K+  L  EA +L   H D ++ I  K  +    W +L  KA+ RK  L+ S+ L
Sbjct: 307  LAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAEIANYWQSLTTKARERKQKLDESYYL 366

Query: 6144 HRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASA 5965
            HRFLAD+RDL+SWI  MKA+I ADELAKDVAGAEALLE HQEHKGEIDAR DSF  T  +
Sbjct: 367  HRFLADFRDLVSWINGMKAIISADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTES 426

Query: 5964 GQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWM 5785
            GQKL+E     + E+QEKL  L+++KSSLL LWE+RRILYEQCMDLQLFYRDTEQA+TWM
Sbjct: 427  GQKLLEREHYAAAEIQEKLAALENDKSSLLSLWEDRRILYEQCMDLQLFYRDTEQADTWM 486

Query: 5784 NKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADD 5605
             KQEAFLAN DLGDSLDSVE LIKKHEDFEKSLAAQEEKI ALD FATKLI GQHYAADD
Sbjct: 487  AKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADD 546

Query: 5604 VAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLD 5425
            VA+                  R   L++S + Q F+RDCDE   WI+EKL  A DDSYLD
Sbjct: 547  VAQRRQMLLARRAALQEKSSKRRQLLEDSNRYQQFERDCDETKGWISEKLKFATDDSYLD 606

Query: 5424 PTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
            PTN+ GK+QKH NFE EL AN++R++DI + G ++I+  H+AAD I  R++++  LW  L
Sbjct: 607  PTNLNGKMQKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETL 666

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
            V A++KKG KL EA  +QQFNR IED+E WLSE+EGQ+ SED+GKDL SVQNLQKK  L+
Sbjct: 667  VQASDKKGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALL 726

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
            E+D  AH DR++ IK  A +F E  HF+A  I  K+ NL  RY AL  P+ +RK+ L +S
Sbjct: 727  EADVMAHQDRIESIKVAANKFIESGHFDADNIRNKEGNLSARYAALAAPMGERKQHLLDS 786

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
             Q  QLFRD+EDE AWIREKE +A STNRGRDLIGVQNLIKK QA++AEI NH++++ +V
Sbjct: 787  LQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGVQNLIKKHQAVLAEINNHEARLLNV 846

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
             S+  +M++   F + +IR +L  L++ W  LK K+ +R+ DLDDSLQAHQY +DANEA+
Sbjct: 847  ISSGENMLKDQPFASDDIRQRLEALQEQWNTLKEKSSQRKQDLDDSLQAHQYFADANEAE 906

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM 4345
            +WM EKEPI   +DYGKDEDS+EALLKKH AL+SDLEAF  TI+ L++QA  C+ QE P+
Sbjct: 907  SWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNTIQALQEQAKNCRQQETPV 966

Query: 4344 GQL-GRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKR 4168
              + G++CV+ALYDY EKSPREVSMKKGDVLTLLN++N+DWWKVEVNDRQGFVPAAY+K+
Sbjct: 967  VDITGKECVVALYDYTEKSPREVSMKKGDVLTLLNSNNKDWWKVEVNDRQGFVPAAYIKK 1026

Query: 4167 IEPG-TAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
            I+ G +A Q      +SI  +Q++I  +Y  L+ L   R+ KL E  K Y L+REA DLA
Sbjct: 1027 IDAGLSASQQNLVDNHSIAKRQNQINSQYDNLLALARERQNKLNETVKAYVLVREAADLA 1086

Query: 3990 EWIKSREAVAAQQEI-GTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQT 3814
            +WI+ +E  A   ++ G DLE+VEVLQKKFDDF  DLKANEVRL  MN+IA  LTS+GQT
Sbjct: 1087 QWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKANEVRLANMNEIAVQLTSLGQT 1146

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
            E A++I+ Q++DLN +W  L         QLGSAHEVQRFHRD+DET+DWI EK +AL++
Sbjct: 1147 EAALKIQTQMQDLNEKWNNLQTLTAEKASQLGSAHEVQRFHRDIDETKDWIAEKANALNN 1206

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
            +D G+DLRSVQ LQRKHEGVERDLAAL DKI+ LDE ANRL QSHP+ AEQ Y  Q+E+N
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W+++ +K+  RKEKLLDSYD QRFLSDYRDL+ WI SM  LV+S ELANDVTGAEAL+
Sbjct: 1267 EMWDQIITKSTARKEKLLDSYDLQRFLSDYRDLLAWINSMMSLVTSDELANDVTGAEALI 1326

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+RTEID+RA TF AF+QFGN+LL ++HYA+ +I+ +++ + +AR+ LE AW  RR
Sbjct: 1327 ERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDLAKAREDLEKAWTERR 1386

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPS--GDNVESLIKKHEDFDKAINTQE 2920
              L+Q L+LQL+ RDCE A++WMSAREAFL  +D +  G NVE+LIKKHEDFDKAIN  E
Sbjct: 1387 LQLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHE 1446

Query: 2919 EKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSR 2740
            +KI  L+  A+ LI  NHY S  V  KR Q+L+RW  LKE LI+KR +LG+ QTLQQFSR
Sbjct: 1447 QKIAALQTVADQLIAQNHYASNLVDEKRKQVLERWRHLKEGLIEKRSRLGDEQTLQQFSR 1506

Query: 2739 DADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIE 2560
            DADEIENW+ EK Q+A EE+Y+DP NIQ KHQK QAFEAEL AN+DRI +++  G NLI+
Sbjct: 1507 DADEIENWIAEKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLID 1566

Query: 2559 NAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVE 2380
              +C G E AV  RL  + DQW+ L   TTEKS +LKEANKQ++++AAVKDL+FWLGEVE
Sbjct: 1567 KKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVE 1626

Query: 2379 ILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAER 2200
             LL +ED GKDLASV+NL+KKH L+EADIVAH+DR+ +MN +ADSL+E+ QF    I E+
Sbjct: 1627 SLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNRADSLVESGQFDTAGIQEK 1686

Query: 2199 RKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPG 2020
            R+ I +RY+ +  +A  R+ +L++AL +HQFFRDI DEESWIKEKKLLV SDDYGRDL G
Sbjct: 1687 RQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTG 1746

Query: 2019 VQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQI 1840
            VQNL++KH+R++ EL SHEP +  V+  GE+L+  +    +G  +I++R++ L Q+W ++
Sbjct: 1747 VQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVS---NLGVPEIEQRLKALNQAWAEL 1803

Query: 1839 RDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTF 1660
            ++L   R Q+LDES  +Q FL  VEEEEAW+ EKQQ+L  +++G++MA VQGLLKKHD F
Sbjct: 1804 KNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAF 1863

Query: 1659 QVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDN 1480
            + D   HK R + + ++G  L+   NHH   I QRC QLR +L  + ++A  R   L DN
Sbjct: 1864 ETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDN 1923

Query: 1479 SAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQR 1300
            SAYLQFMWK DVVESWI +KE  VRS++FGRDLS+VQ LLTKQE FDAGLNAFE EGI
Sbjct: 1924 SAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHN 1983

Query: 1299 ITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA 1120
            IT LKDQL+++ H QSPAI KRH +VI RWQ L   S  R+           QIEELYL
Sbjct: 1984 ITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLT 2043

Query: 1119 FAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDR 940
            FAKKAS FNSWFENAEEDLTDPVRCNS+EEIRALRDAH +FQ SLSSAE DF+ L  LD+
Sbjct: 2044 FAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQ 2103

Query: 939  RIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +IKSFNVGPNPYTWFTM+ALE+TWRNLQ+II+ER+ ELA+E +RQEENDKLR+EFAK AN
Sbjct: 2104 KIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHAN 2163

Query: 759  AFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNR 580
             FH WLT TR  MME  G+LE+QL+A+  KA E++A +  L++IEE GA+LE +LILDNR
Sbjct: 2164 LFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNR 2223

Query: 579  YTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTG 400
            YTEHSTVG+AQ WDQLDQL+MRMQHNLEQQIQARN SGVSE++L+EFSMMFKHFDK+K+G
Sbjct: 2224 YTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHFDKDKSG 2283

Query: 399  RLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETE 220
            +L+HQ+FKSCLRALGYDLPMV+EGQP+PEF+ ILD+VDPNRDGYV+LQEY+AFMISKETE
Sbjct: 2284 KLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFMISKETE 2343

Query: 219  NIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGL 40
            N+QS EEIE AFRA++   RPYVT EELY NLT + A++C++RMKP+ +  SG+ I+  L
Sbjct: 2344 NVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQPIKDAL 2403

Query: 39   DYEQFVHALFQS 4
            DY  F   LFQ+
Sbjct: 2404 DYIDFTRTLFQN 2415


>gi|47477769|gb|AAH70885.1| Spna2 protein [Rattus norvegicus]
          Length = 2452

 Score = 2854 bits (7399), Expect = 0.0
 Identities = 1423/2449 (58%), Positives = 1818/2449 (74%), Gaps = 46/2449 (1%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   VASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+++VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET+ WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L+ S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A + +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL++L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  PM
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 P--GTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAE 3988
            P    ++++  ++  SI  +Q +I+++YQ L+ LGE RK  LE++CK + L REAN+L +
Sbjct: 1026 PAQSASRENLLEEQGSIALRQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANELQQ 1085

Query: 3987 WIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTET 3808
            WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G
Sbjct: 1086 WINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAE 1145

Query: 3807 AVRIRQQ-----------------------------------IEDLNARWRALXXXXXXX 3733
             V+  QQ                                   I++LN RWR+L
Sbjct: 1146 EVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEER 1205

Query: 3732 XXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAAL 3553
               LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAAL
Sbjct: 1206 SQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAAL 1265

Query: 3552 GDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFL 3373
            GDK+ SL E A RL QSHPE+AE + +   ELN+ W  L  +A+ RK KL DS+D QRFL
Sbjct: 1266 GDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFL 1325

Query: 3372 SDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQL 3193
            SD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QL
Sbjct: 1326 SDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQL 1385

Query: 3192 LNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSARE 3013
            L   HYA+ +I+ +L  +++ R  LE AWV RR +LD CLELQLF+RDCEQA+ WM+ARE
Sbjct: 1386 LAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAARE 1445

Query: 3012 AFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRK 2839
            AFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI  +HY    +  +
Sbjct: 1446 AFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANR 1505

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNI 2659
            R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNI
Sbjct: 1506 RNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNI 1565

Query: 2658 QQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVK 2479
            Q KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G E AV ARL AL DQW  LV+
Sbjct: 1566 QSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQ 1625

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
             + EKS +LKEANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH LLEA
Sbjct: 1626 KSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEA 1685

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
            DI AH+DR+ ++N QADSL+ +  F   Q+ E+R  I  R+  +K MAT RR KLS++
Sbjct: 1686 DISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHR 1745

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
            +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V
Sbjct: 1746 LHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLD 1805

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEE 1759
             G++L   + +  +G+++I++R+    + W +++ L   R QRL+ES  +Q F+ +VEEE
Sbjct: 1806 TGKKL---SDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEE 1862

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNH 1579
            EAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G  LI   NH
Sbjct: 1863 EAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNH 1922

Query: 1578 HAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSE 1399
            H  +I  +   L  ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++
Sbjct: 1923 HEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTD 1982

Query: 1398 DFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVI 1219
            D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH +++
Sbjct: 1983 DYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLM 2042

Query: 1218 QRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNS 1039
            +RW  LLA+S  R+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNS
Sbjct: 2043 KRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNS 2102

Query: 1038 LEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNL 859
            LEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNL
Sbjct: 2103 LEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNL 2162

Query: 858  QRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGTLE 697
            Q+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GTLE
Sbjct: 2163 QKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLE 2222

Query: 696  EQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAM 517
             QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL M
Sbjct: 2223 SQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGM 2282

Query: 516  RMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMV 337
            RMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV
Sbjct: 2283 RMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMV 2342

Query: 336  DEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRP 157
            +EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +P
Sbjct: 2343 EEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKP 2402

Query: 156  YVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            YVT EELY NLT EQA++C+  MKPY+D   GR +    DY +F  +LF
Sbjct: 2403 YVTKEELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFDYVEFTRSLF 2450


>gi|31565122|gb|AAH53521.1| SPTAN1 protein [Homo sapiens]
          Length = 2452

 Score = 2848 bits (7384), Expect = 0.0
 Identities = 1420/2449 (57%), Positives = 1816/2449 (73%), Gaps = 46/2449 (1%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   IASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  ++  H+ R+NE+NQ A KL++E H E + I  K+D+VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L  S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A D +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG- 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PG--TAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAE 3988
            P    ++++  ++  SI  +Q +I+++Y  L+ LGE RK  LE++CK + L REAN+L +
Sbjct: 1026 PAQSASRENLLEEQGSIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREANELQQ 1085

Query: 3987 WIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTET 3808
            WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G
Sbjct: 1086 WINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAE 1145

Query: 3807 AVRIRQQ-----------------------------------IEDLNARWRALXXXXXXX 3733
             V+  QQ                                   I++LN RWR+L
Sbjct: 1146 EVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEER 1205

Query: 3732 XXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAAL 3553
               LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAAL
Sbjct: 1206 SQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAAL 1265

Query: 3552 GDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFL 3373
            GDK+ SL E A RL QSHPE+AE + +   ELN+ W+ L  +A+ RK KL DS+D QRFL
Sbjct: 1266 GDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFL 1325

Query: 3372 SDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQL 3193
            SD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QL
Sbjct: 1326 SDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQL 1385

Query: 3192 LNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSARE 3013
            L   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCLELQLF+RDCEQA+ WM+ARE
Sbjct: 1386 LAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAARE 1445

Query: 3012 AFLAQEDP--SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRK 2839
            AFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI   HY    ++ +
Sbjct: 1446 AFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSR 1505

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNI 2659
            R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNI
Sbjct: 1506 RNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNI 1565

Query: 2658 QQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVK 2479
            Q KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G E AV ARL AL DQW  LV+
Sbjct: 1566 QSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQ 1625

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
             + EKS +LKEANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH LLEA
Sbjct: 1626 KSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEA 1685

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
            DI AH+DR+ ++N QADSL+ +  F   Q+ ++R  I  R+  +K MA  RR KL+++
Sbjct: 1686 DISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLNESHR 1745

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
            +HQFFRD+DDEESWIKEKKLLV S+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V
Sbjct: 1746 LHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLD 1805

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEE 1759
             G++L   + +  +G+++I++R+    + W +++ L   R QRL+ES  +Q F+ +VEEE
Sbjct: 1806 TGKKL---SDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEE 1862

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNH 1579
            EAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G  LI   NH
Sbjct: 1863 EAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNH 1922

Query: 1578 HAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSE 1399
            H  +I  +   L  ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++
Sbjct: 1923 HEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTD 1982

Query: 1398 DFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVI 1219
            D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH +++
Sbjct: 1983 DYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLM 2042

Query: 1218 QRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNS 1039
            +RW  LLA+S AR+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNS
Sbjct: 2043 KRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNS 2102

Query: 1038 LEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNL 859
            LEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNL
Sbjct: 2103 LEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNL 2162

Query: 858  QRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGTLE 697
            Q+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GTLE
Sbjct: 2163 QKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLE 2222

Query: 696  EQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAM 517
             QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL M
Sbjct: 2223 SQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGM 2282

Query: 516  RMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMV 337
            RMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV
Sbjct: 2283 RMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMV 2342

Query: 336  DEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRP 157
            +EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +P
Sbjct: 2343 EEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKP 2402

Query: 156  YVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            YVT EELY NLT EQA++C+  MKPY+D   GR +    DY +F  +LF
Sbjct: 2403 YVTKEELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFDYVEFTRSLF 2450


>gi|17380501|sp|P16086|SPCN_RAT Spectrin alpha chain, brain (Spectrin,
            non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin
            alpha chain)
 gi|3462887|gb|AAC33127.1| alpha-fodrin [Rattus norvegicus]
          Length = 2472

 Score = 2845 bits (7374), Expect = 0.0
 Identities = 1422/2469 (57%), Positives = 1814/2469 (72%), Gaps = 66/2469 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   VASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+++VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET+ WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L+ S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A + +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL++L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  PM
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++  S+  +  ++E+ YQ L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVGQTETAVRIRQQ--------------------------------- 3787
            RL+++N++A  L S G     V+  QQ
Sbjct: 1146 RLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATF 1205

Query: 3786 --IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W  L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LD CL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 AFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGG 2539
            W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G
Sbjct: 1566 WISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGS 1625

Query: 2538 EAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
            E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +FWL EVE LL SED
Sbjct: 1626 EDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASED 1685

Query: 2358 YGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR 2179
            YGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ E+R  I  R
Sbjct: 1686 YGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGR 1745

Query: 2178 YDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRK 1999
            +  +K MAT RR KLS++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+K
Sbjct: 1746 FQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKK 1805

Query: 1998 HRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNR 1819
            H+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W +++ L   R
Sbjct: 1806 HKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGQEEIQQRLAQFVEHWKELKQLAAAR 1862

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
             QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +H
Sbjct: 1863 GQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVH 1922

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
            K RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R AKL +NSA+LQF
Sbjct: 1923 KDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFN 1982

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQ 1279
            WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQ
Sbjct: 1983 WKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQ 2042

Query: 1278 LVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKAST 1099
            L++++H QS AIE RH ++++RW  LLA+S  R+           ++E+L+L FAKKAS
Sbjct: 2043 LLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASA 2102

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNV 919
            FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V
Sbjct: 2103 FNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRV 2162

Query: 918  GPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLT 739
              NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+
Sbjct: 2163 ASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQ 2222

Query: 738  NTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY 577
             TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+Y
Sbjct: 2223 ETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKY 2282

Query: 576  TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGR 397
            TEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GR
Sbjct: 2283 TEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGR 2342

Query: 396  LDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETEN 217
            L+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN
Sbjct: 2343 LNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETEN 2402

Query: 216  IQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLD 37
            ++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D   GR +    D
Sbjct: 2403 VKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFD 2461

Query: 36   YEQFVHALF 10
            Y +F  +LF
Sbjct: 2462 YVEFTRSLF 2470


>gi|31543764|ref|NP_741984.2| alpha-spectrin 2; alpha-fodrin;
            noerythroid alpha-spectrin 2; inhibitory protein factor;
            nonerythroid alpha-spectrin 2; a--fodrin; brain
            alpha-spectrin [Rattus norvegicus]
 gi|1495198|emb|CAA62350.1| alphaII spectrin [Rattus norvegicus]
          Length = 2472

 Score = 2838 bits (7358), Expect = 0.0
 Identities = 1418/2469 (57%), Positives = 1812/2469 (72%), Gaps = 66/2469 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   VASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+++VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET+ WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L+ S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A + +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL++L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  PM
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++  S+  +  ++E+ YQ L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVGQTETAVRIRQQ--------------------------------- 3787
            RL+++N++A  L S G     V+  QQ
Sbjct: 1146 RLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATF 1205

Query: 3786 --IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W  L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LD CL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 AFADQLIALDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGG 2539
            W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G
Sbjct: 1566 WISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGS 1625

Query: 2538 EAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
            E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +FWL EVE LL SED
Sbjct: 1626 EDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASED 1685

Query: 2358 YGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR 2179
            YGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ E+R  I  R
Sbjct: 1686 YGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGR 1745

Query: 2178 YDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRK 1999
            +  +K MAT RR KLS++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+K
Sbjct: 1746 FQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKK 1805

Query: 1998 HRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNR 1819
            H+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W +++ L   R
Sbjct: 1806 HKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGQEEIQQRLAQFVEHWKELKQLAAAR 1862

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
             QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +H
Sbjct: 1863 GQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVH 1922

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
            K RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R A + +NSA+LQF
Sbjct: 1923 KDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKANVDENSAFLQFN 1982

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQ 1279
            WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQ
Sbjct: 1983 WKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQ 2042

Query: 1278 LVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKAST 1099
            L++++H QS AIE RH ++++RW  LLA+S  R+           ++E+L+L FAKKAS
Sbjct: 2043 LLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASA 2102

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNV 919
            FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V
Sbjct: 2103 FNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRV 2162

Query: 918  GPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLT 739
              NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEEND +R+EFA+ ANAFH W+
Sbjct: 2163 ASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDNVRQEFAQHANAFHQWIQ 2222

Query: 738  NTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY 577
             TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+Y
Sbjct: 2223 ETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKY 2282

Query: 576  TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGR 397
            TEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GR
Sbjct: 2283 TEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGR 2342

Query: 396  LDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETEN 217
            L+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN
Sbjct: 2343 LNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETEN 2402

Query: 216  IQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLD 37
            ++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D   GR +    D
Sbjct: 2403 VKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFD 2461

Query: 36   YEQFVHALF 10
            Y +F  +LF
Sbjct: 2462 YVEFTRSLF 2470


>gi|50757376|ref|XP_415495.1| PREDICTED: similar to spectrin alpha
            chain, brain - chicken [Gallus gallus]
          Length = 2498

 Score = 2836 bits (7351), Expect = 0.0
 Identities = 1429/2495 (57%), Positives = 1821/2495 (72%), Gaps = 92/2495 (3%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDADEL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DPSNLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL+
Sbjct: 66   IASDENYKDPSNLQGKLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETIRTRLQ 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH LW         KG+KL QA KL+ F+R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRLWELLLEKMREKGVKLLQAQKLVQFLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+D+VN +W RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRLKGLAQ 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK   ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++  A W  ++  A  R   L  S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+S+LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDE   K+IQ  HYA DDVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDELLNKMIQNNHYAMDDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMKRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A+D +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYASDEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL SVQNLQKK  L+E+
Sbjct: 666  ATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL+DP+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRDIEDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++V S+  +  ++E+ Y  L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVG-----------------------QTETA------------VRIR 3793
            RL+++N++A  L S G                        ++TA            V
Sbjct: 1146 RLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTASPWKSARMMVHTVATF 1205

Query: 3792 QQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W+ L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLQEKCTELNQAWSSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RKEKL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDQCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 SFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQ-----QKHQKQQAFEAELHANSDRIAAIIQAGNNLIENA 2554
            W++EK Q A +E+Y+DPTNIQ      KHQK QAFEAELHAN+DRI  +I+ GN+LIE
Sbjct: 1566 WISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIEMGNSLIERG 1625

Query: 2553 KCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEIL 2374
             C G E AV ARL AL DQW+ LV+ ++EKS +LKEANKQ++F   +KD +FWL EVE L
Sbjct: 1626 ACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL 1685

Query: 2373 LQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRK 2194
            L SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ ++R+
Sbjct: 1686 LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRE 1745

Query: 2193 LIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQ 2014
             I  R+  +K MA  RR KL+++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQ
Sbjct: 1746 TINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ 1805

Query: 2013 NLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRD 1834
            NLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+      W +++
Sbjct: 1806 NLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGKEEIQQRLAQFVDHWKELKQ 1862

Query: 1833 LTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQV 1654
            L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+
Sbjct: 1863 LAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFET 1922

Query: 1653 DLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSA 1474
            D  +HK RV D+   G+ LI   NHH  +I  +   L+ ++ ++E  A  R AKL +NSA
Sbjct: 1923 DFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSA 1982

Query: 1473 YLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRIT 1294
            +LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT
Sbjct: 1983 FLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANIT 2042

Query: 1293 ELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFA 1114
             LKDQL++++H QS AIE RH ++++RW  LLA+S AR+           ++E+L+L FA
Sbjct: 2043 ALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLTFA 2102

Query: 1113 KKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI 934
            KKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+I
Sbjct: 2103 KKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQI 2162

Query: 933  KSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAF 754
            KSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAF
Sbjct: 2163 KSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAF 2222

Query: 753  HAWLTNTRQE---------------------------MMEAGGTLEEQLDAVERKAKEIK 655
            H W+  TR                             M+E  GTLE QL+A +RK +EI+
Sbjct: 2223 HQWIQETRTYLLDGIAYRRVIRVYQYEVGDDLSGRSCMVEESGTLESQLEATKRKHQEIR 2282

Query: 654  ANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARN 475
            A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN
Sbjct: 2283 AMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARN 2342

Query: 474  QSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILD 295
             +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD
Sbjct: 2343 TTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILD 2402

Query: 294  IVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPE 115
             VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +PYVT EELY NLT E
Sbjct: 2403 TVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTRE 2462

Query: 114  QAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            QA++CI  MKPYMD   GR +    DY +F  +LF
Sbjct: 2463 QADYCISHMKPYMDG-KGRELPSAYDYIEFTRSLF 2496


>gi|134800|sp|P07751|SPCN_CHICK Spectrin alpha chain, brain (Spectrin,
            non-erythroid alpha chain) (Fodrin alpha chain)
 gi|71567|pir||SJCHA spectrin alpha chain, brain - chicken
          Length = 2477

 Score = 2832 bits (7342), Expect = 0.0
 Identities = 1427/2474 (57%), Positives = 1814/2474 (72%), Gaps = 71/2474 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDADEL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELGKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DPSNLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL+
Sbjct: 66   IASDENYKDPSNLQGKLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETIRTRLQ 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH LW         KG+KL QA KL+ F+R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRLWELLLEKMREKGVKLLQAQKLVQFLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+D+VN +W RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRLKGLAQ 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK   ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            A   K+  L  EA +L ++HP  A  I  K ++  A W  ++  A  R   L  S++L R
Sbjct: 306  AFHHKVKALCAEADRLQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+S+LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA DDVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMDDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMKRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A+D +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYASDEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL SVQNLQKK  L+E+
Sbjct: 666  ATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH D +DGI   A+QFQ+  HF+A  I +KQE L  RY AL+DP+  RK+KL +S +
Sbjct: 726  DVAAHQDPIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRDIEDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA +W
Sbjct: 846  KGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADANEAQSW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++V S+  +  ++E+ Y  L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVG-------------------QTET----------------AVRIR 3793
            RL+++N++A  L S G                   + ET                 V
Sbjct: 1146 RLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTVSPWKSARMMVHTVATF 1205

Query: 3792 QQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSA EVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQR  EG ERDLAALGDK+ SL E A RL QSHPE AE + +   ELN+ W+ L
Sbjct: 1266 ASVQALQRNDEGFERDLAALGDKVNSLGETAQRLIQSHPELAEDLQEKCTELNQAWSSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RKEKL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDQCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 SFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQ-----QKHQKQQAFEAELHANSDRIAAIIQAGNNLIENA 2554
            W++EK Q A +E+Y+DPTNIQ      KHQK QAFEAELHAN+DRI  +I+ GN LIE
Sbjct: 1566 WISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIEMGNPLIERG 1625

Query: 2553 KCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEIL 2374
             C G E AV ARL AL DQW+ LV+ ++EKS +LKEANKQ++F   +KD +FWL EVE L
Sbjct: 1626 ACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL 1685

Query: 2373 LQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRK 2194
            L SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ ++R+
Sbjct: 1686 LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRE 1745

Query: 2193 LIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQ 2014
             I  R+  +K MA  RR KL+++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQ
Sbjct: 1746 TINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ 1805

Query: 2013 NLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRD 1834
            NLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+      W +++
Sbjct: 1806 NLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGKEEIQQRLAQFVDHWKELKQ 1862

Query: 1833 LTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQV 1654
            L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+
Sbjct: 1863 LAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFET 1922

Query: 1653 DLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSA 1474
            D  +HK RV D+   G+ LI   NHH  +I  +   L+ ++ ++E  A  R AKL +NSA
Sbjct: 1923 DFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSA 1982

Query: 1473 YLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRIT 1294
            +LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT
Sbjct: 1983 FLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANIT 2042

Query: 1293 ELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFA 1114
             LKDQL++++H QS AIE RH ++++RW  LLA+S AR+           ++E+L+L FA
Sbjct: 2043 ALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLTFA 2102

Query: 1113 KKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI 934
            KKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+I
Sbjct: 2103 KKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQI 2162

Query: 933  KSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAF 754
            KSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAF
Sbjct: 2163 KSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAF 2222

Query: 753  HAWLTNTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLI 592
            H W+  TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LI
Sbjct: 2223 HQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALI 2282

Query: 591  LDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDK 412
            LDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK
Sbjct: 2283 LDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDK 2342

Query: 411  EKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMIS 232
            +K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS
Sbjct: 2343 DKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMIS 2402

Query: 231  KETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSI 52
            +ETEN++SSEEIE AFRALS E +PYVT EELY NLT EQA++CI  MKPYMD   GR +
Sbjct: 2403 RETENVKSSEEIESAFRALSSERKPYVTKEELYQNLTREQADYCISHMKPYMDG-KGREL 2461

Query: 51   QGGLDYEQFVHALF 10
                DY +F  +LF
Sbjct: 2462 PSAYDYIEFTRSLF 2475


>gi|1805280|gb|AAB41498.1| alpha II spectrin [Homo sapiens]
          Length = 2477

 Score = 2830 bits (7335), Expect = 0.0
 Identities = 1417/2474 (57%), Positives = 1811/2474 (72%), Gaps = 71/2474 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   IASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  ++  H+ R+NE+NQ A KL++E H E + I  K+D+VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L  S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A D +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG- 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++  S+  +  ++E+ Y  L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVGQTETAVRIRQQ--------------------------------- 3787
            RL+++N++A  L S G     V+  QQ
Sbjct: 1146 RLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATF 1205

Query: 3786 --IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W+ L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQEDP--SGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI   HY    ++ +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 AFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQ-----QKHQKQQAFEAELHANSDRIAAIIQAGNNLIENA 2554
            W++EK Q A +E+Y+DPTNIQ      KHQK QAFEAELHAN+DRI  +I  GN+LIE
Sbjct: 1566 WISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNSLIERG 1625

Query: 2553 KCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEIL 2374
             C G E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +FWL EVE L
Sbjct: 1626 ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL 1685

Query: 2373 LQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRK 2194
            L SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ ++R
Sbjct: 1686 LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRD 1745

Query: 2193 LIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQ 2014
             I  R+  +K MA  RR KL+++  +HQFFRD+DDEESWIKEKKLLV S+DYGRDL GVQ
Sbjct: 1746 TINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQ 1805

Query: 2013 NLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRD 1834
            NLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W +++
Sbjct: 1806 NLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGKEEIQQRLAQFVEHWKELKQ 1862

Query: 1833 LTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQV 1654
            L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+
Sbjct: 1863 LAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFET 1922

Query: 1653 DLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSA 1474
            D  +HK RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R A + +NSA
Sbjct: 1923 DFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKANVDENSA 1982

Query: 1473 YLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRIT 1294
            +LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT
Sbjct: 1983 FLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANIT 2042

Query: 1293 ELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFA 1114
             LKDQL++++H QS AIE RH ++++RW  LLA+S AR+           ++E+L+L FA
Sbjct: 2043 ALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFA 2102

Query: 1113 KKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI 934
            KKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+I
Sbjct: 2103 KKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQI 2162

Query: 933  KSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAF 754
            KSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAF
Sbjct: 2163 KSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAF 2222

Query: 753  HAWLTNTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLI 592
            H W+  TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LI
Sbjct: 2223 HQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALI 2282

Query: 591  LDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDK 412
            LDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK
Sbjct: 2283 LDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDK 2342

Query: 411  EKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMIS 232
            +K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS
Sbjct: 2343 DKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMIS 2402

Query: 231  KETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSI 52
            +ETEN++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D   GR +
Sbjct: 2403 RETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG-KGREL 2461

Query: 51   QGGLDYEQFVHALF 10
                DY +F  +LF
Sbjct: 2462 PTAFDYVEFTRSLF 2475


>gi|4507191|ref|NP_003118.1| spectrin, alpha, non-erythrocytic 1
            (alpha-fodrin) [Homo sapiens]
 gi|2493433|sp|Q13813|SPCN_HUMAN Spectrin alpha chain, brain
            (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin)
            (Fodrin alpha chain)
 gi|106032|pir||A35715 fodrin alpha chain - human
 gi|179106|gb|AAA51790.1| nonerythroid alpha-spectrin
          Length = 2472

 Score = 2821 bits (7313), Expect = 0.0
 Identities = 1411/2469 (57%), Positives = 1805/2469 (72%), Gaps = 66/2469 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   IASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA  L+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQNLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  ++  H+ R+NE+NQ A KL++E H E + I  K+D+VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L  S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGD LDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDFLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A D +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DG+   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGVTIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG- 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++  S+  +  ++E+ Y  L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVGQTETAVRIRQQ--------------------------------- 3787
            RL+++N++A  L S G     V+  QQ
Sbjct: 1146 RLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATF 1205

Query: 3786 --IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W+ L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQAWSSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQEDP--SGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI   HY    ++ +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 AFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGG 2539
            W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G
Sbjct: 1566 WISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGN 1625

Query: 2538 EAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
            E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD+ FWL EVE LL SED
Sbjct: 1626 EDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDIAFWLSEVEALLASED 1685

Query: 2358 YGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR 2179
            YGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ ++R  I  R
Sbjct: 1686 YGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGR 1745

Query: 2178 YDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRK 1999
            +  +K MA  RR KL+++  +HQFFRD+DDEESWIKEKKLLV S+DYGRDL GVQNLR+K
Sbjct: 1746 FQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKK 1805

Query: 1998 HRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNR 1819
            H+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W +++ L   R
Sbjct: 1806 HKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGKEEIQQRLAQFVEHWKELKQLAAAR 1862

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
             QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+    +H
Sbjct: 1863 GQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETAFTVH 1922

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
            K RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R A + +NSA+LQF
Sbjct: 1923 KDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKANVDENSAFLQFN 1982

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQ 1279
            WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQ
Sbjct: 1983 WKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQ 2042

Query: 1278 LVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKAST 1099
            L++++H QS AIE RH ++++RW  LLA+S AR+           ++E+L+L FAKKAS
Sbjct: 2043 LLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKASA 2102

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNV 919
            FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V
Sbjct: 2103 FNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRV 2162

Query: 918  GPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLT 739
              NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+
Sbjct: 2163 ASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQ 2222

Query: 738  NTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY 577
             TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+Y
Sbjct: 2223 ETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKY 2282

Query: 576  TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGR 397
            TEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GR
Sbjct: 2283 TEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGR 2342

Query: 396  LDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETEN 217
            L+HQ  KSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN
Sbjct: 2343 LNHQDGKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETEN 2402

Query: 216  IQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLD 37
            ++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKP +D   GR +    D
Sbjct: 2403 VKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPIVDG-KGRELPTAFD 2461

Query: 36   YEQFVHALF 10
            Y +F  +LF
Sbjct: 2462 YVEFTRSLF 2470


>gi|1334744|emb|CAA32663.1| spectrin alpha chain [Gallus gallus]
          Length = 2449

 Score = 2806 bits (7275), Expect = 0.0
 Identities = 1415/2451 (57%), Positives = 1796/2451 (72%), Gaps = 71/2451 (2%)
 Frame = -1

Query: 7149 FKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAF 6970
            FK+ S  +R +LE++ +FQ+F+RDADEL  WI EKLQ A +EN++DPSNLQ K+QKH+AF
Sbjct: 1    FKELSSLRRQKLEDSYRFQFFQRDADELGKWIQEKLQIASDENYKDPSNLQGKLQKHQAF 60

Query: 6969 EAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQA 6790
            EAEVQA++  I  LD+TGN MI   HFASE I+ RL+ELH LW         KG+KL QA
Sbjct: 61   EAEVQANSGAIVKLDETGNQMINEGHFASETIRTRLQELHRLWELLLEKMREKGVKLLQA 120

Query: 6789 LKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEI 6610
             KL+ F+R+C++++ WI +KE  VT+E++G DLEHVE+LQ+KF++F  +L  H+ R+NE+
Sbjct: 121  QKLVQFLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEV 180

Query: 6609 NQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETL 6430
            NQ A KL++E H E + I  K+D+VN +W RL  LA  R+  LFGA +VQRFNRD DET+
Sbjct: 181  NQFAGKLIQEQHPEEELIKSKQDEVNASWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETI 240

Query: 6429 AWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDR 6250
            +WI EK   ++SDD+GRDL +VQAL RKHEG ERDLAA   K+  L  EA +L ++HP
Sbjct: 241  SWIKEKGQLMASDDFGRDLASVQALLRKHEGLERDLAAFHHKVKALCAEADRLQQSHPIN 300

Query: 6249 AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADE 6070
            A  I  K ++  A W  ++  A  R   L  S++L RFLAD+RDL SW+ +MKA+I ADE
Sbjct: 301  ASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADE 360

Query: 6069 LAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHE 5890
            LA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ L+  G   S EV+EKL  L  E
Sbjct: 361  LANDVAGAEALLDRHQEHKGEIDAHEDSFRSADESGQALLAAGHYASDEVKEKLTILSDE 420

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
            +S+LL LWE RR  YEQCMDLQLFYRDTEQ + WM+KQEAFL N DLGDSLDSVE L+KK
Sbjct: 421  RSALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKK 480

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            HEDFEKSL+AQEEKI ALDEFATKLIQ  HYA DDVA                   R
Sbjct: 481  HEDFEKSLSAQEEKITALDEFATKLIQNNHYAMDDVATRRDALLSRRNALHERAMKRRAQ 540

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRL 5350
            L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+N++GK+QKH  FE EL AN++R+
Sbjct: 541  LADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRI 600

Query: 5349 DDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIE 5170
            D +   G+++ID  H+A+D +  R+ +V +LW +L++AT  KG KLREA  +QQFNRN+E
Sbjct: 601  DALEKAGQKLIDVNHYASDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVE 660

Query: 5169 DVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEE 4990
            D+E WL E+EG +AS+DYGKDL SVQNLQKK  L+E+D  AH D +DGI   A+QFQ+
Sbjct: 661  DIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDPIDGITIQARQFQDAG 720

Query: 4989 HFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAG 4810
            HF+A  I +KQE L  RY AL+DP+  RK+KL +S +  QLFRDIEDE  WIREKE +A
Sbjct: 721  HFDADNIKKKQEALVARYEALKDPMVARKQKLADSLRLQQLFRDIEDEETWIREKEPIAA 780

Query: 4809 STNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQL 4630
            STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+   N M+++GHF A +++ KL +L
Sbjct: 781  STNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKIKLNEL 840

Query: 4629 RDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEAL 4450
               W  LK+KA +RR DL+DSLQA QY +DANEA +WM EKEPIVGSTDYGKDEDSAEAL
Sbjct: 841  NQKWDSLKAKASQRRQDLEDSLQAQQYFADANEAQSWMREKEPIVGSTDYGKDEDSAEAL 900

Query: 4449 LKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-GQLGRDCVLALYDYQEKSPREVSM 4273
            LKKH AL+SDL A+  +I+ LR+QA  C+ Q  P   + G++ VLALYDYQEKSPREV+M
Sbjct: 901  LKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTM 960

Query: 4272 KKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA------------------- 4150
            KKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++P  +
Sbjct: 961  KKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQ 1020

Query: 4149 ---QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIK 3979
               Q    ++V S+  +  ++E+ Y  L+ LGE RK  LE++CK + L REAN+L +WI
Sbjct: 1021 IDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWIN 1080

Query: 3978 SREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVG------- 3820
             +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G
Sbjct: 1081 EKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVANDLESEGLMAEEVQ 1140

Query: 3819 ------------QTET----------------AVRIRQQIEDLNARWRALXXXXXXXXXQ 3724
                        + ET                 V     I++LN RWR+L
Sbjct: 1141 AVEHQEVYGMMPRDETDSKTVSPWKSARMMVHTVATFNSIKELNERWRSLQQLAEERSQL 1200

Query: 3723 LGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK 3544
            LGSA EVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQR  EG ERDLAALGDK
Sbjct: 1201 LGSADEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRNDEGFERDLAALGDK 1260

Query: 3543 IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDY 3364
            + SL E A RL QSHPE AE + +   ELN+ W+ L  +A+ RKEKL DS+D QRFLSD+
Sbjct: 1261 VNSLGETAQRLIQSHPELAEDLQEKCTELNQAWSSLGKRADQRKEKLGDSHDLQRFLSDF 1320

Query: 3363 RDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNS 3184
            RDLM WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL
Sbjct: 1321 RDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAR 1380

Query: 3183 HHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFL 3004
             HYA+ +I+ +L  +++ R  LE AWV RR +LDQCLELQLF+RDCEQA+ WM+AREAFL
Sbjct: 1381 GHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFL 1440

Query: 3003 AQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQ 2830
              ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI  +HY    +  +R++
Sbjct: 1441 NTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQSFADQLIAADHYAKGVIANRRNE 1500

Query: 2829 ILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQ-- 2656
            +LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ
Sbjct: 1501 VLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQLS 1560

Query: 2655 ---QKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLL 2485
                KHQK QAFEAELHAN+DRI  +I+ GN LIE   C G E AV ARL AL DQW+ L
Sbjct: 1561 KLLSKHQKHQAFEAELHANADRIRGVIEMGNPLIERGACAGSEDAVKARLAALADQWEFL 1620

Query: 2484 VKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLL 2305
            V+ ++EKS +LKEANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH LL
Sbjct: 1621 VQKSSEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLL 1680

Query: 2304 EADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKA 2125
            EADI AH+DR+ ++N QADSL+ +  F   Q+ ++R+ I  R+  +K MA  RR KL+++
Sbjct: 1681 EADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAARRAKLNES 1740

Query: 2124 LNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLV 1945
              +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V
Sbjct: 1741 HRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGV 1800

Query: 1944 KLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVE 1765
               G++L   + +  +G+++I++R+      W +++ L   R QRL+ES  +Q F+ +VE
Sbjct: 1801 LDTGKKL---SDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVE 1857

Query: 1764 EEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            EEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G+ LI
Sbjct: 1858 EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKN 1917

Query: 1584 NHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVR 1405
            NHH  +I  +   L+ ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++
Sbjct: 1918 NHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 1977

Query: 1404 SEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTN 1225
            ++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH +
Sbjct: 1978 TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEVRHAS 2037

Query: 1224 VIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRC 1045
            +++RW  LLA+S AR+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRC
Sbjct: 2038 LMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRC 2097

Query: 1044 NSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWR 865
            NSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWR
Sbjct: 2098 NSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWR 2157

Query: 864  NLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGT 703
            NLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GT
Sbjct: 2158 NLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGT 2217

Query: 702  LEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQL 523
            LE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL
Sbjct: 2218 LESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQL 2277

Query: 522  AMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLP 343
             MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLP
Sbjct: 2278 GMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLP 2337

Query: 342  MVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEF 163
            MV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E
Sbjct: 2338 MVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSER 2397

Query: 162  RPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            +PYVT EELY NLT EQA++CI  MKPYMD   GR +    DY +F  +LF
Sbjct: 2398 KPYVTKEELYQNLTREQADYCISHMKPYMDG-KGRELPSAYDYIEFTRSLF 2447



 Score =  692 bits (1787), Expect = 0.0
 Identities = 512/2179 (23%), Positives = 987/2179 (44%), Gaps = 33/2179 (1%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-R 7015
            I  ++ EV   +   K  +Q ++ +L  A + Q F RD DE   WI EK Q    ++F R
Sbjct: 198  IKSKQDEVNASWQRLKGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGR 257

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXX 6835
            D +++QA ++KHE  E ++ A    +  L    + + Q +   +  I+ + EEL A W
Sbjct: 258  DLASVQALLRKHEGLERDLAAFHHKVKALCAEADRLQQSHPINASQIQVKREELIANWEQ 317

Query: 6834 XXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDD 6655
                   +  +L  + +L  F+    ++  W+ E +  + A+++  D+   E L  +  +
Sbjct: 318  IRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQE 377

Query: 6654 FLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFG 6475
               E+  H+      +++   L+  GH   D++ +K   ++D    L  L   R++
Sbjct: 378  HKGEIDAHEDSFRSADESGQALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQ 437

Query: 6474 AHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQ 6295
               +Q F RD ++   W+ +++  L ++D G  L++V+AL +KHE  E+ L+A E K+
Sbjct: 438  CMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITA 497

Query: 6294 LEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDL 6115
            L++ A KL + +    + +  + D   +  NAL E+A  R+  L  SF L +F  D  +L
Sbjct: 498  LDEFATKLIQNNHYAMDDVATRRDALLSRRNALHERAMKRRAQLADSFHLQQFFRDSDEL 557

Query: 6114 ISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIP 5935
             SW+ + K     DE  KD +  +  ++ HQ  + E+ A     +    AGQKL+++
Sbjct: 558  KSWVNE-KMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHY 616

Query: 5934 ESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANT 5755
             S EV  ++ ++      LL   E + I   +    Q F R+ E  E W+ + E  LA+
Sbjct: 617  ASDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASD 676

Query: 5754 DLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXX 5575
            D G  L SV++L KKH   E  +AA ++ I+ +   A +     H+ AD++ +
Sbjct: 677  DYGKDLTSVQNLQKKHALLEADVAAHQDPIDGITIQARQFQDAGHFDADNIKKKQEALVA 736

Query: 5574 XXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQ 5398
                       R   L +S + Q   RD ++  +WI EK   A   +   D   ++  L+
Sbjct: 737  RYEALKDPMVARKQKLADSLRLQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLK 796

Query: 5397 KHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGA 5218
            KH   + E+  +E R+  +   G  +++ GHFAA+ +  +L ++N  W+ L    +++
Sbjct: 797  KHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQ 856

Query: 5217 KLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHND 5038
             L ++   QQ+  +  + ++W+ E E  V S DYGKD  S + L KK   + SD +A+
Sbjct: 857  DLEDSLQAQQYFADANEAQSWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGS 916

Query: 5037 RVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRD 4858
             +  +++ AQ  +++      V     E  ++   AL D  EK  R++           +
Sbjct: 917  SIQALREQAQSCRQQ------VAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLN 970

Query: 4857 IEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAA--NDM 4684
              ++  W  E     G              +KK     A+ A+ ++ +E   S A   +
Sbjct: 971  STNKDWWKVEVNDRQGFVPAA--------YVKKLDP--AQSASRENLLEEQGSIALRQEQ 1020

Query: 4683 IQQGHFLAPEIRD---KLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMS 4513
            I     +  E+     ++ Q+ + +  L    EKR+  L+ S +      +ANE   W++
Sbjct: 1021 IDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWIN 1080

Query: 4512 EKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLG 4333
            EKE  + + + G D +  E L KK      DL+A +  ++D+ K A+  + +    G +
Sbjct: 1081 EKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVANDLESE----GLMA 1136

Query: 4332 RDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGT 4153
             +  +   ++QE            V  ++     D              +  V   +
Sbjct: 1137 EE--VQAVEHQE------------VYGMMPRDETD--------------SKTVSPWKSAR 1168

Query: 4152 AQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSR 3973
               H     NSI     E+ ++++ L  L E R + L  A +  +  R+A++  EWI+ +
Sbjct: 1169 MMVHTVATFNSI----KELNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEK 1224

Query: 3972 EAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIR 3793
                     G DL  V+ LQ+  + F+ DL A   ++  + + A  L      E A  ++
Sbjct: 1225 NQALNTDNYGHDLASVQALQRNDEGFERDLAALGDKVNSLGETAQRLIQ-SHPELAEDLQ 1283

Query: 3792 QQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
            ++  +LN  W +L         +LG +H++QRF  D  +   WI      + S++  +D+
Sbjct: 1284 EKCTELNQAWSSLGKRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDV 1343

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
               +AL  +H+    ++ A     ++ ++   +L      A+ +I +    L+++   L
Sbjct: 1344 TGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLE 1403

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
                 R+  L    + Q F  D      W+A+    +++++  + +   EAL+++H+++
Sbjct: 1404 KAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFD 1463

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
              I+ +         F +QL+ + HYA G I NR   V +  + L+   + +R+ L +
Sbjct: 1464 KAINVQEEKIAVLQSFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQ 1523

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQE---DPSGDNVESLI---KKHEDFDKAINTQEEKI 2911
             LQ F RD ++ + W+S +    + E   DP+   +  L+   +KH+ F+  ++   ++I
Sbjct: 1524 TLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRI 1583

Query: 2910 KGLKLFAESLIKNNHY--DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            +G+      LI+         AV  +   + D+W  L +   +K  KL E+   Q F+
Sbjct: 1584 RGVIEMGNPLIERGACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTG 1643

Query: 2736 ADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIE 2560
              + + W++E   +   E+Y +D  ++    +K Q  EA++ A+ DR+  +    ++L+
Sbjct: 1644 IKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMT 1703

Query: 2559 NAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVE 2380
            ++     +  V  + + +N ++  +      +  +L E+++   F   + D E W+ E +
Sbjct: 1704 SSAFDTSQ--VKDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKK 1761

Query: 2379 ILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAER 2200
            +L+ SEDYG+DL  V+NL KKH  LEA++ AH+  +  + +    L +++    ++I +R
Sbjct: 1762 LLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQR 1821

Query: 2199 RKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPG 2020
                 D +  +K++A  R  +L ++L   QF  ++++EE+WI EK  LV+S+DYG  L
Sbjct: 1822 LAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAA 1881

Query: 2019 VQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQI 1840
            +Q L +KH   +T+   H+ +V+ V   GE+L++   +     + I  +M+ L+     +
Sbjct: 1882 IQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIK---KNNHHVENITAKMKGLKGKVSDL 1938

Query: 1839 RDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTF 1660
                  R  +LDE+ AF  F    +  E+W+ EK+  L +D++G +++ VQ LL K +TF
Sbjct: 1939 EKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETF 1998

Query: 1659 QVDLELHKQR-VADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRD 1483
               L+  +Q  +A++    D L+   +  +  I+ R   L  R  ++ + +  R  KL +
Sbjct: 1999 DAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKLLE 2058

Query: 1482 --------NSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLN 1327
                       +L F  K     SW    E+ +        L  ++ L    +AF + L+
Sbjct: 2059 AQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLS 2118

Query: 1326 AFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXX 1147
            + + +   ++ EL  Q+ S     +P        + + W+NL    + R
Sbjct: 2119 SAQAD-FNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQ 2177

Query: 1146 XQIEELYLAFAKKASTFNSWFENAEEDLTD----PVRCNSLE-EIRALRDAHGEFQRSLS 982
             + ++L   FA+ A+ F+ W +     L D         +LE ++ A +  H E    +
Sbjct: 2178 EENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQE----IR 2233

Query: 981  SAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQE 802
            +     ++++DL   ++   +  N YT  +   L   W  L ++    +  L ++ Q +
Sbjct: 2234 AMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARN 2293

Query: 801  E---NDKLRREFAKLANAF 754
                 ++  +EF+ +   F
Sbjct: 2294 TTGVTEEALKEFSMMFKHF 2312



 Score =  536 bits (1380), Expect = e-150
 Identities = 453/2004 (22%), Positives = 875/2004 (43%), Gaps = 118/2004 (5%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILE-KLQTAQEE 7024
            A  I  +R+E++ ++   +  +  +  RL ++ + Q F  D  +L  W+ E K     +E
Sbjct: 301  ASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADE 360

Query: 7023 NFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHAL 6844
               D +  +A + +H+  + E+ AH  +  + D++G A++   H+AS+ +K++L  L
Sbjct: 361  LANDVAGAEALLDRHQEHKGEIDAHEDSFRSADESGQALLAAGHYASDEVKEKLTILSDE 420

Query: 6843 WXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRK 6664
                      +  + +Q + L  F R  +++  W+ ++E ++  ED+G  L+ VE L +K
Sbjct: 421  RSALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKK 480

Query: 6663 FDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
             +DF K L   + +I  +++ A KL++  H   D +  +RD +    + L+  A  R+
Sbjct: 481  HEDFEKSLSAQEEKITALDEFATKLIQNNHYAMDDVATRRDALLSRRNALHERAMKRRAQ 540

Query: 6483 LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGK 6304
            L  +  +Q+F RD+DE  +W+ EK +  ++D+  +D +N+Q   +KH+  E +L+A + +
Sbjct: 541  LADSFHLQQFFRDSDELKSWVNEK-MKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSR 599

Query: 6303 MLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
            +  LEK   KL + +   ++ +  + ++  + W  L E  + +   L  + Q  +F  +
Sbjct: 600  IDALEKAGQKLIDVNHYASDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNV 659

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEM 5944
             D+  W+ +++  + +D+  KD+   + L + H   + ++ A  D  +      ++  +
Sbjct: 660  EDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQDPIDGITIQARQFQDA 719

Query: 5943 GIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
            G  ++  +++K E L     +L      R+      + LQ  +RD E  ETW+ ++E
Sbjct: 720  GHFDADNIKKKQEALVARYEALKDPMVARKQKLADSLRLQQLFRDIEDEETWIREKEPIA 779

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
            A+T+ G  L  V++L+KKH+  +  +A  E +I A+ +    +++  H+AA+DV
Sbjct: 780  ASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKIKLNE 839

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRG 5407
                          R   L++S + Q +  D +E  SW+ EK        Y  D  +
Sbjct: 840  LNQKWDSLKAKASQRRQDLEDSLQAQQYFADANEAQSWMREKEPIVGSTDYGKDEDSAEA 899

Query: 5406 KLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELV--DAT 5233
             L+KH     +L A  + +  +R   +          D  G  L      + E    + T
Sbjct: 900  LLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVT 959

Query: 5232 NKKG--AKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
             KKG    L  + N+  +   + D + ++           Y K L   Q+  ++  L E
Sbjct: 960  MKKGDILTLLNSTNKDWWKVEVNDRQGFVPAA--------YVKKLDPAQSASRENLLEEQ 1011

Query: 5058 DFNA-HNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESH 4882
               A   +++D    + ++           +  + + +++ Y++L +  EKRK  L +S
Sbjct: 1012 GSIALRQEQIDNQTLITKEVGS--------VSLRMKQVEELYHSLLELGEKRKGMLEKSC 1063

Query: 4881 QGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVS 4702
            +   LFR+  +   WI EKE    +   G DL  V+ L KK      ++  ++S+++ ++
Sbjct: 1064 KKFMLFREANELQQWINEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDIN 1123

Query: 4701 SAANDMIQQGHFLAPEIR-------------------------------------DKLAQ 4633
              AND+  +G  +A E++                                     + + +
Sbjct: 1124 KVANDLESEG-LMAEEVQAVEHQEVYGMMPRDETDSKTVSPWKSARMMVHTVATFNSIKE 1182

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEA 4453
            L + WR L+  AE+R   L  + +  ++  DA+E   W+ EK   + + +YG D  S +A
Sbjct: 1183 LNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQA 1242

Query: 4452 LLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQ-LGRDCVLALYDYQEKSPREVS 4276
            L +       DL A    +  L + A +       + + L   C      +     R
Sbjct: 1243 LQRNDEGFERDLAALGDKVNSLGETAQRLIQSHPELAEDLQEKCTELNQAWSSLGKRADQ 1302

Query: 4275 MKK---------------GDVLTLLNA----SNRDWWKVEVNDRQGFVPAAYVKRIE--- 4162
             K+                D+++ +N      + D    +V   +  +      R E
Sbjct: 1303 RKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDA 1362

Query: 4161 -PGTAQQHAQ--QQVNSIGGKQS-EIEDKYQRL------MMLGETRKRKLEEACKGYQLL 4012
              GT Q   Q  QQ+ + G   S EI++K   L      +     ++R + + C   QL
Sbjct: 1363 RAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDQCLELQLF 1422

Query: 4011 -REANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATA 3835
             R+      W+ +REA    ++ G  L+ VE L KK +DF   +   E ++  +   A
Sbjct: 1423 HRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQSFADQ 1482

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQE 3655
            L +       V   ++ E L+ RWR L         +LG +  +Q+F RDVDE   WI E
Sbjct: 1483 LIAADHYAKGVIANRRNEVLD-RWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE 1541

Query: 3654 KDDALDSEDFGRDLRSVQ-----ALQRKHEGVERDLAALGDKIKSLDEKANRL--RQSHP 3496
            K      E + +D  ++Q     +  +KH+  E +L A  D+I+ + E  N L  R +
Sbjct: 1542 KLQTASDESY-KDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIEMGNPLIERGACA 1600

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
             + + +      L +QW  L  K++ + +KL ++   Q F +  +D   W++ +  L++S
Sbjct: 1601 GSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLAS 1660

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
            ++   D+     LL++HQ    +I +     +  +   + L+ S  +    ++++ + +N
Sbjct: 1661 EDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETIN 1720

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
               + ++    ARR  L++   L  F+RD +  ++W+  ++  ++ ED   D   V++L
Sbjct: 1721 GRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLR 1780

Query: 2961 KKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKR 2782
            KKH+  +  +   E  I+G+    + L  +N      + ++  Q +D W  LK+    +
Sbjct: 1781 KKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARG 1840

Query: 2781 FKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDP-TNIQQKHQKQQAFEAELHANS 2605
             +L ES   QQF  + +E E W+ EK  +   E+Y D    IQ   +K +AFE +   +
Sbjct: 1841 QRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHK 1900

Query: 2604 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 2425
            DR+  +   G +LI+  K       ++A++K L  +   L K   ++  +L E +    F
Sbjct: 1901 DRVNDVCANGEDLIK--KNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSAFLQF 1958

Query: 2424 MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVA-HQDRVGEMNEQAD 2248
                  +E W+GE E  L+++DYG+DL+SV+ LL K    +A + A  Q+ +  +    D
Sbjct: 1959 NWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKD 2018

Query: 2247 SLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDD------- 2089
             LL     Q + I  R   +  R++ +   +  R+ KL   L   + FR ++D
Sbjct: 2019 QLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKL---LEAQEHFRKVEDLFLTFAK 2075

Query: 2088 ----EESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
                  SW +  +  ++       L  ++ LR  H    + L+S +   + +     EL
Sbjct: 2076 KASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL----AELD 2131

Query: 1920 RSAAEAGVGEDQIK-KRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEA--- 1753
            R      V  +      ME LE++W  ++ +   R   L + +  Q     + +E A
Sbjct: 2132 RQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHA 2191

Query: 1752 -----WMNEKQQIL--GS---DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGD 1603
                 W+ E +  L  GS   +  G   + ++   +KH   +  +    +++ DL    +
Sbjct: 2192 NAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRA-MRSQLKKIEDLGAAME 2250

Query: 1602 TLIHNGNHHAPH----IKQRCDQL 1543
              +   N +  H    + Q+ DQL
Sbjct: 2251 EALILDNKYTEHSTVGLAQQWDQL 2274


>gi|34852958|ref|XP_346648.1| hypothetical protein XP_346647 [Rattus
            norvegicus]
          Length = 2362

 Score = 2640 bits (6843), Expect = 0.0
 Identities = 1325/2331 (56%), Positives = 1696/2331 (71%), Gaps = 66/2331 (2%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI +RRQ+VL  Y  FK+ S  +R +LE++ +FQ+F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DP+NLQ K+QKH+AFEAEVQA++  I  LD+TGN MI   HFASE I+ RL
Sbjct: 66   VASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLM 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH  W         KGIKL QA KL+ ++R+C++++ WI +KE  VT+E++G DLEHVE
Sbjct: 126  ELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I  K+++VN AW RL  LA
Sbjct: 186  VLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRLKGLAL 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET+ WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  EA +L ++HP  A  I  K ++    W  ++  A  R   L+ S++L R
Sbjct: 306  ALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            FLAD+RDL SW+ +MKA+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF     +GQ
Sbjct: 366  FLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSADESGQ 425

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
             L+  G   S EV+EKL  L  E+++LL LWE RR  YEQCMDLQLFYRDTEQ + WM+K
Sbjct: 426  ALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVDNWMSK 485

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            QEAFL N DLGDSLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 486  QEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVA 545

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPT 5419
                               R   L +S+  Q F RD DE+ SW+ EK+ TA D++Y DP+
Sbjct: 546  TRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPS 605

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
            N++GK+QKH  FE EL AN++R+D +   G+++ID  H+A + +  R+ +V +LW +L++
Sbjct: 606  NLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLWKKLLE 665

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+
Sbjct: 666  ATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEA 725

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
            D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +
Sbjct: 726  DVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLR 785

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+
Sbjct: 786  LQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQ 845

Query: 4698 AANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAW 4519
              N M+++GHF A +++ KL++L   W  LK+KA +RR DL+DSLQA QY +DANEA++W
Sbjct: 846  KGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESW 905

Query: 4518 MSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPM-G 4342
            M EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  PM
Sbjct: 906  MREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPMDD 965

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
            + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++
Sbjct: 966  ETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD 1025

Query: 4161 PGTA----------------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKR 4048
            P  +                      Q    ++  S+  +  ++E+ YQ L+ LGE RK
Sbjct: 1026 PAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELGEKRKG 1085

Query: 4047 KLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEV 3868
             LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE
Sbjct: 1086 MLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANES 1145

Query: 3867 RLQEMNQIATALTSVGQTETAVRIRQQ--------------------------------- 3787
            RL+++N++A  L S G     V+  QQ
Sbjct: 1146 RLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATF 1205

Query: 3786 --IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDL 3613
              I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL
Sbjct: 1206 NSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDL 1265

Query: 3612 RSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLT 3433
             SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W  L
Sbjct: 1266 ASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLG 1325

Query: 3432 SKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
             +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+R
Sbjct: 1326 KRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHR 1385

Query: 3252 TEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCL 3073
            TEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LD CL
Sbjct: 1386 TEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCL 1445

Query: 3072 ELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLK 2899
            ELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+
Sbjct: 1446 ELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 1505

Query: 2898 LFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
             FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE
Sbjct: 1506 AFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEA 1565

Query: 2718 WMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGG 2539
            W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I  GN+LIE   C G
Sbjct: 1566 WISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGS 1625

Query: 2538 EAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
            E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +FWL EVE LL SED
Sbjct: 1626 EDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASED 1685

Query: 2358 YGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR 2179
            YGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+ E+R  I  R
Sbjct: 1686 YGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGR 1745

Query: 2178 YDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRK 1999
            +  +K MAT RR KLS++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+K
Sbjct: 1746 FQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKK 1805

Query: 1998 HRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNR 1819
            H+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W +++ L   R
Sbjct: 1806 HKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGQEEIQQRLAQFVEHWKELKQLAAAR 1862

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
             QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH+ F+ D  +H
Sbjct: 1863 GQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVH 1922

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
            K RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R AKL +NSA+LQF
Sbjct: 1923 KDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFN 1982

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQ 1279
            WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQ
Sbjct: 1983 WKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQ 2042

Query: 1278 LVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKAST 1099
            L++++H QS AIE RH ++++RW  LLA+S  R+           ++E+L+L FAKKAS
Sbjct: 2043 LLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASA 2102

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNV 919
            FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V
Sbjct: 2103 FNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRV 2162

Query: 918  GPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLT 739
              NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+
Sbjct: 2163 ASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQ 2222

Query: 738  NTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY 577
             TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+Y
Sbjct: 2223 ETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKY 2282

Query: 576  TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFK 424
            TEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMM +
Sbjct: 2283 TEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMLQ 2333


>gi|38074607|ref|XP_207079.2| spectrin alpha 2 [Mus musculus]
          Length = 1818

 Score = 2144 bits (5555), Expect = 0.0
 Identities = 1071/1820 (58%), Positives = 1355/1820 (73%), Gaps = 64/1820 (3%)
 Frame = -1

Query: 5277 LRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVS 5098
            + +V +LW +L++AT  KG KLREA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +
Sbjct: 1    MNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTN 60

Query: 5097 VQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDP 4918
            VQNLQKK  L+E+D  AH DR+DGI   A+QFQ+  HF+A  I +KQE L  RY AL++P
Sbjct: 61   VQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEP 120

Query: 4917 LEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAE 4738
            +  RK+KL +S +  QLFRD+EDE  WIREKE +A STNRG+DLIGVQNL+KK QAL AE
Sbjct: 121  MVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAE 180

Query: 4737 IANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQA 4558
            IA H+ +I++V+   N M+++GHF A +++ KL++L   W  LK+KA +RR DL+DSLQA
Sbjct: 181  IAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQA 240

Query: 4557 HQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQ 4378
             QY +DANEA++WM EKEPIVGSTDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+Q
Sbjct: 241  QQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQ 300

Query: 4377 ASQCKYQEQPMG-QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASN----RDWWKVE 4213
            A  C+ Q  PM  + G++ VLALYDYQEKSPREV+MKKGD+LTLLN++N    RDWWKVE
Sbjct: 301  AQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKARHRDWWKVE 360

Query: 4212 VNDRQGFVPAAYVKRIEPGTA----------------------QQHAQQQVNSIGGKQSE 4099
            VNDRQGFVPAAYVK+++P  +                      Q    ++  S+  +  +
Sbjct: 361  VNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQ 420

Query: 4098 IEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEV 3919
            +E+ YQ L+ LGE RK  LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEV
Sbjct: 421  VEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNEEVGADLEQVEV 480

Query: 3918 LQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ---------------- 3787
            LQKKFDDF+ DLKANE RL+++N++A  L S G     V+  QQ
Sbjct: 481  LQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKT 540

Query: 3786 -------------------IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDW 3664
                               I++LN RWR+L          LGSAHEVQRFHRD DET++W
Sbjct: 541  ASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEW 600

Query: 3663 IQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAE 3484
            I+EK+ AL+++++G DL SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE
Sbjct: 601  IEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAE 660

Query: 3483 QIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELA 3304
             + +   ELN+ W  L  +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA
Sbjct: 661  DLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELA 720

Query: 3303 NDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARK 3124
             DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R
Sbjct: 721  KDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERT 780

Query: 3123 GLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP--SGDNVESLIKKHE 2950
             LE AWV RR +LD CLELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHE
Sbjct: 781  DLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHE 840

Query: 2949 DFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLG 2770
            DFDKAIN QEEKI  L+ FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLG
Sbjct: 841  DFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLG 900

Query: 2769 ESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAA 2590
            ESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI
Sbjct: 901  ESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRG 960

Query: 2589 IIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVK 2410
            +I  GN+LIE   C G E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +K
Sbjct: 961  VIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIK 1020

Query: 2409 DLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLEND 2230
            D +FWL EVE LL SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +
Sbjct: 1021 DFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSS 1080

Query: 2229 QFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVS 2050
             F   Q+ E+R  I  R+  +K MAT RR KLS++  +HQFFRD+DDEESWIKEKKLLVS
Sbjct: 1081 AFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVS 1140

Query: 2049 SDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRM 1870
            S+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+
Sbjct: 1141 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGQEEIQQRL 1197

Query: 1869 EDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGV 1690
                + W +++ L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +
Sbjct: 1198 AQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAI 1257

Query: 1689 QGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMA 1510
            QGLLKKH+ F+ D  +HK RV D+   G  LI   NHH  +I  +   L  ++ ++E  A
Sbjct: 1258 QGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAA 1317

Query: 1509 EGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGL 1330
              R AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL
Sbjct: 1318 AQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGL 1377

Query: 1329 NAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXX 1150
             AF+ EGI  IT LKDQL++++H QS AIE RH ++++RW  LLA+S  R+
Sbjct: 1378 QAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSH 1437

Query: 1149 XXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEE 970
              ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+
Sbjct: 1438 FRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQA 1497

Query: 969  DFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDK 790
            DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDK
Sbjct: 1498 DFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDK 1557

Query: 789  LRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAM 610
            LR+EFA+ ANAFH W+  TR  M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA
Sbjct: 1558 LRQEFAQHANAFHQWIQETRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAA 1617

Query: 609  LERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMM 430
            +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMM
Sbjct: 1618 MEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMM 1677

Query: 429  FKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEY 250
            FKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEY
Sbjct: 1678 FKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEY 1737

Query: 249  MAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDA 70
            MAFMIS+ETEN++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D
Sbjct: 1738 MAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG 1797

Query: 69   ISGRSIQGGLDYEQFVHALF 10
              GR +    DY +F  +LF
Sbjct: 1798 -KGRELPTAFDYVEFTRSLF 1816



 Score =  676 bits (1744), Expect = 0.0
 Identities = 422/1253 (33%), Positives = 653/1253 (51%), Gaps = 106/1253 (8%)
 Frame = -1

Query: 6876 IKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGM 6697
            +  R++++  L+         +   L+++ K     R+ +E+  WI EKE  +T E++G
Sbjct: 414  VSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNEEVGA 473

Query: 6696 DLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEG-HSEHDQIYKKRD------- 6541
            DLE VE+LQ+KFDDF K+L  ++ R+ +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 474  DLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPR 533

Query: 6540 ----------------------------DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
                                        ++N+ W  L  LA  R + L  AH+VQRF+RD
Sbjct: 534  DEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRD 593

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
            ADET  WI EK+ AL++D+YG DL +VQALQRKHEG ERDLAAL  K+  L + A +L +
Sbjct: 594  ADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQ 653

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
            +HP+ AE + +K  +   AW +L ++A  RK  L  S  L RFL+D+RDL+SWI  ++ +
Sbjct: 654  SHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGL 713

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            + +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G   SPE++EKL+
Sbjct: 714  VSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLD 773

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             LD E++ L   W +RR++ + C++LQLF+RD EQAE WM  +EAFL   D GDSLDSVE
Sbjct: 774  ILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVE 833

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXX 5545
             LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D+A
Sbjct: 834  ALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMI 893

Query: 5544 XRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKA 5365
             + + L ES   Q F RD DE+ +WI+EKL TA D+SY DPTNI+ K QKH  FE EL A
Sbjct: 894  EKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHA 953

Query: 5364 NENRLDDIRSTGEQIIDSGHFAA--DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
            N +R+  +   G  +I+ G  A   D +  RL  + + W  LV  + +K  KL+EA  +Q
Sbjct: 954  NADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQ 1013

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
             FN  I+D + WLSE+E  +ASEDYGKDL SV NL KK  L+E+D +AH DR+  +   A
Sbjct: 1014 NFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQA 1073

Query: 5010 QQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIR 4831
                    F+   +  K++ +  R+  ++     R+ KL ESH+ +Q FRD++DE +WI+
Sbjct: 1074 DSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIK 1133

Query: 4830 EKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEI 4651
            EK+ +  S + GRDL GVQNL KK + L AE+A H+  I+ V      +         EI
Sbjct: 1134 EKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEI 1193

Query: 4650 RDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKD 4471
            + +LAQ  ++W+ LK  A  R   L++SL+  Q++++  E +AW++EK  +V S DYG
Sbjct: 1194 QQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDT 1253

Query: 4470 EDSAEALLKKHRALLSD--------------------------------LEAFKGTIEDL 4387
              + + LLKKH A  +D                                ++   G + DL
Sbjct: 1254 LAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDL 1313

Query: 4386 RKQASQCKYQEQPMGQLGRDCVLALYDYQEK------SPREVSMKKGD-------VLTLL 4246
             K A+Q K       +L  +     ++++          +E S+K  D       V TLL
Sbjct: 1314 EKAAAQRK------AKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLL 1367

Query: 4245 NASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMML 4066
                     ++   ++G      +K  +   A +H Q +  +I  + + +  ++ +L+
Sbjct: 1368 TKQETFDAGLQAFQQEGIANITALK--DQLLAAKHIQSK--AIEARHASLMKRWTQLLAN 1423

Query: 4065 GETRKRKLEEACKGYQ--------LLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQK 3910
              TRK+KL EA   ++          ++A+    W ++ E           LE+++ L++
Sbjct: 1424 SATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALRE 1483

Query: 3909 KFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXX 3730
              D F+  L + +    ++ ++   + S  +  +       +E L   WR L
Sbjct: 1484 AHDAFRSSLSSAQADFNQLAELDRQIKSF-RVASNPYTWFTMEALEETWRNLQKIIKERE 1542

Query: 3729 XQLGS---------------AHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQAL 3595
             +L                 A     FH+ + ETR  + E+   L+S+        ++A
Sbjct: 1543 LELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESGTLESQ--------LEAT 1594

Query: 3594 QRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRL 3436
            +RKH+    ++ A+  ++K +++    + ++     +        L +QW++L
Sbjct: 1595 KRKHQ----EIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 1643



 Score =  481 bits (1237), Expect = e-133
 Identities = 409/1697 (24%), Positives = 748/1697 (43%), Gaps = 116/1697 (6%)
 Frame = -1

Query: 6543 DDVNDAWHRLNTLAATRKEG--LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLN 6370
            ++V   W +L  L AT  +G  L  A+Q Q+FNR+ ++   W+ E +  L+SDDYG+DL
Sbjct: 2    NEVISLWKKL--LEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLT 59

Query: 6369 NVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKE 6190
            NVQ LQ+KH   E D+AA + ++  +  +A +  +     AE I +K +   A + ALKE
Sbjct: 60   NVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKE 119

Query: 6189 KAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKG 6010
                RK  L  S +L +   D  D  +WI + + +  +    KD+ G + LL+ HQ  +
Sbjct: 120  PMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQA 179

Query: 6009 EIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMD 5830
            EI             G  +VE G   + +V+ KL +L+ +  +L     +RR   E  +
Sbjct: 180  EIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQ 239

Query: 5829 LQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDE 5650
             Q ++ D  +AE+WM ++E  + +TD G   DS E L+KKHE     L+A    I AL E
Sbjct: 240  AQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALRE 299

Query: 5649 FATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSW 5470
             A    Q      D+  +                       +E   R+   +  D +
Sbjct: 300  QAQSCRQQVAPMDDETGKELVLALYD--------------YQEKSPREVTMKKGDILTLL 345

Query: 5469 ITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHF---- 5302
             +   +  RD   ++  + +G +      + +   + +R + +   G   +  G
Sbjct: 346  NSTNKARHRDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQT 405

Query: 5301 ----AADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQ 5134
                 A  +  R++QV  L+  L++   K+   L ++  +    R   +++ W++E E
Sbjct: 406  RITKEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAA 465

Query: 5133 VASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPV-IVRKQ 4957
            + +E+ G DL  V+ LQKK    + D  A+  R+  I ++A+  + E      V  V++Q
Sbjct: 466  LTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQ 525

Query: 4956 E-----------------------------------NLQQRYNALRDPLEKRKRKLGESH 4882
            E                                    L +R+ +L+   E+R + LG +H
Sbjct: 526  EVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAH 585

Query: 4881 QGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVS 4702
            +  +  RD ++   WI EK Q   + N G DL  VQ L +K +    ++A    ++ S+
Sbjct: 586  EVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLG 645

Query: 4701 SAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADA 4522
              A  +IQ     A ++++K  +L   W  L  +A++R+  L DS    ++LSD  +  +
Sbjct: 646  ETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMS 705

Query: 4521 WMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC-------- 4366
            W++    +V S +  KD   AEALL++H+   ++++A  GT +   +   Q
Sbjct: 706  WINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYAS 765

Query: 4365 ------------------KYQEQPMGQLGRDCVLALYDYQ-EKSPREVSMKKGDVLTLLN 4243
                              K   Q    L     L L+    E++   ++ ++  + T
Sbjct: 766  PEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDK 825

Query: 4242 ASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQV-------NSIGGKQSEIEDKY 4084
              + D  +  +   + F  A  V+  +    Q  A Q +         I  +++E+ D++
Sbjct: 826  GDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRW 885

Query: 4083 QRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKF 3904
            +RL      ++ KL E+    Q  R+ +++  WI S +   A  E   D   ++   +K
Sbjct: 886  RRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWI-SEKLQTASDESYKDPTNIQSKHQKH 944

Query: 3903 DDFKGDLKANEVRLQEMNQIATALTSVGQ---TETAVRIRQQIEDLNARWRALXXXXXXX 3733
              F+ +L AN  R++ +  +  +L   G    +E AV+ R  +  L  +W+ L
Sbjct: 945  QAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKAR--LAALADQWQFLVQKSAEK 1002

Query: 3732 XXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAAL 3553
              +L  A++ Q F+  + +   W+ E +  L SED+G+DL SV  L +KH+ +E D++A
Sbjct: 1003 SQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAH 1062

Query: 3552 GDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFL 3373
             D++K L+ +A+ L  S      Q+ + +  +N ++ ++ S A +R+ KL +S+   +F
Sbjct: 1063 EDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFF 1122

Query: 3372 SDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQL 3193
             D  D   WI     LVSS++   D+TG + L ++H+    E+ +     Q     G +L
Sbjct: 1123 RDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL 1182

Query: 3192 LNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSARE 3013
             + +     +I+ RL    E  K L+    AR   L++ LE Q F  + E+ + W++ +
Sbjct: 1183 SDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKM 1242

Query: 3012 AFLAQEDPSGDN---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTR 2842
              +A ED  GD    ++ L+KKHE F+      ++++  +    + LIK N++    ++
Sbjct: 1243 TLVASED-YGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISS 1301

Query: 2841 KRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPT 2665
            K   +  + + L++A  Q++ KL E+    QF+  AD +E+W+ EK    + ++Y RD +
Sbjct: 1302 KMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLS 1361

Query: 2664 NIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLL 2485
            ++Q    KQ+ F+A L A      A I A  + +  AK    + A+ AR  +L  +W  L
Sbjct: 1362 SVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSK-AIEARHASLMKRWTQL 1420

Query: 2484 VKTTTEKSYRLKEANKQ--------KSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVEN 2329
            +  +  +  +L EA            +F         W    E  L        L  ++
Sbjct: 1421 LANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKA 1480

Query: 2328 LLKKHSLLEADIVAHQ---DRVGEMNEQADSL--------------LENDQFQGQQIAER 2200
            L + H    + + + Q   +++ E++ Q  S               LE      Q+I +
Sbjct: 1481 LREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKE 1540

Query: 2199 RKLIADRYDGVKKMATDRRDKLSK--ALNVHQFFRDIDDEESWIKEKKLLVSS--DDYGR 2032
            R+L   +    ++   +  DKL +  A + + F + I +  S + E+   + S  +   R
Sbjct: 1541 RELELQK----EQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESGTLESQLEATKR 1596

Query: 2031 DLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQS 1852
                ++ +R + ++I+   A+ E  + L     E      A+     DQ+  RM+   +
Sbjct: 1597 KHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQ 1656

Query: 1851 WGQIRDLTGNRHQRLDE 1801
              Q R+ TG   + L E
Sbjct: 1657 QIQARNTTGVTEEALKE 1673



 Score =  466 bits (1199), Expect = e-129
 Identities = 384/1627 (23%), Positives = 713/1627 (43%), Gaps = 105/1627 (6%)
 Frame = -1

Query: 6864 LEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEH 6685
            + E+ +LW         KGIKL++A +   F R  ++I  W+ E E ++ ++D G DL +
Sbjct: 1    MNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTN 60

Query: 6684 VEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTL 6505
            V+ LQ+K      ++  HQ RI+ I   A +  + GH + + I KK++ +   +  L
Sbjct: 61   VQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEP 120

Query: 6504 AATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERD 6325
               RK+ L  + ++Q+  RD ++   WI EK+   +S + G+DL  VQ L +KH+  + +
Sbjct: 121  MVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAE 180

Query: 6324 LAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQL 6145
            +A  E ++  + ++ + + E     AE +  K  +    W ALK KA  R+  LE S Q
Sbjct: 181  IAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQA 240

Query: 6144 HRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASA 5965
             ++ AD  +  SW+ + + ++G+ +  KD   AEALL+ H+    ++ A   S
Sbjct: 241  QQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQ 300

Query: 5964 GQKLVEMGIPESPEVQEKLEKLDH---EKSSLLGLWEERRILYEQCMDLQLFYRDTEQAE 5794
             Q   +   P   E  ++L    +   EKS      ++  IL       +  +RD  + E
Sbjct: 301  AQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKARHRDWWKVE 360

Query: 5793 TWMNKQEAFLANTDLGDSLDSVEHLIKKH-EDFEKSLAAQEEKINALDEFATKLIQGQHY 5617
              +N ++ F+    +   LD  +   +++  + + S+A ++ +I+       +
Sbjct: 361  --VNDRQGFVPAAYV-KKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKE------- 410

Query: 5616 AADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK-LSTARD 5440
             A  V+                   R   L++S K+    R+ +E+  WITEK  +   +
Sbjct: 411  -AGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNE 469

Query: 5439 DSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAAD----------- 5293
            +   D   +    +K  +F+++LKANE+RL DI    E +   G  A +
Sbjct: 470  EVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYG 529

Query: 5292 -------------------------HIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQ 5188
                                        + ++++N  W  L     ++   L  A   Q+
Sbjct: 530  AMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQR 589

Query: 5187 FNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQ 5008
            F+R+ ++ + W+ E    + +++YG DL SVQ LQ+K    E D  A  D+V+ + + AQ
Sbjct: 590  FHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQ 649

Query: 5007 QFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIRE 4828
            +  +    +A  +  K   L Q + +L    ++RK KLG+SH   +   D  D ++WI
Sbjct: 650  RLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWING 709

Query: 4827 KEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIR 4648
               +  S    +D+ G + L+++ Q    EI       ++       ++  GH+ +PEI+
Sbjct: 710  IRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIK 769

Query: 4647 DKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDE 4468
            +KL  L      L+    +RR  LD  L+   +  D  +A+ WM+ +E  + + D G
Sbjct: 770  EKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSL 829

Query: 4467 DSAEALLKKHRALLSDLEAFKGTIEDLRKQASQ-CKYQEQPMGQLG--RDCVLALYDYQE 4297
            DS EAL+KKH      +   +  I  L+  A Q         G +   R+ VL  +   +
Sbjct: 830  DSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLK 889

Query: 4296 KSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQ-QHAQQQV-- 4126
                E   K G+  TL   S RD  ++E    +    A+     +P   Q +H + Q
Sbjct: 890  AQMIEKRSKLGESQTLQQFS-RDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFE 948

Query: 4125 ------------------------------NSIGGKQSEIEDKYQRLMMLGETRKRKLEE 4036
                                          +++  + + + D++Q L+     + +KL+E
Sbjct: 949  AELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKE 1008

Query: 4035 ACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQE 3856
            A K         D   W+   EA+ A ++ G DL  V  L KK    + D+ A+E RL++
Sbjct: 1009 ANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKD 1068

Query: 3855 MNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDE 3676
            +N  A +L +    +T+ +++++ + +N R++ +         +L  +H + +F RD+D+
Sbjct: 1069 LNSQADSLMTSSAFDTS-QVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDD 1127

Query: 3675 TRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHP 3496
               WI+EK   + SED+GRDL  VQ L++KH+ +E +LAA    I+ + +   +L   +
Sbjct: 1128 EESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNT 1187

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
               E+I     +  E W  L   A  R ++L +S +YQ+F+++  +   WI     LV+S
Sbjct: 1188 IGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVAS 1247

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
            ++  + +   + LL++H+ + T+              G  L+  +++   +I ++++G+N
Sbjct: 1248 EDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLN 1307

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
                 LE A   R+  LD+      F    +  ++W+  +E  L  +D   D  +V++L+
Sbjct: 1308 GKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLL 1367

Query: 2961 KKHEDFDKAINT-QEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
             K E FD  +   Q+E I  +    + L+   H  S A+  +   ++ RW  L      +
Sbjct: 1368 TKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATR 1427

Query: 2784 RFKLGESQT--------LQQFSRDADEIENWMTEKFQIAQEENYRDPT------NIQQKH 2647
            + KL E+Q+           F++ A    +W         EE+  DP        I+
Sbjct: 1428 KKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFEN-----AEEDLTDPVRCNSLEEIKALR 1482

Query: 2646 QKQQAFEAEL---HANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKT 2476
            +   AF + L    A+ +++A +    +  I++ +           ++AL + W  L K
Sbjct: 1483 EAHDAFRSSLSSAQADFNQLAEL----DRQIKSFRVASNPYTWFT-MEALEETWRNLQKI 1537

Query: 2475 TTEKSYRL-KEANKQ-------KSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLK 2320
              E+   L KE  +Q       + F         W+ E    +  E+ G   + +E   +
Sbjct: 1538 IKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCM-VEESGTLESQLEATKR 1596

Query: 2319 KHSLLEA 2299
            KH  + A
Sbjct: 1597 KHQEIRA 1603



 Score =  452 bits (1163), Expect = e-125
 Identities = 395/1703 (23%), Positives = 741/1703 (43%), Gaps = 127/1703 (7%)
 Frame = -1

Query: 7173 EVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILE-KLQTAQEENFRDPSNLQ 6997
            EV+  +    + ++ K  +L EA Q Q F R+ +++ +W+ E +   A ++  +D +N+Q
Sbjct: 3    EVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQ 62

Query: 6996 AKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXX 6817
               +KH   EA+V AH   I  +           HF +E+IKK+ E L A +
Sbjct: 63   NLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMV 122

Query: 6816 XKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELG 6637
             +  KL  +L+L    R  ++   WIREKE    + + G DL  V+ L +K      E+
Sbjct: 123  ARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIA 182

Query: 6636 NHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQR 6457
             H+ RI  + Q  + +VEEGH   + +  K  ++N  W  L   A+ R++ L  + Q Q+
Sbjct: 183  GHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQ 242

Query: 6456 FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAH 6277
            +  DA+E  +W+ EK+  + S DYG+D ++ +AL +KHE    DL+A    +  L ++A
Sbjct: 243  YFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQ 302

Query: 6276 KLA--------ETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
                       ET  +   A++   + +       +E    + D L      ++  A +R
Sbjct: 303  SCRQQVAPMDDETGKELVLALYDYQEKSP------REVTMKKGDILTLLNSTNK--ARHR 354

Query: 6120 DLISW----IGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSF-NQTASAGQK 5956
            D   W    + D +  + A  + K      A  E+  E +G I  R     NQT
Sbjct: 355  D---WWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRIT--- 408

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
                   E+  V  ++++++    SLL L E+R+ + E+     + +R+  + + W+ ++
Sbjct: 409  ------KEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEK 462

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL------------I 5632
            EA L N ++G  L+ VE L KK +DF+K L A E ++  +++ A  L            +
Sbjct: 463  EAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAV 522

Query: 5631 QGQH-YAA--DDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKR---------------- 5509
            Q Q  Y A   D A+                    N++KE  +R
Sbjct: 523  QQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLG 582

Query: 5508 -----QTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENRLD 5347
                 Q F RD DE   WI EK      D+Y  D  +++   +KH  FE++L A  ++++
Sbjct: 583  SAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVN 642

Query: 5346 DIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIED 5167
             +  T +++I S   +A+ + ++  ++N  W  L    +++ AKL ++ + Q+F  +  D
Sbjct: 643  SLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRD 702

Query: 5166 VEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEH 4987
            + +W++ + G V+S++  KD+   + L ++     ++ +A        +Q  QQ     H
Sbjct: 703  LMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGH 762

Query: 4986 FNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGS 4807
            + +P I  K + L Q    L     +R+  L    +     RD E    W+  +E    +
Sbjct: 763  YASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNT 822

Query: 4806 TNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLR 4627
             ++G  L  V+ LIKK +     I   + +I ++ + A+ +I   H+   +I ++  ++
Sbjct: 823  EDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVL 882

Query: 4626 DNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALL 4447
            D WR LK++  ++R+ L +S    Q+  D +E +AW+SEK        Y KD  + ++
Sbjct: 883  DRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESY-KDPTNIQSKH 941

Query: 4446 KKHRALLSDLEA----FKGTIE---DLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSP 4288
            +KH+A  ++L A     +G I+    L ++ +    ++    +L        +  Q+ +
Sbjct: 942  QKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAE 1001

Query: 4287 REVSMKKGDVLTLLNASNR--DWWKVEVN-------------------DRQGFVPA---A 4180
            +   +K+ +     N   +  D+W  EV                     +   + A   A
Sbjct: 1002 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1061

Query: 4179 YVKRIEPGTAQQHAQQ-----QVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQL 4015
            +  R++   +Q  +         + +  K+  I  ++Q++  +  +R+ KL E+ + +Q
Sbjct: 1062 HEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQF 1121

Query: 4014 LREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATA 3835
             R+ +D   WIK ++ + + ++ G DL  V+ L+KK    + +L A+E  +Q +
Sbjct: 1122 FRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKK 1181

Query: 3834 LT---SVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDW 3664
            L+   ++GQ E   R+ Q +E     W+ L         +L  + E Q+F  +V+E   W
Sbjct: 1182 LSDDNTIGQEEIQQRLAQFVE----HWKELKQLAAARGQRLEESLEYQQFVANVEEEEAW 1237

Query: 3663 IQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAE 3484
            I EK   + SED+G  L ++Q L +KHE  E D     D++  +      L + +    E
Sbjct: 1238 INEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEE 1297

Query: 3483 QIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELA 3304
             I    + LN + + L   A  RK KL ++  + +F      +  WI      + + +
Sbjct: 1298 NISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYG 1357

Query: 3303 NDVTGAEALLERHQEYRTEIDSRAATFQAFDQFG--------NQLLNSHHYAAGDIENR- 3151
             D++  + LL + + +        A  QAF Q G        +QLL + H  +  IE R
Sbjct: 1358 RDLSSVQTLLTKQETF-------DAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARH 1410

Query: 3150 ----------LQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLA 3001
                      L      +K L +A    R + D  L    F +     ++W    E  L
Sbjct: 1411 ASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFL---TFAKKASAFNSWFENAEEDLT 1467

Query: 3000 QEDP----SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRD 2833
              DP    S + +++L + H+ F  ++++ +     L      +       +P      +
Sbjct: 1468 --DPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTME 1525

Query: 2832 QILDRWNGLKEALIQKRFKLGESQ--------TLQQFSRDADEIENWMTEKFQIAQEENY 2677
             + + W  L++ + ++  +L + Q          Q+F++ A+    W+ E      EE+
Sbjct: 1526 ALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESG 1585

Query: 2676 RDPTNIQ---QKHQKQQAFEAELHANSDRIAAIIQA---GNNLIENAKCGGGEAAVSARL 2515
               + ++   +KHQ+ +A  ++L    D  AA+ +A    N   E++  G
Sbjct: 1586 TLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVG---------- 1635

Query: 2514 KALNDQWDLLVKTTTEKSYRLKE 2446
              L  QWD L +      + L++
Sbjct: 1636 --LAQQWDQLDQLGMRMQHNLEQ 1656



 Score =  402 bits (1034), Expect = e-110
 Identities = 376/1605 (23%), Positives = 690/1605 (42%), Gaps = 119/1605 (7%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            A++I ++++ ++  Y   K+    ++ +L ++ + Q   RD ++   WI EK   A   N
Sbjct: 100  AENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTN 159

Query: 7020 F-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHAL 6844
              +D   +Q  ++KH+A +AE+  H   I  + + GNAM++  HFA+E +K +L EL+
Sbjct: 160  RGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLSELNQK 219

Query: 6843 WXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRK 6664
            W         +   L+ +L+   +    +E   W+REKE  V + D G D +  E L +K
Sbjct: 220  WEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKK 279

Query: 6663 FDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
             +  + +L  +   I  + + A    ++     D+  K+       +   +    T K+G
Sbjct: 280  HEALMSDLSAYGSSIQALREQAQSCRQQVAPMDDETGKELVLALYDYQEKSPREVTMKKG 339

Query: 6483 -LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEG 6307
             +          R  D     + ++        Y + L+  Q+  R++   E+   AL
Sbjct: 340  DILTLLNSTNKARHRDWWKVEVNDRQ-GFVPAAYVKKLDPAQSASRENLLEEQGSIALRQ 398

Query: 6306 KMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLAD 6127
              +  +    K        A ++  +    +  + +L E  + RK  LE+S +      +
Sbjct: 399  GQIDNQTRITK-------EAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFRE 451

Query: 6126 YRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEI---DARADSFNQTA----S 5968
              +L  WI + +A +  +E+  D+   E L +   + + ++   ++R    N+ A    S
Sbjct: 452  ANELQQWITEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLES 511

Query: 5967 AGQKLVEMGIPESPEVQ-----------------------------EKLEKLDHEKSSLL 5875
             G    E+   +  EV                                +++L+    SL
Sbjct: 512  EGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQ 571

Query: 5874 GLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFE 5695
             L EER  L     ++Q F+RD ++ + W+ ++   L   + G  L SV+ L +KHE FE
Sbjct: 572  QLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFE 631

Query: 5694 KSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESY 5515
            + LAA  +K+N+L E A +LIQ    +A+D+ E                  R   L +S+
Sbjct: 632  RDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSH 691

Query: 5514 KRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIR 5338
              Q F  D  +++SWI   +   + D+   D T     L++H     E+ A
Sbjct: 692  DLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFE 751

Query: 5337 STGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEA 5158
              G+Q++  GH+A+  I ++L  ++    +L  A  ++   L      Q F+R+ E  E
Sbjct: 752  QFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAEN 811

Query: 5157 WLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNA 4978
            W++  E  + +ED G  L SV+ L KK    +   N   +++  ++  A Q    +H+
Sbjct: 812  WMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAK 871

Query: 4977 PVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNR 4798
              I  ++  +  R+  L+  + +++ KLGES    Q  RD+++  AWI EK Q A S
Sbjct: 872  GDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTA-SDES 930

Query: 4797 GRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPE--IRDKLAQLRD 4624
             +D   +Q+  +K QA  AE+  +  +I  V    N +I++G     E  ++ +LA L D
Sbjct: 931  YKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALAD 990

Query: 4623 NWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLK 4444
             W+ L  K+ ++   L ++ +   + +   + D W+SE E ++ S DYGKD  S   LLK
Sbjct: 991  QWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLK 1050

Query: 4443 KHRALLSDLEAFKGTIEDLRKQA-----------SQCK---------YQEQPMGQLGRDC 4324
            KH+ L +D+ A +  ++DL  QA           SQ K         +Q+       R
Sbjct: 1051 KHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRA 1110

Query: 4323 VLA----LYD-YQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEP 4159
             L+    L+  +++    E  +K+  +L       RD   V+ N R+        KR+E
Sbjct: 1111 KLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ-NLRKKH------KRLEA 1163

Query: 4158 G-TAQQHAQQQVNSIGGK--------QSEIEDK-------YQRLMMLGETRKRKLEEACK 4027
               A + A Q V   G K        Q EI+ +       ++ L  L   R ++LEE+ +
Sbjct: 1164 ELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLE 1223

Query: 4026 GYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQ 3847
              Q +    +   WI  +  + A ++ G  L  ++ L KK + F+ D   ++ R+ ++
Sbjct: 1224 YQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCT 1283

Query: 3846 IATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRD 3667
                L           I  +++ LN +   L         +L       +F+   D
Sbjct: 1284 NGQDLIKKNNHHEE-NISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVES 1342

Query: 3666 WIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK-IKSLDEKANRLRQSHPEA 3490
            WI EK+++L ++D+GRDL SVQ L  K E  +  L A   + I ++    ++L  +
Sbjct: 1343 WIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQ 1402

Query: 3489 AEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDY--------RDLMQWIASM 3334
            ++ I      L ++W +L + +  RK+KLL++  + R + D              W  +
Sbjct: 1403 SKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENA 1462

Query: 3333 NQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQL----LNSHHYAAG 3166
             + ++     N +   +AL E H  +R+ + S  A F    +   Q+    + S+ Y
Sbjct: 1463 EEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWF 1522

Query: 3165 DIENRLQGVNEARKGLEDAWVARRNIL-DQCLELQLFYRDCEQAD--------------T 3031
             +E            LE+ W   + I+ ++ LELQ   R  E+ D
Sbjct: 1523 TME-----------ALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQ 1571

Query: 3030 WMSAREAFLAQEDPSGDN-VESLIKKHEDFDKAINTQEEKIKGL-KLFAESLIKNNHYDS 2857
            W+    + + +E  + ++ +E+  +KH++  +A+ +Q +KI+ L     E+LI +N Y
Sbjct: 1572 WIQETRSCMVEESGTLESQLEATKRKHQEI-RAMRSQLKKIEDLGAAMEEALILDNKYTE 1630

Query: 2856 PAVT------RKRDQILDRWNGLKEALIQKRFKLG-ESQTLQQFS 2743
             +         + DQ+  R     E  IQ R   G   + L++FS
Sbjct: 1631 HSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFS 1675



 Score =  340 bits (873), Expect = 2e-91
 Identities = 250/940 (26%), Positives = 429/940 (45%), Gaps = 15/940 (1%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 574  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 633

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   +IQ +  ++E +K++  EL+  W         +  KL  +  L
Sbjct: 634  LAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDL 693

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +  +   E+           Q
Sbjct: 694  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQF 753

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 754  GQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWM 813

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAE 6244
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L A  H  + +
Sbjct: 814  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGD 873

Query: 6243 AIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELA 6064
              +++N +    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE
Sbjct: 874  IANRRN-EVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESY 931

Query: 6063 KDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHE 5890
            KD    ++  + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +
Sbjct: 932  KDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQ 991

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L+    E+    ++    Q F    +  + W+++ EA LA+ D G  L SV +L+KK
Sbjct: 992  WQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKK 1051

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  ++A E+++  L+  A  L+    +    V E                  R
Sbjct: 1052 HQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAK 1111

Query: 5529 LKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
            L ES++   F RD D+  SWI E KL  + +D   D T ++   +KH   E EL A+E
Sbjct: 1112 LSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPA 1171

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +  +  TG+++ D      + I  RL Q    W EL      +G +L E+   QQF  N+
Sbjct: 1172 IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 1231

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
            E+ EAW++E    VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++
Sbjct: 1232 EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 1291

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
             + +   I  K + L  + + L     +RK KL E+    Q     +   +WI EKE
Sbjct: 1292 NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 1351

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLA 4636
             + + GRDL  VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A
Sbjct: 1352 KTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHA 1411

Query: 4635 QLRDNWRILKSKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTD 4483
             L   W  L + +  R+  L ++ Q+H       +L+ A +A A   W    E  +
Sbjct: 1412 SLMKRWTQLLANSATRKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPV 1470

Query: 4482 YGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                 +  +AL + H A  S L + +     L +   Q K
Sbjct: 1471 RCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIK 1510



 Score =  281 bits (718), Expect = 2e-73
 Identities = 196/762 (25%), Positives = 341/762 (44%), Gaps = 23/762 (3%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            DI  RR EVL  +   K     KR +L E++  Q F RD DE+  WI EKLQTA +E+++
Sbjct: 873  DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK 932

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEH--IKKRLEELHALW 6841
            DP+N+Q+K QKH+AFEAE+ A+A  I  +   GN++I+    A     +K RL  L   W
Sbjct: 933  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 992

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KL++A K  +F     +  +W+ E E  + +ED G DL  V  L +K
Sbjct: 993  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 1052

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 ++  H+ R+ ++N  AD L+     +  Q+ +KRD +N  + ++ ++A +R+  L
Sbjct: 1053 QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 1112

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +H++ +F RD D+  +WI EK L +SS+DYGRDL  VQ L++KH+  E +LAA E  +
Sbjct: 1113 SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 1172

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              +     KL++ +    E I Q+       W  LK+ A  R   LE S +  +F+A+
Sbjct: 1173 QGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 1232

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +WI +   ++ +++    +A  + LL+ H+  + +     D  N   + GQ L++
Sbjct: 1233 EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN 1292

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
                  +  K++ L+ + S L     +R+   ++      F    +  E+W+ ++E  L
Sbjct: 1293 NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 1352

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAA-QEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
              D G  L SV+ L+ K E F+  L A Q+E I  +     +L+  +H  +  +
Sbjct: 1353 TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHAS 1412

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTAR------DDSYLDP 5422
                          R   L E+   Q+  R  +++     +K S         ++   DP
Sbjct: 1413 LMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDP 1469

Query: 5421 T------NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
                    I+   + H  F   L + +   + +     QI      +  +    +  +
Sbjct: 1470 VRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEE 1529

Query: 5259 LWNELVDATNKKGAKL-----REAGNE---QQFNRNIEDVEAWLSELEGQVASEDYGKDL 5104
             W  L     ++  +L     R+  N+   Q+F ++      W+ E    +  E
Sbjct: 1530 TWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEES----- 1584

Query: 5103 VSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNA 4978
                      G +ES   A   +   I+ +  Q ++ E   A
Sbjct: 1585 ----------GTLESQLEATKRKHQEIRAMRSQLKKIEDLGA 1616



 Score =  107 bits (268), Expect = 3e-21
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 10/312 (3%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            ++I QR  + + H+   K  +  +  RLEE+ ++Q F  + +E   WI EK+     E++
Sbjct: 1191 EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDY 1250

Query: 7017 RDP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
             D  + +Q  ++KHEAFE +   H   + ++   G  +I+ N+   E+I  +++ L+
Sbjct: 1251 GDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKV 1310

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  KL +    L F  + D +  WI EKE  +  +D G DL  V+ L  K
Sbjct: 1311 SDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQ 1370

Query: 6660 DDFLKELGNHQYR-INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            + F   L   Q   I  I    D+L+   H +   I  +   +   W +L   +ATRK+
Sbjct: 1371 ETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKK 1430

Query: 6483 LFGAHQVQR--------FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTER 6328
            L  A    R        F + A    +W    +  L+       L  ++AL+  H+
Sbjct: 1431 LLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRS 1490

Query: 6327 DLAALEGKMLQL 6292
             L++ +    QL
Sbjct: 1491 SLSSAQADFNQL 1502


>gi|47211130|emb|CAF90368.1| unnamed protein product [Tetraodon
            nigroviridis]
          Length = 2569

 Score = 2141 bits (5548), Expect(2) = 0.0
 Identities = 1154/2496 (46%), Positives = 1573/2496 (62%), Gaps = 181/2496 (7%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI  RRQ+VL  Y  FK+ S  +R +LE++ +FQ F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DPSNLQ K+QKH+AFEAEVQA+A TI  LD+TGN MI   HFASE I+ RLE
Sbjct: 66   IASDENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLE 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH LW         KG++L QA KL+ ++R+C++ L WI +KE   T+E++G DLEHVE
Sbjct: 126  ELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I +K+D+VN AW RL  LA
Sbjct: 186  LLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQ 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI EK+  ++SDD+GRDL +VQAL RKHEG ERDLA
Sbjct: 246  QRQGRLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  +A +L ETHP  A  I  K D+  A W  ++  A  R   L+ S++L R
Sbjct: 306  ALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAAERHARLDDSYRLQR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            F AD+RDL SW+ +M+A+I ADELA DVAGAEALL+ HQEHKGEIDA  DSF  T  AGQ
Sbjct: 366  FTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSTDEAGQ 425

Query: 5958 KLVEMGIPESPEVQEK----------------------------LEKLDHEKSSLLGLWE 5863
             LV  G   S EV+EK                            L  L  EK +LL LWE
Sbjct: 426  ALVNTGHYASEEVKEKVGLPPDCPQTAGVVFSCVSRVCVCVRVQLGILSEEKEALLNLWE 485

Query: 5862 ERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLA 5683
             RR  YEQCMDLQLFYRDTEQ + WM+KQEAFL N DLGDSLDSVE L+KKHEDFEKSL+
Sbjct: 486  VRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLS 545

Query: 5682 AQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQT 5503
            AQEEKI ALDEFATKLIQ  HYA +DVA                   R  AL++S+  Q
Sbjct: 546  AQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQ 605

Query: 5502 FDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQ 5323
            F RD DE+ SWI EK+ TA D++Y DP+N++GK+QKH  FE EL AN++R+D ++ +G+
Sbjct: 606  FFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQD 665

Query: 5322 IIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEA----- 5158
            +++  H+A+  +  R+ +V++ W +L++AT  K ++ + A   QQ       V
Sbjct: 666  LLERKHYASSEVARRMEEVSSQWKKLLEATELKASRGQPAAAVQQERGGHRAVAVRGGGP 725

Query: 5157 -WLSEL-EGQVASEDYGKDLVSVQNLQK-KIGLIE-SDFNAHNDRVDGIKQLAQQFQEEE 4990
              L  L +G     +  ++  +    +    GL+  +   +  DR+DGI   A+QFQE
Sbjct: 726  PGLRRLRQGPDQRPEPAEEARAAGGRRGCSPGLLRVNSLISSQDRIDGISIQARQFQEAG 785

Query: 4989 HFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAG 4810
            HF+A  I RKQE L  RY ALR P+  RK+KL +S +  QLFRD+EDE  WIREKE +A
Sbjct: 786  HFDADNIRRKQEALALRYEALRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAA 845

Query: 4809 STNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQL 4630
            STNRG+DLIGVQNL+KK QAL AEI  H+ +I++V+     M+++GHF   +++ KL +L
Sbjct: 846  STNRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTEL 905

Query: 4629 RDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEAL 4450
               W  LK KA +R+ DL+DSLQA QY +DANEA++WM EKEPIVGSTDYGKDEDSAEAL
Sbjct: 906  HGRWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEAL 965

Query: 4449 LKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLALYDYQEKSPREVSM 4273
            LKKH AL+SDL A+  +I+ L++QA  C+ Q  P   + G++ VLALYDYQEKSPREV+M
Sbjct: 966  LKKHEALMSDLSAYGSSIQGLKEQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTM 1025

Query: 4272 KKGDVLTLLNASNR-----------------------------------------DWWKV 4216
            KKGD+LTLLN++N+                                         DWWKV
Sbjct: 1026 KKGDILTLLNSTNKVERWLACSRAAGSAPPWWRLQVVGLAEPSSLHPMTCGLSWQDWWKV 1085

Query: 4215 EVNDRQGFVPAAYVKRIEPGTA-------QQHA-----QQQVN---------SIGGKQSE 4099
            EVNDRQGFVPAAYVK+++P  +       ++H      Q Q+          S+  +  +
Sbjct: 1086 EVNDRQGFVPAAYVKKLDPNQSSSRENLLEEHGSIALRQDQIENQLVTKEACSVSVRMKQ 1145

Query: 4098 IEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEV 3919
            +E+ Y  L+ LGE RK  LE++CK + L REAN+L +WI  +E     +E+G+DLEQVEV
Sbjct: 1146 VEELYANLLELGEKRKDMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEV 1205

Query: 3918 LQKKFDDFKGDLKANEVRLQEMNQIATALTSVG-QTETAVRIRQQIEDLNARWRALXXXX 3742
            LQKKFDDF+ DLKANE RL+++N++A  L S G   E    ++ Q+  +
Sbjct: 1206 LQKKFDDFQKDLKANESRLRDINKVAAELESEGLMAEETPMVQAQVPGVPP--------- 1256

Query: 3741 XXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDL 3562
                   G+    +R H+       ++Q++ + L             A   K E   +
Sbjct: 1257 -------GARLAFRRQHQPHPLFFLFLQQQQELLG------------AAPGKDEADSKTA 1297

Query: 3561 AALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQ 3382
            +   +   ++   AN             ++  +ELN +W  L   A +R   L  +
Sbjct: 1298 SPWKNVRLAVQTTAN-------------FNTIKELNNRWRSLQQLAEDRSHMLGSA---- 1340

Query: 3381 RFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFG 3202
                D  +  +WI   NQ +++    +D+   +AL  +H+ +  ++ +      +  +
Sbjct: 1341 --TRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETA 1398

Query: 3201 NQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMS 3022
             +L+ SH  A  DI+ +   +N A   L      R++ L    +LQ F  D     +W++
Sbjct: 1399 ERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWIN 1458

Query: 3021 AREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAV 2848
                 ++ E+ + D    E+L+++H++    I+ +    +  + F + L+   HY SP +
Sbjct: 1459 GIRGLVSSEELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLVRGHYASPEI 1518

Query: 2847 TRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDP 2668
             +K + +      L++A +Q+R  L +   LQ FSRD ++ ENWM  +      ++  D
Sbjct: 1519 QQKLEALEQERTHLEKAWVQRRMMLDQCLELQLFSRDCEQAENWMAAREAFLASDDKGDS 1578

Query: 2667 TN-IQQKHQKQQAFEAELHANSDRIAA-------IIQA---------------------- 2578
             + ++   +K + F+  ++   ++IAA       +I A
Sbjct: 1579 LDSVEALIKKHEDFDKAINVQEEKIAALQSFADQLIGADHYAKAEIHSRCREVLDRASIR 1638

Query: 2577 ---------------------GNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
                                 GN LI+   C G E AV  RL AL++QW  LV  + EKS
Sbjct: 1639 SIRRSRQSCTLTQTHPRGHRHGNALIQRGACAGSEDAVKTRLAALDEQWQFLVNKSAEKS 1698

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             +LKEANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH LLEADI AH+
Sbjct: 1699 QKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHE 1758

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
            DR+ ++N QADSL+ +D F   Q+ ++R  +  R+  +K MA  RR +L+++  +HQFFR
Sbjct: 1759 DRLKDLNSQADSLMASDAFDTSQVKDKRSGVNARFAKIKSMAATRRARLNESHRLHQFFR 1818

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ EL +HEP +  V   G++L
Sbjct: 1819 DLDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKL- 1877

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
              + +  +G+++I++R+      W +++DL+G R QRL+ES  +Q F+ +VEEEEAW+NE
Sbjct: 1878 --SDDNTIGQEEIQQRLAQFVDHWKELKDLSGARGQRLEESLEYQQFVANVEEEEAWINE 1935

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            K  ++ S+++G+ +A VQGLLKKH+ F+ D  +H+ RV D+ + G  LI   NHH  +I
Sbjct: 1936 KLNLVASEDYGDTLAAVQGLLKKHEAFETDFTVHRDRVGDVCSNGGELIKKNNHHVNNIS 1995

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
             +   L  ++ E++  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDL
Sbjct: 1996 AKMAALGEKVAELDRAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDL 2055

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
            SSVQ LLTKQE FDAGL AF+ EGI  I+ LK+QL++++H Q+ AI+ RH  +I+RW  L
Sbjct: 2056 SSVQTLLTKQETFDAGLQAFQQEGISNISALKEQLLAAQHVQAKAIQARHAALIKRWTQL 2115

Query: 1200 LAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRA 1021
            L++S AR+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEIRA
Sbjct: 2116 LSNSAARKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRA 2175

Query: 1020 LRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKE 841
            LR+AH  F+ SLSSA+ DF QL +LD++IKS+ V  NPYTWFTM+ALE+TWRNLQ+IIKE
Sbjct: 2176 LREAHEAFRSSLSSAQADFDQLAELDKQIKSYLVVSNPYTWFTMEALEETWRNLQKIIKE 2235

Query: 840  REQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQE--------------------- 724
            RE EL +E +RQEENDKLR+EFA+ ANAFH WL  TR
Sbjct: 2236 RELELQKEQRRQEENDKLRQEFAQHANAFHQWLQETRTYLLDGFLGLLGPGPGAVTHLSV 2295

Query: 723  ------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHST 562
                  M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHST
Sbjct: 2296 CVGRSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHST 2355

Query: 561  VGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQ 382
            VG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDKEK+GRL+HQ+
Sbjct: 2356 VGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKEKSGRLNHQE 2415

Query: 381  FKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRD 274
            FKSCLR+LGYDLPMV+EG+P+PEFQ ILD VDPNR+
Sbjct: 2416 FKSCLRSLGYDLPMVEEGEPDPEFQAILDTVDPNRE 2451



 Score =  419 bits (1078), Expect = e-115
 Identities = 422/1952 (21%), Positives = 800/1952 (40%), Gaps = 229/1952 (11%)
 Frame = -1

Query: 5970 SAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAET 5791
            + G K++E     + ++Q++ +++         L   RR   E     Q F RD E+ E
Sbjct: 3    TTGVKVLET----AEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEK 58

Query: 5790 WMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAA 5611
            W+ ++    ++ +  D   +++  ++KH+ FE  + A    I  LDE    +I   H+A+
Sbjct: 59   WIQEKLQIASDENYKDP-SNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFAS 117

Query: 5610 DDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY 5431
            + +                    +G  L ++ K   + R+C++ + WI++K + A  +
Sbjct: 118  ETIRSRLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEEL 177

Query: 5430 -LDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLW 5254
              D  ++    +K   F+ +L A+E R++++     ++I   H   + I  +  +VN  W
Sbjct: 178  GQDLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAW 237

Query: 5253 NELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKI 5074
              L     ++  +L  A   Q+FNR++++  +W+ E E  +AS+D+G+DL SVQ L +K
Sbjct: 238  QRLKGLAQQRQGRLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKH 297

Query: 5073 GLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKL 4894
              +E D  A  D+V+ +   A + QE    NA  I+ K++ L   +  +R    +R  +L
Sbjct: 298  EGLERDLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAAERHARL 357

Query: 4893 GESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQI 4714
             +S++  +   D  D  +W+ E + +  +     D+ G + L+ + Q    EI  H+
Sbjct: 358  DDSYRLQRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQEHKGEIDAHEDSF 417

Query: 4713 ESVSSAANDMIQQGHFLAPEIRDK----------------------------LAQLRDNW 4618
             S   A   ++  GH+ + E+++K                            L  L +
Sbjct: 418  RSTDEAGQALVNTGHYASEEVKEKVGLPPDCPQTAGVVFSCVSRVCVCVRVQLGILSEEK 477

Query: 4617 RILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKH 4438
              L +  E RR   +  +    +  D  + D WMS++E  + + D G   DS EALLKKH
Sbjct: 478  EALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKH 537

Query: 4437 RALLSDLEAFKGTIEDLRKQAS---QCKYQEQPMGQLGRDCVLALYD--YQEKSPREVSM 4273
                  L A +  I  L + A+   Q  +  +      RD +L+  +  ++    R  ++
Sbjct: 538  EDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAAL 597

Query: 4272 KKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE--PGTAQQH----AQQQVNS--I 4117
            +    L      + D  K  +N++         K      G  Q+H    A+   N   I
Sbjct: 598  EDSFHLQQF-FRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRI 656

Query: 4116 GGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIG-- 3943
               Q   +D  +R         R++EE    ++ L EA +L +  + + A A QQE G
Sbjct: 657  DALQKSGQDLLERKHYASSEVARRMEEVSSQWKKLLEATEL-KASRGQPAAAVQQERGGH 715

Query: 3942 ------------------------TDLEQVEVLQKKFDDFKGDLKANEV-----RLQEMN 3850
                                       E+      +     G L+ N +     R+  ++
Sbjct: 716  RAVAVRGGGPPGLRRLRQGPDQRPEPAEEARAAGGRRGCSPGLLRVNSLISSQDRIDGIS 775

Query: 3849 QIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETR 3670
              A      G  + A  IR++ E L  R+ AL         +L  +  +Q+  RDV++
Sbjct: 776  IQARQFQEAGHFD-ADNIRRKQEALALRYEALRQPMATRKQKLSDSLRLQQLFRDVEDEE 834

Query: 3669 DWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEA 3490
             WI+EK+    S + G+DL  VQ L +KH+ ++ ++     +IK++ +K   + +    A
Sbjct: 835  TWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFA 894

Query: 3489 AEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQE 3310
             E +     EL+ +W+ L  KA+ RK+ L DS   Q++ +D  +   W+     +V S +
Sbjct: 895  GEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTD 954

Query: 3309 LANDVTGAEALLERHQEYRTEIDSRAATFQAF---------------DQFGNQLLNSHH- 3178
               D   AEALL++H+   +++ +  ++ Q                 D+ G +L+ + +
Sbjct: 955  YGKDEDSAEALLKKHEALMSDLSAYGSSIQGLKEQAQSCRQQVAPTDDETGKELVLALYD 1014

Query: 3177 ----------YAAGDIENRLQGVNEARKGLEDAWVA-------RRNILDQCLELQLFYRD 3049
                         GDI   L   N+  + L  +  A       R  ++       L
Sbjct: 1015 YQEKSPREVTMKKGDILTLLNSTNKVERWLACSRAAGSAPPWWRLQVVGLAEPSSLHPMT 1074

Query: 3048 C--EQADTW---MSARE-----AFLAQEDPS-GDNVESLIKKHEDFDKAINTQEEKIKGL 2902
            C     D W   ++ R+     A++ + DP+   + E+L+++H     +I  ++++I+
Sbjct: 1075 CGLSWQDWWKVEVNDRQGFVPAAYVKKLDPNQSSSRENLLEEH----GSIALRQDQIENQ 1130

Query: 2901 KLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIE 2722
             +  E+          +V+ +  Q+ + +  L E   +++  L +S       R+A+E++
Sbjct: 1131 LVTKEAC---------SVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFREANELQ 1181

Query: 2721 NWMTEK-FQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCG 2545
             W+ EK   +  EE   D   ++   +K   F+ +L AN  R+  I +    L
Sbjct: 1182 QWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELESEGLMA 1241

Query: 2544 GGEAAVSARLKA----------------------LNDQWDL------------------- 2488
                 V A++                        L  Q +L
Sbjct: 1242 EETPMVQAQVPGVPPGARLAFRRQHQPHPLFFLFLQQQQELLGAAPGKDEADSKTASPWK 1301

Query: 2487 ---LVKTTTEKSYRLKEAN----------KQKSFM--AAVKDLE---FWLGEVEILLQSE 2362
               L   TT     +KE N          + +S M  +A +D +    W+ E    L ++
Sbjct: 1302 NVRLAVQTTANFNTIKELNNRWRSLQQLAEDRSHMLGSATRDADETKEWIEEKNQALNTD 1361

Query: 2361 DYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIAD 2182
            +YG DLASV+ L +KH   E D+ A  D+V  + E A+ L+++     + I E+   +
Sbjct: 1362 NYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNT 1421

Query: 2181 RYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRR 2002
             +  +   A  R+DKL+ + ++ +F  D  D  SWI   + LVSS++  +D+ G + L
Sbjct: 1422 AWSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLE 1481

Query: 2001 KHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGN 1822
            +H+   TE+ +        +  G++LL           +I++++E LEQ    +
Sbjct: 1482 RHQEHRTEIDARAGTFQAFEQFGQQLL---VRGHYASPEIQQKLEALEQERTHLEKAWVQ 1538

Query: 1821 RHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLEL 1642
            R   LD+    Q F  D E+ E WM  ++  L SD+ G+++  V+ L+KKH+ F   + +
Sbjct: 1539 RRMMLDQCLELQLFSRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAINV 1598

Query: 1641 HKQRVADLINKGDTLIHNGNHHAPHIKQRCDQL--RARLIEI------------------ 1522
             ++++A L +  D LI   ++    I  RC ++  RA +  I
Sbjct: 1599 QEEKIAALQSFADQLIGADHYAKAEIHSRCREVLDRASIRSIRRSRQSCTLTQTHPRGHR 1658

Query: 1521 --------------ESMAEGRLA------------------KLRDNSAYLQFMWKCDVVE 1438
                          E   + RLA                  KL++ +    F       +
Sbjct: 1659 HGNALIQRGACAGSEDAVKTRLAALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFD 1718

Query: 1437 SWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQ 1258
             W++E E  + SED+G+DL+SV  LL K +  +A ++A E + ++ +    D L++S+
Sbjct: 1719 FWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHE-DRLKDLNSQADSLMASDAF 1777

Query: 1257 QSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFEN 1078
             +  ++ + + V  R+  + + +  RR              +L            SW +
Sbjct: 1778 DTSQVKDKRSGVNARFAKIKSMAATRRARLNESHRLHQFFRDL--------DDEESWIKE 1829

Query: 1077 AEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTW 898
             +  ++       L  ++ LR  H   +  L + E   + + D  +++   N
Sbjct: 1830 KKLLVSSEDYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQ 1889

Query: 897  FTMDALEDTWRNLQRIIKEREQELAREHQRQE 802
              +    D W+ L+ +   R Q L    + Q+
Sbjct: 1890 QRLAQFVDHWKELKDLSGARGQRLEESLEYQQ 1921



 Score =  291 bits (746), Expect = 1e-76
 Identities = 230/1012 (22%), Positives = 435/1012 (42%), Gaps = 51/1012 (5%)
 Frame = -1

Query: 3831 TSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEK 3652
            T V   ETA  I+ + + +  R+R           +L  ++  Q F RD +E   WIQEK
Sbjct: 4    TGVKVLETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEK 63

Query: 3651 DDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYD 3472
                  E++ +D  ++Q   +KH+  E ++ A    I  LDE  N +      A+E I
Sbjct: 64   LQIASDENY-KDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRS 122

Query: 3471 LQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVT 3292
               EL+  W+ L  K   +  +LL +    ++L +  D + WI+    + +S+EL  D+
Sbjct: 123  RLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLE 182

Query: 3291 GAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLED 3112
              E L ++ +E++T++ +        +Q   +L+   H     I  +   VN A + L+
Sbjct: 183  HVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKG 242

Query: 3111 AWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDK 2938
                R+  L    E+Q F RD ++  +W+  +E  +A +D   D  +V++L++KHE  ++
Sbjct: 243  LAQQRQGRLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGLER 302

Query: 2937 AINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQT 2758
             +   E+K+  L   A  L + +  ++  +  K+D+++  W  ++    ++  +L +S
Sbjct: 303  DLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAAERHARLDDSYR 362

Query: 2757 LQQFSRDADEIENWMTE-KFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQ 2581
            LQ+F+ D  ++ +W+TE +  I  +E   D    +    + Q  + E+ A+ D   +  +
Sbjct: 363  LQRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSTDE 422

Query: 2580 AGNNLIENAKCGGGE--------------------------AAVSARLKALNDQWDLLVK 2479
            AG  L+        E                            V  +L  L+++ + L+
Sbjct: 423  AGQALVNTGHYASEEVKEKVGLPPDCPQTAGVVFSCVSRVCVCVRVQLGILSEEKEALLN 482

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
                +  + ++    + F    + ++ W+ + E  L +ED G  L SVE LLKKH   E
Sbjct: 483  LWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 542

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
             + A ++++  ++E A  L++N+ +  + +A RR  +  R + + + A  RR  L  + +
Sbjct: 543  SLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFH 602

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
            + QFFRD D+ +SWI E K+  ++D+  +D   +Q   +KH+  + EL++++ ++  ++
Sbjct: 603  LQQFFRDSDELKSWINE-KMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQK 661

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLG----- 1774
             G++LL     A     ++ +RME++   W ++ + T  +  R   + A Q   G
Sbjct: 662  SGQDLLERKHYA---SSEVARRMEEVSSQWKKLLEATELKASRGQPAAAVQQERGGHRAV 718

Query: 1773 -----------------DVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLE 1645
                             D   E A   E +   G       +  V  L+   D
Sbjct: 719  AVRGGGPPGLRRLRQGPDQRPEPA--EEARAAGGRRGCSPGLLRVNSLISSQD------- 769

Query: 1644 LHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQ 1465
                R+  +  +       G+  A +I+++ + L  R   +      R  KL D+    Q
Sbjct: 770  ----RIDGISIQARQFQEAGHFDADNIRRKQEALALRYEALRQPMATRKQKLSDSLRLQQ 825

Query: 1464 FMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELK 1285
                 +  E+WI EKE    S + G+DL  VQ LL K +A  A +   E   I+ +T+
Sbjct: 826  LFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEPR-IKAVTQKG 884

Query: 1284 DQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKA 1105
            + +V   H     ++ + T +  RW  L   +  R+              + Y A A +A
Sbjct: 885  ETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQA-----QQYFADANEA 939

Query: 1104 STFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQD 949
                SW    E  +         +   AL   H      LS+     + L++
Sbjct: 940  ---ESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQGLKE 988



 Score = 44.3 bits (103), Expect(2) = 0.0
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = -3

Query: 286  PEQRWLRNSARVHGVHDQQRNREHPVFGRNRDGIQSSFEGIPTICHGRGALREPDTGASR 107
            P +   R  A VHG+HDQ R+ E  V   +R+ +         +    GA+ EPD GA R
Sbjct: 2448 PNRERERVPAGVHGLHDQPRDGERQVQRGDRERLPGPERREQALRDQGGAVPEPDQGAGR 2507

Query: 106  ILHTKNEAIHGR 71
            +L   +EA+ GR
Sbjct: 2508 LLPVPHEALPGR 2519


>gi|1174412|sp|P02549|SPCA_HUMAN Spectrin alpha chain, erythrocyte
            (Erythroid alpha-spectrin)
          Length = 2418

 Score = 2004 bits (5192), Expect = 0.0
 Identities = 1046/2417 (43%), Positives = 1542/2417 (63%), Gaps = 15/2417 (0%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I +RRQEVL  Y  FK+    +  +LE++   Q FKRDAD+L  WI+EK+
Sbjct: 16   KVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNI 75

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
              ++++ DP+N+Q K QKH++ EAEVQ  ++ ++ L+KT        H A E  K  +EE
Sbjct: 76   LTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEE 135

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         KG +L +ALK   ++++C +IL WI +KE   T+ ++G D E  E+
Sbjct: 136  LRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEV 195

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF+DF  EL   + R+ E+NQ A++  EE H +   I  K+++VN AW RL  LA
Sbjct: 196  LHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQ 255

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R++ L  A  +QRF RD  E + WI EK+  L+S+DYG+DL   + L   H+G ER+LA
Sbjct: 256  RQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAV 315

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            +  K+ +L  +A KL  +HP  A  I +  +D  ++W  ++  A  R + L+ ++  HRF
Sbjct: 316  MSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRF 375

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
             +D+ +L  W+ +  A I ADEL  DVAG E LL+ HQ+HK EID+  D F      GQ
Sbjct: 376  SSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQD 435

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            LV      S EV+EK+E LD+  ++LL LW+ER   YEQC+D  LFYRD+EQ ++WM++Q
Sbjct: 436  LVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHLFYRDSEQVDSWMSRQ 495

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+SL S E L++KHEDFE++  AQEEKI  +D+ ATKLI   HY ++++
Sbjct: 496  EAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTATKLIGDDHYDSENIKA 555

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTN 5416
                              R   LKES   Q    D D++ +WI +K   A D+ Y D  N
Sbjct: 556  IRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINKKKKLADDEDYKDIQN 615

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
            ++ ++QK   FE+EL  N+ +L++I+ TG+++I+ GH+A+D++  RL +V +LW EL++A
Sbjct: 616  LKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRLSEVASLWEELLEA 675

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T +KG +L EA  + QF  N ED++ WL ++E QV SEDYGK L  VQN  +K GL+ES
Sbjct: 676  TKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESA 735

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
              A  D+VD +  LA  F+E  H ++  I  +QE+L  R+ AL++PL  RK+KL +
Sbjct: 736  VAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKEPLATRKKKLLDLLHL 795

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
              + RD EDE AWI+E E  A ST  G+DLI  + L+ + + ++  IA+H+ +I+ ++
Sbjct: 796  QLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEPRIQEITER 855

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
             N M+++GHF A ++  ++  L  N   L+++A +R+ DL+ ++Q  QYL+D +EA+ W+
Sbjct: 856  GNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWI 915

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQP--MG 4342
             EKEPIV +T+YG DE++A ALLKKH A L DL +F  +++ LR QA+ C+ Q+     G
Sbjct: 916  REKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEG 975

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRI- 4165
              G   V+ALYD+Q +SPREV+MKKGDVLTLL++ N+DWWKVE  D QG VPA YV+R+
Sbjct: 976  VAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLA 1035

Query: 4164 --EPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
              E     Q  +++  +I  +Q +IE++Y+ L+   E R+R+L +    + L  EA D+
Sbjct: 1036 HDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDML 1095

Query: 3990 EWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVG-QT 3814
            EWI+ ++A    +  G +L+ V  LQKKFD+F+ DL  NE RL+++N++A  L   G  T
Sbjct: 1096 EWIQEKKA----ENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLT 1151

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
                +IRQ   +LNARW +L          LGSAH V+ FHR+ D+T++ I++K  AL +
Sbjct: 1152 PEGAQIRQ---ELNARWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIEKKCQALSA 1208

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
             D G DL SVQALQR+HEG ERDL  LGDK+  L E A RL +SHP+A E +   + ELN
Sbjct: 1209 ADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDLQRQKMELN 1268

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W  L  +  +RKE L ++  +  FLS  RDL  WI+S+  +VSSQELA D+TG E LL
Sbjct: 1269 EAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILL 1328

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+R ++++ A TFQA + F  +L++S H+A+ +IE +LQ V   R  LE AW  R+
Sbjct: 1329 ERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDLEKAWEKRK 1388

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKHEDFDKAINTQEE 2917
             ILDQCLELQ+F  +C+Q ++ M ARE  L  +D S  D++E+L+KK +D DKAI  QE
Sbjct: 1389 KILDQCLELQMFQGNCDQVESRMVARENSLRSDDKSSLDSLEALMKKRDDLDKAITAQEG 1448

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            KI  L+ FAESLI + HY    +  +  ++LDRW  LK  LI +R KLG+   L+QF RD
Sbjct: 1449 KITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYANLKQFYRD 1508

Query: 2736 ADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIEN 2557
             +E+E W++E    A +E+Y+D TNIQ+K+ K Q F  E+   S+++  +I  GN+LIE
Sbjct: 1509 LEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIER 1568

Query: 2556 AKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEI 2377
            + C G E A+  +L+ L + WD L++ T +K  +L EA++Q+ F  +++D EFWL E E
Sbjct: 1569 S-CDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFEFWLSEAET 1627

Query: 2376 LLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            LL  +D  +DLAS  NLLKKH LLE +++A +D + ++N  A+ LL +  F   QI +++
Sbjct: 1628 LLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFNVDQIVKKK 1687

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
              +  R+  V+++A    +KL +A  + QFF+D+DDEESWI+EK + VSS DYGRDL GV
Sbjct: 1688 DNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGV 1747

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
            QNL +KH+R++ EL +HEP +  V    E+L   AA   VG+++I+ R+    + W +++
Sbjct: 1748 QNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAA---VGQEEIQLRLAQFVEHWEKLK 1804

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
            +L   R  +L+ES  +  F+ + EEEEAW+NEK  +    + G+ +A  Q LL KH+  +
Sbjct: 1805 ELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALE 1864

Query: 1656 VDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLA---KLR 1486
             D  +H+ RV ++  +G+ +++   H     K+   ++ A   +  S+A+   A   +L
Sbjct: 1865 NDFAVHETRVQNVCAQGEDILNKVLHEESQNKEISSKIEALNEKTPSLAKAIAAWKLQLE 1924

Query: 1485 DNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGI 1306
            D+ A+ +F WK DVVE+WIA+KE  +++   G DL     LL KQ+  DA L +F+ E +
Sbjct: 1925 DDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSFQQERL 1984

Query: 1305 QRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY 1126
              IT+LKD+L+S++H QS AIE+R+  +++RW+ LL  S   R           + E+L+
Sbjct: 1985 PEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQKAEDLF 2044

Query: 1125 LAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDL 946
            + FA KAS  N+W E  EE+L++PV C SL EIR L+  H +F  SL+ A+ DF+ L +L
Sbjct: 2045 VEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFKCLLEL 2104

Query: 945  DRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKL 766
            D++IK+  V  +PYTW T++ LE TW++L  II+EREQEL +E  RQ +N ++ +EF +
Sbjct: 2105 DQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQEFEQN 2164

Query: 765  ANAFHAWLTNTRQ-----EMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLER 601
            A+ F  W+  TR       +++  GTLE QL+A +RK KEI+A K QL +I + G  LE
Sbjct: 2165 ASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLGDNLED 2224

Query: 600  NLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKH 421
             LILD +Y   ST+G+AQ WDQL QL +RMQHNLEQQIQA++  GVSEE L+EFS ++KH
Sbjct: 2225 ALILDIKY---STIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIYKH 2281

Query: 420  FDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAF 241
            FD+  TGRL H++F+SCLR L Y LPMV+E + EP+F++ LD VDP R GYV+L++Y AF
Sbjct: 2282 FDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAF 2341

Query: 240  MISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISG 61
            +I KE+ENI+SS+EIE AF+AL+ E + Y+T E++   LTPEQ  FC   M+ YMD
Sbjct: 2342 LIDKESENIKSSDEIENAFQALA-EGKSYITKEDMKQALTPEQVSFCATHMQQYMDP-RV 2399

Query: 60   RSIQGGLDYEQFVHALF 10
             +I   +DY  F ++ F
Sbjct: 2400 EAISLAMDYVGFTNSYF 2416



 Score =  119 bits (298), Expect = 1e-24
 Identities = 104/499 (20%), Positives = 212/499 (41%), Gaps = 2/499 (0%)
 Frame = -1

Query: 2319 KHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRD 2140
            K +++E+      +   E+ E+   +L   Q   +++AER + + D Y
Sbjct: 6    KETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSY------------ 53

Query: 2139 KLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEP 1960
                  ++  F RD DD   WI EK  +++   Y  D   +Q   +KH+ ++ E+ +
Sbjct: 54   ------HLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQTKSR 106

Query: 1959 QVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAF 1780
             +S ++   EE       A    ++ K  +E+L   W  + +LT  +  +L  +  FQ +
Sbjct: 107  LMSELEKTREERFTMGHSA---HEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQY 163

Query: 1779 LGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDT 1600
            + +  +   W+ +K+ I  S   GE+    + L KK + FQV+L   + RV ++    +
Sbjct: 164  VQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANE 223

Query: 1599 LIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVES--WIA 1426
                 +   P I+ + +++ A    +  +A  R  K   N+A LQ  +K DV E+  WI
Sbjct: 224  CAEENHPDLPLIQSKQNEVNAAWERLRGLALQR-QKALSNAANLQ-RFKRDVTEAIQWIK 281

Query: 1425 EKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPA 1246
            EKE  + SED+G+DL + + L    +  +  L A   + ++ +    ++L  S    +P
Sbjct: 282  EKEPVLTSEDYGKDLVASEGLFHSHKGLERNL-AVMSDKVKELCAKAEKLTLSHPSDAPQ 340

Query: 1245 IEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEED 1066
            I++   +++  W+++ A + +R                 Y  F+      + W
Sbjct: 341  IQEMKEDLVSSWEHIRALATSRYEKLQATY--------WYHRFSSDFDELSGWMNEKTAA 392

Query: 1065 LTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMD 886
            +        +     L D H + +  + S ++ F+   +  + + + N   +      M+
Sbjct: 393  INADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKME 452

Query: 885  ALEDTWRNLQRIIKEREQE 829
             L++ W  L  +  ER ++
Sbjct: 453  ILDNNWTALLELWDERHRQ 471


>gi|4507189|ref|NP_003117.1| spectrin, alpha, erythrocytic 1
            (elliptocytosis 2); Spectrin, alpha, erythrocytic-1 [Homo
            sapiens]
 gi|71566|pir||SJHUA spectrin alpha chain - human
 gi|338438|gb|AAA60577.1| erythroid alpha spectrin
 gi|460309|gb|AAA60994.1| alpha-spectrin
          Length = 2429

 Score = 2001 bits (5184), Expect = 0.0
 Identities = 1041/2396 (43%), Positives = 1533/2396 (63%), Gaps = 15/2396 (0%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I +RRQEVL  Y  FK+    +  +LE++   Q FKRDAD+L  WI+EK+
Sbjct: 16   KVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNI 75

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
              ++++ DP+N+Q K QKH++ EAEVQ  ++ ++ L+KT        H A E  K  +EE
Sbjct: 76   LTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEE 135

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         KG +L +ALK   ++++C +IL WI +KE   T+ ++G D E  E+
Sbjct: 136  LRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEV 195

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF+DF  EL   + R+ E+NQ A++  EE H +   I  K+++VN AW RL  LA
Sbjct: 196  LHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQ 255

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R++ L  A  +QRF RD  E + WI EK+  L+S+DYG+DL   + L   H+G ER+LA
Sbjct: 256  RQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAV 315

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            +  K+ +L  +A KL  +HP  A  I +  +D  ++W  ++  A  R + L+ ++  HRF
Sbjct: 316  MSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRF 375

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
             +D+ +L  W+ +  A I ADEL  DVAG E LL+ HQ+HK EID+  D F      GQ
Sbjct: 376  SSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQD 435

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            LV      S EV+EK+E LD+  ++LL LW+ER   YEQC+D  LFYRD+EQ ++WM++Q
Sbjct: 436  LVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHLFYRDSEQVDSWMSRQ 495

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+SL S E L++KHEDFE++  AQEEKI  +D+ ATKLI   HY ++++
Sbjct: 496  EAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTATKLIGDDHYDSENIKA 555

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTN 5416
                              R   LKES   Q    D D++ +WI +K   A D+ Y D  N
Sbjct: 556  IRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINKKKKLADDEDYKDIQN 615

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
            ++ ++QK   FE+EL  N+ +L++I+ TG+++I+ GH+A+D++  RL +V +LW EL++A
Sbjct: 616  LKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRLSEVASLWEELLEA 675

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T +KG +L EA  + QF  N ED++ WL ++E QV SEDYGK L  VQN  +K GL+ES
Sbjct: 676  TKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESA 735

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
              A  D+VD +  LA  F+E  H ++  I  +QE+L  R+ AL++PL  RK+KL +
Sbjct: 736  VAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKEPLATRKKKLLDLLHL 795

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
              + RD EDE AWI+E E  A ST  G+DLI  + L+ + + ++  IA+H+ +I+ ++
Sbjct: 796  QLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEPRIQEITER 855

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
             N M+++GHF A ++  ++  L  N   L+++A +R+ DL+ ++Q  QYL+D +EA+ W+
Sbjct: 856  GNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWI 915

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQP--MG 4342
             EKEPIV +T+YG DE++A ALLKKH A L DL +F  +++ LR QA+ C+ Q+     G
Sbjct: 916  REKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEG 975

Query: 4341 QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRI- 4165
              G   V+ALYD+Q +SPREV+MKKGDVLTLL++ N+DWWKVE  D QG VPA YV+R+
Sbjct: 976  VAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLA 1035

Query: 4164 --EPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
              E     Q  +++  +I  +Q +IE++Y+ L+   E R+R+L +    + L  EA D+
Sbjct: 1036 HDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDML 1095

Query: 3990 EWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVG-QT 3814
            EWI+ ++A    +  G +L+ V  LQKKFD+F+ DL  NE RL+++N++A  L   G  T
Sbjct: 1096 EWIQEKKA----ENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLT 1151

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
                +IRQ   +LNARW +L          LGSAH V+ FHR+ D+T++ I++K  AL +
Sbjct: 1152 PEGAQIRQ---ELNARWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIEKKCQALSA 1208

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
             D G DL SVQALQR+HEG ERDL  LGDK+  L E A RL +SHP+A E +   + ELN
Sbjct: 1209 ADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDLQRQKMELN 1268

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W  L  +  +RKE L ++  +  FLS  RDL  WI+S+  +VSSQELA D+TG E LL
Sbjct: 1269 EAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILL 1328

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+R ++++ A TFQA + F  +L++S H+A+ +IE +LQ V   R  LE AW  R+
Sbjct: 1329 ERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDLEKAWEKRK 1388

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKHEDFDKAINTQEE 2917
             ILDQCLELQ+F  +C+Q ++ M ARE  L  +D S  D++E+L+KK +D DKAI  QE
Sbjct: 1389 KILDQCLELQMFQGNCDQVESRMVARENSLRSDDKSSLDSLEALMKKRDDLDKAITAQEG 1448

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            KI  L+ FAESLI + HY    +  +  ++LDRW  LK  LI +R KLG+   L+QF RD
Sbjct: 1449 KITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYANLKQFYRD 1508

Query: 2736 ADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIEN 2557
             +E+E W++E    A +E+Y+D TNIQ+K+ K Q F  E+   S+++  +I  GN+LIE
Sbjct: 1509 LEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIER 1568

Query: 2556 AKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEI 2377
            + C G E A+  +L+ L + WD L++ T +K  +L EA++Q+ F  +++D EFWL E E
Sbjct: 1569 S-CDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFEFWLSEAET 1627

Query: 2376 LLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            LL  +D  +DLAS  NLLKKH LLE +++A +D + ++N  A+ LL +  F   QI +++
Sbjct: 1628 LLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFNVDQIVKKK 1687

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
              +  R+  V+++A    +KL +A  + QFF+D+DDEESWI+EK + VSS DYGRDL GV
Sbjct: 1688 DNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGV 1747

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
            QNL +KH+R++ EL +HEP +  V    E+L   AA   VG+++I+ R+    + W +++
Sbjct: 1748 QNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAA---VGQEEIQLRLAQFVEHWEKLK 1804

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
            +L   R  +L+ES  +  F+ + EEEEAW+NEK  +    + G+ +A  Q LL KH+  +
Sbjct: 1805 ELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALE 1864

Query: 1656 VDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLA---KLR 1486
             D  +H+ RV ++  +G+ +++   H     K+   ++ A   +  S+A+   A   +L
Sbjct: 1865 NDFAVHETRVQNVCAQGEDILNKVLHEESQNKEISSKIEALNEKTPSLAKAIAAWKLQLE 1924

Query: 1485 DNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGI 1306
            D+ A+ +F WK DVVE+WIA+KE  +++   G DL     LL KQ+  DA L +F+ E +
Sbjct: 1925 DDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSFQQERL 1984

Query: 1305 QRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY 1126
              IT+LKD+L+S++H QS AIE+R+  +++RW+ LL  S   R           + E+L+
Sbjct: 1985 PEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQKAEDLF 2044

Query: 1125 LAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDL 946
            + FA KAS  N+W E  EE+L++PV C SL EIR L+  H +F  SL+ A+ DF+ L +L
Sbjct: 2045 VEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFKCLLEL 2104

Query: 945  DRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKL 766
            D++IK+  V  +PYTW T++ LE TW++L  II+EREQEL +E  RQ +N ++ +EF +
Sbjct: 2105 DQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQEFEQN 2164

Query: 765  ANAFHAWLTNTRQ-----EMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLER 601
            A+ F  W+  TR       +++  GTLE QL+A +RK KEI+A K QL +I + G  LE
Sbjct: 2165 ASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLGDNLED 2224

Query: 600  NLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKH 421
             LILD +Y   ST+G+AQ WDQL QL +RMQHNLEQQIQA++  GVSEE L+EFS ++KH
Sbjct: 2225 ALILDIKY---STIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIYKH 2281

Query: 420  FDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAF 241
            FD+  TGRL H++F+SCLR L Y LPMV+E + EP+F++ LD VDP R GYV+L++Y AF
Sbjct: 2282 FDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAF 2341

Query: 240  MISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMD 73
            +I KE+ENI+SS+EIE AF+AL+ E + Y+T E++   LTPEQ  FC   M+ YMD
Sbjct: 2342 LIDKESENIKSSDEIENAFQALA-EGKSYITKEDMKQALTPEQVSFCATHMQQYMD 2396



 Score =  119 bits (298), Expect = 1e-24
 Identities = 104/499 (20%), Positives = 212/499 (41%), Gaps = 2/499 (0%)
 Frame = -1

Query: 2319 KHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRD 2140
            K +++E+      +   E+ E+   +L   Q   +++AER + + D Y
Sbjct: 6    KETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSY------------ 53

Query: 2139 KLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEP 1960
                  ++  F RD DD   WI EK  +++   Y  D   +Q   +KH+ ++ E+ +
Sbjct: 54   ------HLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQTKSR 106

Query: 1959 QVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAF 1780
             +S ++   EE       A    ++ K  +E+L   W  + +LT  +  +L  +  FQ +
Sbjct: 107  LMSELEKTREERFTMGHSA---HEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQY 163

Query: 1779 LGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDT 1600
            + +  +   W+ +K+ I  S   GE+    + L KK + FQV+L   + RV ++    +
Sbjct: 164  VQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANE 223

Query: 1599 LIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVES--WIA 1426
                 +   P I+ + +++ A    +  +A  R  K   N+A LQ  +K DV E+  WI
Sbjct: 224  CAEENHPDLPLIQSKQNEVNAAWERLRGLALQR-QKALSNAANLQ-RFKRDVTEAIQWIK 281

Query: 1425 EKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPA 1246
            EKE  + SED+G+DL + + L    +  +  L A   + ++ +    ++L  S    +P
Sbjct: 282  EKEPVLTSEDYGKDLVASEGLFHSHKGLERNL-AVMSDKVKELCAKAEKLTLSHPSDAPQ 340

Query: 1245 IEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEED 1066
            I++   +++  W+++ A + +R                 Y  F+      + W
Sbjct: 341  IQEMKEDLVSSWEHIRALATSRYEKLQATY--------WYHRFSSDFDELSGWMNEKTAA 392

Query: 1065 LTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMD 886
            +        +     L D H + +  + S ++ F+   +  + + + N   +      M+
Sbjct: 393  INADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKME 452

Query: 885  ALEDTWRNLQRIIKEREQE 829
             L++ W  L  +  ER ++
Sbjct: 453  ILDNNWTALLELWDERHRQ 471


>gi|19526481|ref|NP_035595.2| spectrin alpha 1; alpha-spectrin 1,
            erythroid; spherocytosis; hemolytic anemia [Mus musculus]
 gi|3668418|gb|AAC61874.1| erythroid alpha-spectrin [Mus musculus]
          Length = 2415

 Score = 1996 bits (5171), Expect = 0.0
 Identities = 1040/2415 (43%), Positives = 1538/2415 (63%), Gaps = 13/2415 (0%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I  RR EVL  Y  FKD    +  +LEE+  +Q F+RDAD+L  WI+EKL+
Sbjct: 15   KVLETAEEIQHRRAEVLNQYQRFKDRVAERGQKLEESYHYQVFRRDADDLEKWIMEKLEI 74

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
            A+++ + +P+N+Q K QKHE+F +EVQA ++ +  L++   A    +HFA E  K  L++
Sbjct: 75   AKDKTY-EPTNIQGKYQKHESFVSEVQAKSRVLPELEEIREARFAEDHFAHEATKTHLKQ 133

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         K   L +ALK   + ++C++IL W++EKE  VT  ++G D E  E+
Sbjct: 134  LRLLWDLLLELTQEKSDVLLRALKFYQYSQECEDILEWVKEKEAIVTLVELGDDWERTEV 193

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF++F +EL   + +++ +NQ A++  +E H +  +I  K+D+VN AW RL +LA
Sbjct: 194  LHKKFEEFQEELTARKGKVDRVNQYANECAQEKHPKLPEIKAKQDEVNAAWDRLWSLALK 253

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R+E L  A  +QRF RD +E + W+ EK+  L+S+DYG+DL + +AL   H+  ER+LA
Sbjct: 254  RRESLSNAADLQRFKRDVNEAIQWMEEKEPQLTSEDYGKDLVSSEALFHNHKRLERNLAV 313

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            ++ K+ +L  +A KL  +H   A  I Q   D  + W  ++  A +R   L+ S+  HRF
Sbjct: 314  MDDKVKELCAKADKLMISHSADAPQIQQMKLDLVSNWERIRALATNRYAKLKASYGYHRF 373

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
            L+DY +L  W+ +  A+I ADEL  DVA  EALL  HQ+HK EID+  D F    + GQ+
Sbjct: 374  LSDYDELSGWMKEKTALINADELPTDVASGEALLARHQQHKHEIDSYDDRFQSADATGQE 433

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            L++     S E++EK+  L ++ ++LL LW++ +  Y QC+D  LFYRD+EQ ++WM++Q
Sbjct: 434  LLDGNHEASEEIREKMTILANDWAALLELWDKCQHQYRQCLDFHLFYRDSEQVDSWMSRQ 493

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+S+ SVE L++KH+DFE++  AQEEKI  LDE ATKLI   HY ++++A
Sbjct: 494  EAFLENEDLGNSVGSVEALLQKHDDFEEAFTAQEEKIITLDETATKLIDNDHYDSENIAA 553

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTN 5416
                              R   L +S   Q   +D D++ +WI +K   A DD Y D  N
Sbjct: 554  IRDGLLARRDALRERAATRRKLLVDSQLLQQLYQDSDDLKTWINKKKKLADDDDYKDVQN 613

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
            ++ ++QK  +FE+EL  NE  L+++  TG+++I+ GH+A++ +  RL +V NLW EL++A
Sbjct: 614  LKSRVQKQQDFEEELAVNEIMLNNLEKTGQEMIEDGHYASEAVAARLSEVANLWKELLEA 673

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T +KG +L EA    QF  N ED++ WL E+E QV SEDYGK L  VQNL +K GL+ESD
Sbjct: 674  TAQKGTQLYEANQLLQFENNAEDLKRWLEEVEWQVTSEDYGKGLADVQNLLRKHGLLESD 733

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
              A  ++VD +  +A  F+E  H ++  I  +QE+L  R+ AL++PL  RK+KL +  +
Sbjct: 734  VTARQNQVDTLTDMAAHFEEIGHPDSGDIRARQESLLSRFEALKEPLAIRKKKLIDLLKL 793

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q+ RD EDE AWI+E E  A ST+ G+DL+  +NL+ + + ++A+IA+H+ +I+ ++
Sbjct: 794  QQICRDSEDEEAWIQETEPSAASTHLGKDLVAAKNLLNRHEVILADIASHEPRIQVITER 853

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
             N M+++GHF A +I  ++  L  N   L ++A +R  DL  ++Q  QYL+D +EA+AW+
Sbjct: 854  GNKMVEEGHFAAEDIASRVESLNKNMESLHARAIRRENDLKANVQLQQYLADLHEAEAWI 913

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQE-QPMGQ 4339
             EKEPIV + +YG DE++A ALLKKH A L DL AF+ +I+ LR QA  C+ Q+  P+ +
Sbjct: 914  KEKEPIVDNKNYGADEEAAGALLKKHEAFLVDLNAFENSIKALRDQAEVCQQQQAAPVDE 973

Query: 4338 LGRDC-VLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
             GR+  V+ALYD++ +S REVSMKK DVLTLL++ N+DWWKVE +D QGFVPA YV+++
Sbjct: 974  AGREARVIALYDFEARSRREVSMKKNDVLTLLSSINKDWWKVEADDHQGFVPAVYVRKLA 1033

Query: 4161 PGTA---QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
            P       QH Q++  +I   Q ++E  Y  L+   E R+R+L +    + L  EA D+
Sbjct: 1034 PDELPGFPQHRQEEPVNIPQLQQQVETLYHSLLDRAEERRRRLLQRYNEFLLAYEAGDML 1093

Query: 3990 EWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALT-SVGQT 3814
            EWI+ ++     +  G +L+ V  LQKKFD+F+ DLK+NE RL+++N++A  L      T
Sbjct: 1094 EWIQEKKT----ENTGVELDDVWELQKKFDEFQRDLKSNEPRLKDINKVADELLFEELLT 1149

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
                 IRQ   +LN RW +L          L SAH V+ FHR+ D+ ++ I +K  AL++
Sbjct: 1150 PEGAHIRQ---ELNTRWNSLKRLADEQYQLLSSAHAVEMFHREADDVKEQIDKKCRALNA 1206

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
             D G DL SVQALQR+HE  ERD+  LG+K+ +L E A RL +SHP+A E +   + ELN
Sbjct: 1207 ADPGSDLLSVQALQRQHEVFERDIIPLGEKVTTLGETAERLCESHPDATEDLQKQRTELN 1266

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W+ L    ++RKE L +++ +  FLS   DL  WI ++  ++SS ELA D+TG E LL
Sbjct: 1267 EAWDTLQGLTSDRKESLNEAHKFFLFLSKASDLENWIKTIGGVISSPELAEDLTGTEILL 1326

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+  +I     TFQA + FG +L++S H    +I+N LQ +N  R  LE +W  R+
Sbjct: 1327 ERHQEHHDDIKREDPTFQALEDFGTELIDSGHRNRREIDNTLQNINSKRDNLEKSWENRK 1386

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKHEDFDKAINTQEE 2917
             +LDQCLELQLF   C+Q ++WM ARE  L  +D    +++++L+KK +D DKAI  QE
Sbjct: 1387 KMLDQCLELQLFRGKCDQVESWMVARENSLRSDDRDHLNSLQALMKKRDDLDKAITAQEG 1446

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            KI  L+  A  LI N+HY    +  +  ++LDRW  LKE L+ +  KLG+   L+QF RD
Sbjct: 1447 KISDLENVATRLIDNDHYAKEEIAARLQRVLDRWKALKEQLLTELGKLGDYADLKQFYRD 1506

Query: 2736 ADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIEN 2557
             +++E W+ E   IA +E+Y+DPTNIQ+K+ K QAFE E++  ++++  +I  GN+LIE
Sbjct: 1507 LEDLEEWINEMLPIACDESYKDPTNIQRKYLKHQAFENEVNGRAEQVDGVINLGNSLIER 1566

Query: 2556 AKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEI 2377
              C G E  +  +L  L + WD L++ TT+K  +L EA++Q+ F  +++D EFWL E E
Sbjct: 1567 RVCDGDEENMQEQLDKLKENWDYLLERTTDKGQKLNEASRQQRFNTSIRDFEFWLSEAEG 1626

Query: 2376 LLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            LL  +D  +DL S  NLLKKH LLEA+++A +D + ++N+ A  L+ +  F   QI E+
Sbjct: 1627 LLAMKDQARDLTSAGNLLKKHQLLEAEMLAREDPLKDLNDLAQELISSGTFNIDQIEEKM 1686

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
              + +R++ V+ +A    +KL +   + QFF+D+DDEE+WI+EK L VSS DYGRDL  V
Sbjct: 1687 NGVNERFENVQSLAAAHHEKLKETYALFQFFQDLDDEEAWIEEKLLRVSSQDYGRDLQSV 1746

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
            QNL +KH+R++ EL +HEP V  V L   E LR   +A VG+++I++R+    Q W +++
Sbjct: 1747 QNLLKKHKRLEGELVAHEPAVQNV-LDTAESLRD--KAAVGKEEIQERLAQFVQHWEKLK 1803

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
            +L   R   L+ES  +  F+ + EEEEAW+ EK  ++   + G+ +A  Q LLKKH+  +
Sbjct: 1804 ELAKTRGVNLEESLEYLQFMENAEEEEAWLGEKCALVSRGDSGDTLAATQSLLKKHEALE 1863

Query: 1656 VDLELHKQRVADLINKGDTLIH-NGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDN 1480
             D  +HK RV D+  +G+ +++     +   I  +   L  +   +        ++L D
Sbjct: 1864 NDFAVHKNRVQDVCAQGEDILNKEETQNKDKISTKIQVLNEKTASLAKALAAWKSQLDDV 1923

Query: 1479 SAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQR 1300
             A+ QF WK DVVESWI EKE  ++++  G DL++   LL K +  DA L +F+ E +
Sbjct: 1924 HAFQQFNWKADVVESWIGEKEASLKTKSNGADLTAFLTLLAKHDTLDASLQSFQQERLSE 1983

Query: 1299 ITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA 1120
            I ELKDQLV+ EH Q+ AIE++H  +++ W+ LL  S   R           + EEL++
Sbjct: 1984 IAELKDQLVAGEHSQAKAIEEQHAALLRHWEQLLEASRVHRQKLLEKQLPLQKAEELFME 2043

Query: 1119 FAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDR 940
            FA KAS FN+W ENAEEDL++PV C SL EIR L+  H  F  SL+ A+EDF  L +LD+
Sbjct: 2044 FAHKASAFNNWCENAEEDLSEPVHCVSLNEIRQLQKEHEAFLASLAGAQEDFNYLLELDK 2103

Query: 939  RIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +IK+ NV  +PYTW T+D L   W +L  IIKEREQEL +E  RQ +N ++ +EF + A+
Sbjct: 2104 QIKALNVPSSPYTWLTVDVLGRIWNHLPDIIKEREQELQKEEARQIKNFEMCQEFEQNAS 2163

Query: 759  AFHAWLTNTRQ-----EMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNL 595
            AF  W+  TR       +++  GTLE QL+A +RK KEI+A K  L +IE+ G  +E  L
Sbjct: 2164 AFLQWIQETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRHLTKIEDLGDSMEEAL 2223

Query: 594  ILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFD 415
            ILD +Y   ST+G+AQ WDQL QL MRMQHNLEQQIQA++  GVSEE L+EFS  +KHFD
Sbjct: 2224 ILDIKY---STIGLAQQWDQLHQLGMRMQHNLEQQIQAKDTIGVSEETLKEFSTTYKHFD 2280

Query: 414  KEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMI 235
            +  TGRL H++F+SCLR L Y LPMV+EG+PEP+F++ L+ VDP R GYV+L++Y +F+I
Sbjct: 2281 ENLTGRLTHKEFRSCLRGLNYYLPMVEEGEPEPKFEKFLNAVDPGRKGYVSLEDYTSFLI 2340

Query: 234  SKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRS 55
             KE+ENI++S++IE AF+AL+ E + Y+T E++   LTPEQ  FC   M+ YMD   GRS
Sbjct: 2341 DKESENIKTSDDIESAFQALA-EGKAYITKEDMKQALTPEQVSFCTIHMQQYMDP-RGRS 2398

Query: 54   IQGGLDYEQFVHALF 10
               G DY  F ++ F
Sbjct: 2399 QPAGYDYVGFTNSFF 2413


>gi|17380523|sp|P08032|SPCA_MOUSE Spectrin alpha chain, erythrocyte
            (Erythroid alpha-spectrin)
 gi|1841857|gb|AAB47540.1| erythroid alpha-spectrin [Mus musculus]
          Length = 2415

 Score = 1993 bits (5164), Expect = 0.0
 Identities = 1038/2415 (42%), Positives = 1538/2415 (62%), Gaps = 13/2415 (0%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I  RR EVL  Y  FKD    +  +LEE+  +Q F+RDAD+L  WI+EKL+
Sbjct: 15   KVLETAEEIQHRRAEVLNQYQRFKDRVAERGQKLEESYHYQVFRRDADDLEKWIMEKLEI 74

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
            A+++ + +P+N+Q K QKHE+F +EVQA ++ +  L++   A    +HFA E  K  L++
Sbjct: 75   AKDKTY-EPTNIQGKYQKHESFVSEVQAKSRVLPELEEIREARFAEDHFAHEATKTHLKQ 133

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         K   L +ALK   + ++C++IL W++EKE  VT  ++G D E  E+
Sbjct: 134  LRLLWDLLLELTQEKSDVLLRALKFYQYSQECEDILEWVKEKEAIVTLVELGDDWERTEV 193

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF++F +EL   + +++ +NQ A++  +E H +  +I  K+D+VN AW RL +LA
Sbjct: 194  LHKKFEEFQEELTARKGKVDRVNQYANECAQEKHPKLPEIKAKQDEVNAAWDRLWSLALK 253

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R+E L  A  +QRF RD +E + W+ EK+  L+S+DYG+DL + +AL   H+  ER+LA
Sbjct: 254  RRESLSNAADLQRFKRDVNEAIQWMEEKEPQLTSEDYGKDLVSSEALFHNHKRLERNLAV 313

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            ++ K+ +L  +A KL  +H   A  I Q   D  + W  ++  A +R   L+ S+  HRF
Sbjct: 314  MDDKVKELCAKADKLMISHSADALQIQQMKLDLVSNWERIRALATNRYAKLKASYGYHRF 373

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
            L+DY +L  W+ +  A+I ADEL  DVA  EALL  HQ+HK EID+  D F    + GQ+
Sbjct: 374  LSDYDELSGWMKEKTALINADELPTDVASGEALLARHQQHKHEIDSYDDRFQSADATGQE 433

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            L++     S E++EK+  L ++ ++LL LW++ +  Y QC+D  LFYRD+EQ ++WM++Q
Sbjct: 434  LLDGNHEASEEIREKMTILANDWAALLELWDKCQHQYRQCLDFHLFYRDSEQVDSWMSRQ 493

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+S+ SVE L++KH+DFE++  AQEEKI  LDE ATKLI   HY ++++A
Sbjct: 494  EAFLENEDLGNSVGSVEALLQKHDDFEEAFTAQEEKIITLDETATKLIDNDHYDSENIAA 553

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTN 5416
                              R   L +S   Q   +D D++ +WI +K   A DD Y D  N
Sbjct: 554  IRDGLLARRDALRERAATRRKLLVDSQLLQQLYQDSDDLKTWINKKKKLADDDDYKDVQN 613

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
            ++ ++QK  +FE+EL  NE  L+++  TG+++I+ GH+A++ +  RL +V NLW EL++A
Sbjct: 614  LKSRVQKQQDFEEELAVNEIMLNNLEKTGQEMIEDGHYASEAVAARLSEVANLWKELLEA 673

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T +KG +L EA    QF  N ED++ WL E+E QV SEDYGK L  VQNL +K GL+ESD
Sbjct: 674  TAQKGTQLYEANQLLQFENNAEDLKRWLEEVEWQVTSEDYGKVLADVQNLLRKHGLLESD 733

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
              A  +++D +  +A  F+E  H ++  I  +QE+L  R+ AL++PL  RK+KL +  +
Sbjct: 734  VTARQNQMDTLTDMAAHFEEIGHPDSGDIRARQESLLSRFEALKEPLAIRKKKLIDLLKL 793

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q+ RD EDE AWI+E E  A ST+ G+DL+  +NL+ + + ++A+IA+H+ +I+ ++
Sbjct: 794  QQICRDSEDEEAWIQETEPSAASTHLGKDLVAAKNLLNRHEVILADIASHEPRIQVITER 853

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
             N M+++GHF A +I  ++  L  N   L ++A +R  DL  ++Q  QYL+D +EA+AW+
Sbjct: 854  GNKMVEEGHFAAEDIASRVESLNKNMESLHARAIRRENDLKANVQLQQYLADLHEAEAWI 913

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQE-QPMGQ 4339
             EKEPIV + +YG DE++A ALLKKH A L DL AF+ +I+ LR QA  C+ Q+  P+ +
Sbjct: 914  KEKEPIVDNKNYGADEEAAGALLKKHEAFLVDLNAFENSIKALRDQAEVCQQQQAAPVDE 973

Query: 4338 LGRDC-VLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
             GR+  V+ALYD++ +S REVSMKK DVLTLL++ N+DWWKVE +D QGFVPA YV+++
Sbjct: 974  AGREARVIALYDFEARSRREVSMKKNDVLTLLSSINKDWWKVEADDHQGFVPAVYVRKLA 1033

Query: 4161 PGTA---QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLA 3991
            P       QH +++  +I   Q ++E  Y  L+   E R+R+L +    + L  EA D+
Sbjct: 1034 PDELPGFPQHQREEPVNIPQLQQQVETLYHSLLDRAEERRRRLLQRYNEFLLAYEAGDML 1093

Query: 3990 EWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALT-SVGQT 3814
            EWI+ ++     +  G +L+ V  LQKKFD+F+ DLK+NE RL+++N++A  L      T
Sbjct: 1094 EWIQEKKT----ENTGVELDDVWELQKKFDEFQRDLKSNEPRLKDINKVADELLFEELLT 1149

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
                 IRQ   +LN RW +L          L SAH V+ FHR+ D+ ++ I +K  AL++
Sbjct: 1150 PEGAHIRQ---ELNTRWNSLKRLADEQYQLLSSAHAVEMFHREADDVKEQIDKKCRALNA 1206

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
             D G DL SVQALQR+HE  ERD+  LG+K+ +L E A RL +SHP+A E +   + ELN
Sbjct: 1207 ADPGSDLLSVQALQRQHECFERDIIPLGEKVNTLGETAERLCESHPDATEDLQKQRTELN 1266

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            E W+ L    ++RKE L +++ +  FLS   DL  WI ++  ++SS ELA D+TG E LL
Sbjct: 1267 EAWDTLQGLTSDRKESLNEAHKFFLFLSKASDLENWIKTIGGVISSPELAEDLTGTEILL 1326

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ERHQE+  +I     TFQA + FG +L++S H    +I+N LQ +N  R  LE +W  R+
Sbjct: 1327 ERHQEHHDDIKREDPTFQALEDFGTELIDSGHRNRREIDNTLQNINSKRDNLEKSWENRK 1386

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKHEDFDKAINTQEE 2917
             +LDQCLELQLF   C+Q ++WM ARE  L  +D    D++++L+KK +D DKAI  QE
Sbjct: 1387 KMLDQCLELQLFRGKCDQVESWMVARENSLRSDDRDHLDSLQALMKKRDDLDKAITAQEG 1446

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            KI  L+  A  LI N+HY    +  +  ++LDRW  LKE L+ +  KLG+   L+QF RD
Sbjct: 1447 KISDLENVATRLIDNDHYAKEEIAARLQRVLDRWKALKEQLLTELGKLGDYADLKQFYRD 1506

Query: 2736 ADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIEN 2557
             +++E W+ E   IA +E+Y+DPTNIQ+K+ K QAFE E++  ++++  +I  GN+LIE
Sbjct: 1507 LEDLEEWINEMLPIACDESYKDPTNIQRKYLKHQAFENEVNGRAEQVDGVINLGNSLIER 1566

Query: 2556 AKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEI 2377
              C G E  +  +L  L + WD L++ TT+K  +L EA++Q+ F  +++D EFWL E E
Sbjct: 1567 RVCDGDEENMQEQLDMLKENWDYLLERTTDKGQKLNEASRQQRFNTSIRDFEFWLSEAEG 1626

Query: 2376 LLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            LL  +D  +DL S  NLLKKH LLEA+++A +D + ++N+ A  L+ +  F   QI E+
Sbjct: 1627 LLAMKDQARDLTSAGNLLKKHQLLEAEMLAREDPLKDLNDLAQELISSGTFNIDQIEEKM 1686

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
              + +R++ V+ +A    +KL +   + QFF+D+DDEE+WI+EK L VSS DYGRDL  V
Sbjct: 1687 NGVNERFENVQSLAAAHHEKLKETYALFQFFQDLDDEEAWIEEKLLRVSSQDYGRDLQSV 1746

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
            QNL +KH+R++ EL +HEP V  V L   E LR   +A VG+++I++R+    Q W +++
Sbjct: 1747 QNLLKKHKRLEGELVAHEPAVQNV-LDTAESLRD--KAAVGKEEIQERLAQFVQHWEKLK 1803

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
            +L   R   L+ES  +  F+ + EEEEAW+ EK  ++   + G+ +A  Q LLKKH+  +
Sbjct: 1804 ELAKTRGVNLEESLEYLQFMENAEEEEAWLGEKCALVSRGDSGDTLAATQSLLKKHEALE 1863

Query: 1656 VDLELHKQRVADLINKGDTLIH-NGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDN 1480
             D  +HK RV D+  +G+ +++     +   I  +   L  +   +        ++L D
Sbjct: 1864 NDFAVHKNRVQDVCAQGEDILNKEETQNKDKISTKIQVLNEKTASLAKALAAWKSQLDDV 1923

Query: 1479 SAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQR 1300
             A+ QF WK DVVESWI EKE  ++++  G DL++   LL K +  DA L +F+ E +
Sbjct: 1924 HAFQQFNWKADVVESWIGEKEASLKTKSNGADLTAFLTLLAKHDTLDASLQSFQQERLSE 1983

Query: 1299 ITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA 1120
            I ELKDQLV+ EH Q+ AIE++H  +++ W+ LL  S   R           + EEL++
Sbjct: 1984 IAELKDQLVAGEHSQAKAIEEQHAALLRHWEQLLEASRVHRQKLLEKQLPLQKAEELFME 2043

Query: 1119 FAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDR 940
            FA KAS FN+W ENAEED+++PV C SL EIR L+  H  F  SL+ A+EDF  L +LD+
Sbjct: 2044 FAHKASAFNNWCENAEEDMSEPVHCVSLNEIRQLQKEHEAFLASLAGAQEDFNYLLELDK 2103

Query: 939  RIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +IK+ NV  +PYTW T+D L   W +L  IIKEREQEL +E  RQ +N ++ +EF + A+
Sbjct: 2104 QIKALNVPSSPYTWLTVDVLGRIWNHLPDIIKEREQELQKEEARQIKNFEMCQEFEQNAS 2163

Query: 759  AFHAWLTNTRQ-----EMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNL 595
            AF  W+  TR       +++  GTLE QL+A +RK KEI+A K  L +IE+ G  +E  L
Sbjct: 2164 AFLQWIQETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRHLTKIEDLGDSMEEAL 2223

Query: 594  ILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFD 415
            ILD +Y   ST+G+AQ WDQL QL MRMQHNLEQQIQA++  GVSEE L+EFS  +KHFD
Sbjct: 2224 ILDIKY---STIGLAQQWDQLHQLGMRMQHNLEQQIQAKDTIGVSEETLKEFSTTYKHFD 2280

Query: 414  KEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMI 235
            +  TGRL H++F+SCLR L Y LPMV+EG+PEP+F++ L+ VDP R GYV+L++Y +F+I
Sbjct: 2281 ENLTGRLTHKEFRSCLRGLNYYLPMVEEGEPEPKFEKFLNAVDPGRKGYVSLEDYTSFLI 2340

Query: 234  SKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRS 55
             KE+ENI++S++IE AF+AL+ E + Y+T E++   LTPEQ  FC   M+ YMD   GRS
Sbjct: 2341 DKESENIKTSDDIESAFQALA-EGKAYITKEDMKQALTPEQVSFCTIHMQQYMDP-RGRS 2398

Query: 54   IQGGLDYEQFVHALF 10
               G DY  F ++ F
Sbjct: 2399 QPAGYDYVGFTNSFF 2413


>gi|33303718|gb|AAQ02378.1| erythroid spectrin alpha [Rattus
            norvegicus]
          Length = 2385

 Score = 1919 bits (4972), Expect = 0.0
 Identities = 1018/2412 (42%), Positives = 1503/2412 (62%), Gaps = 10/2412 (0%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I  RRQEVL  Y  FK+    +  +LEE+  +Q F+RDAD+L  WI+EKL+
Sbjct: 15   KVLETAEEIQHRRQEVLDQYQRFKERVAERGQKLEESYHYQVFRRDADDLEKWIMEKLEI 74

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
             +++ + +P+N+Q K QKHE+F +EVQA ++ +  L++   A    +HFA E  K  L+E
Sbjct: 75   TKDKTY-EPTNIQGKYQKHESFVSEVQAKSRVLPELEEIREARFAEDHFAHEATKTHLKE 133

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         K   L +ALK   + ++C++IL W++EKE  VT  ++G D E  E+
Sbjct: 134  LRHLWDLLLELTQEKSDILLRALKFYQYCQECEDILEWVKEKEAIVTLVELGDDWERTEV 193

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF++F +EL   + +++ +NQ A++  +E H +  +I  K+D+VN AW RL +LA
Sbjct: 194  LHKKFEEFQEELTARKGKVDRVNQYANECAQEQHPKLPEIKAKQDEVNAAWDRLWSLALK 253

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R+E L  A  +QRF RD +E + W+ EK+  L+S+DYG+DL + +AL   H+  ER+LA
Sbjct: 254  RRESLSNAADLQRFKRDVNEAIQWMEEKEPLLTSEDYGKDLVSSEALFHSHKRLERNLAV 313

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            ++ K+ +L  +A KL  +H   A  I Q   D  + W  ++  A +R   L+ S+  HRF
Sbjct: 314  MDDKVKELCAKADKLMVSHSADAPQIQQMKMDLVSNWELIRALATNRYAKLKASYGYHRF 373

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
            L+DY +L  W+ +  A+I ADEL  DVA  EALL  HQ+HK EID+  D F    + GQ
Sbjct: 374  LSDYDELTGWMEEKTALINADELPTDVASGEALLARHQQHKHEIDSYDDRFQTAEATGQD 433

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            L++     S E++EK+  L H+ ++L  LW + +  Y Q +D  LFYRD+EQ ++WM++Q
Sbjct: 434  LLDGNHEASDEIREKMTILAHDWAALRELWNKCQHQYRQSLDFHLFYRDSEQVDSWMSRQ 493

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+S+ SVE L++KH+DFE++  AQEEKI  LDE ATKLI   HY ++++A
Sbjct: 494  EAFLENEDLGNSVGSVEALLQKHDDFEEAFTAQEEKIITLDETATKLIDNDHYDSENIAA 553

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTN 5416
                              R   L +S   Q   +D D++ +WI +K   A D+ Y D  N
Sbjct: 554  IRDGLLARRDALRERAATRRKLLVDSQLLQQLYQDSDDLKTWINKKKKLADDEDYKDVQN 613

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
            ++ ++QK  +FE+EL ANE  L+++  TG+ +I++ H+A+D +  R+ +V NLW EL++A
Sbjct: 614  LKSRVQKQQDFEEELAANEIMLNNLERTGQDMIENDHYASDAVAARMSEVANLWKELLEA 673

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T +KG +L EA    QF  N ED++ WL E+E QVASEDYGK L  VQNL +K GL+ES
Sbjct: 674  TAQKGTQLYEANQLLQFENNAEDLKRWLEEVERQVASEDYGKGLADVQNLLRKHGLLESA 733

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
              A  D+VD +  +A  F+E  H ++  I  +QE+L  R+ AL++PL  RK+KL +  +
Sbjct: 734  VLARQDQVDTLTDMAAHFEEIGHPDSENICARQESLLSRFEALKEPLATRKKKLIDLLKL 793

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q+ RD EDE AWI+E E  A ST+ G+DL+  +NL+ + + ++A+IA+H+ +I++++
Sbjct: 794  QQICRDSEDEEAWIQETEPSAASTHLGKDLVAAKNLLNRHEVILADIASHEPRIQTITER 853

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
             N M+++GHF + +I  ++  L  N   L+++A +R  DL  ++Q  QYL+D +EA+AW+
Sbjct: 854  GNKMVEEGHFASEDIASRVESLNKNMESLRARAIRRENDLKANVQLQQYLADLHEAEAWI 913

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQE-QPMGQ 4339
             EKEPIV + +YG DE++A ALLKKH A L DL AF  +I+ L  QA  C+ Q+  P+ +
Sbjct: 914  KEKEPIVDNKNYGADEEAAGALLKKHEAFLVDLNAFGNSIKALGDQAEACQQQQAAPVDE 973

Query: 4338 LGRDC-VLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE 4162
             GR+  V+ALYD++ +S REVSMKK DVLTLL++ N+DWWKVE +D QGFVPA YV+++
Sbjct: 974  AGREARVIALYDFEARSRREVSMKKNDVLTLLSSINKDWWKVEADDHQGFVPAVYVRKLA 1033

Query: 4161 ----PGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDL 3994
                PG  QQ  ++ VN I   Q +IE  Y  L+   E R+R+L +    + L  EA D+
Sbjct: 1034 HDELPGFPQQRREEPVN-IPQLQEQIETLYHSLLDRAEERRRRLLQRYNEFLLAYEAGDM 1092

Query: 3993 AEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVG-Q 3817
             EWI+ ++     +  G +L+ V  LQKKFD+F+ DLK+NE RL+++N++A  L
Sbjct: 1093 LEWIQEKKT----ENTGVELDDVWELQKKFDEFQRDLKSNEPRLKDINKVADELLFEDLL 1148

Query: 3816 TETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALD 3637
            T     IRQ   +LN RW +L          L SAH V+ F R+ D+ ++ I +K  AL+
Sbjct: 1149 TPEGSHIRQ---ELNTRWSSLKRLADEQYQLLSSAHAVEMFLREADDVKEQIDKKCQALN 1205

Query: 3636 SEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQREL 3457
            + D G DL SVQALQR+HE  ERD+  LG+K+ +L E A RL +SHP+A E +   + EL
Sbjct: 1206 AADPGSDLLSVQALQRQHEVFERDIIPLGEKVTTLGETAERLCESHPDATEDLQKQRTEL 1265

Query: 3456 NEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEAL 3277
            NE W+ L    ++RKE L +++ +  FLS   DL  WI ++  ++SS ELA D+TG E L
Sbjct: 1266 NEAWDTLQGLTSDRKESLNEAHKFFLFLSKASDLENWIKAIGGVISSPELAEDLTGTEIL 1325

Query: 3276 LERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVAR 3097
            LERHQE+  +I     TFQA + FG +L++  H  + +IE  LQ +   R  LE  W  R
Sbjct: 1326 LERHQEHYDDIKREDPTFQALEDFGRELIDRGHRNSHEIETTLQDIKLKRDDLEKNWENR 1385

Query: 3096 RNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKHEDFDKAINTQE 2920
            + +LDQCLELQLF   CEQ ++WM ARE  L  +D    +++++L+KK +D DKAI  QE
Sbjct: 1386 KKMLDQCLELQLFRGKCEQVESWMVARENSLRSDDRDHLNSLQALMKKRDDLDKAIAAQE 1445

Query: 2919 EKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSR 2740
             KI  L+  A  L+ N+HY    +  +  ++LDRW  LK  L+ +  KLG+   L+QF R
Sbjct: 1446 GKIADLENHATRLMDNDHYAKEEIAARLQRVLDRWKDLKTQLLAELGKLGDYADLKQFYR 1505

Query: 2739 DADEIENWMTEKFQIAQEENYRDPTNIQQ-KHQKQQAFEAELHANSDRIAAIIQAGNNLI 2563
            D +++E W++E   +A +E+Y+DPTNIQQ K+ K QAFE E++  ++++  +I  G +LI
Sbjct: 1506 DLEDLEEWISEMLPVACDESYKDPTNIQQRKYLKHQAFENEVNGRAEQVEGVINLGKSLI 1565

Query: 2562 ENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEV 2383
            E   C G E  +  +L  L + WD L++ TT+K  +L EA++Q+ F  +++D EFWL E
Sbjct: 1566 ERRVCDGDEENMQEQLDKLKENWDYLLERTTDKGQKLNEASRQQRFNTSIRDFEFWLSEA 1625

Query: 2382 EILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAE 2203
            E LL  +D  +DL S  NLLKKH LLEA+++A +D + ++N  A  L+ +  F  +QI E
Sbjct: 1626 EGLLAMKDQARDLTSAGNLLKKHQLLEAEMLAREDPLKDLNGLAKELISSGTFNIEQIEE 1685

Query: 2202 RRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLP 2023
            +   + +R+  V+ +A    +KL +   + QFF+D+DDEE+WI+EK L VSS D GRDL
Sbjct: 1686 KMNGVNERFKNVQSLAAAHHEKLKETYALFQFFQDLDDEEAWIEEKLLRVSSQDCGRDLQ 1745

Query: 2022 GVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQ 1843
             VQNL +KHRR++ EL +HEP V  V    E L   AA   VG+++I++R+    Q W +
Sbjct: 1746 SVQNLLKKHRRLEGELVAHEPAVQNVLDTAESLKDKAA---VGKEEIQERLAQFVQHWEK 1802

Query: 1842 IRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDT 1663
            +++L   R   L+ES  +  F+ + EEEEAW+ EK  ++   + G+ +A  Q LLKKH+
Sbjct: 1803 LKELAKTRGVNLEESLQYLQFMENAEEEEAWLGEKDALVSRGDSGDTLAATQSLLKKHEA 1862

Query: 1662 FQVDLELHKQRVADLINKG-DTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLR 1486
             + D  +HK RV D+  +G D L      +   I  + + L  +   +        ++L
Sbjct: 1863 LENDFAVHKNRVQDVCAQGEDILSKEETQNKDKISTKIEVLNEKTASLTKALAAWKSQLD 1922

Query: 1485 DNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGI 1306
            +  A+ QF WK DVVESWI EKE  ++++  G DL++   LL KQ+  DA L +F+ E +
Sbjct: 1923 EVHAFQQFNWKADVVESWIGEKEASLKTKSNGADLTAFLTLLAKQDTLDASLQSFQQERL 1982

Query: 1305 QRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY 1126
              IT+LKD+L+++EH QS AIE+RH  +++RW+ LL      R           + EEL+
Sbjct: 1983 SEITDLKDELLAAEHSQSKAIEERHAALLRRWEQLLEACRVHRQKLLEKQLPLQKAEELF 2042

Query: 1125 LAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDL 946
            + FA KAS FN+W ENAEEDL++PV C SL EIR L+  H  F  S+  A+EDF  L  L
Sbjct: 2043 MEFAHKASAFNNWCENAEEDLSEPVHCVSLNEIRQLQKEHEAFLASMVGAQEDFNYLLAL 2102

Query: 945  DRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKL 766
            D++IK+ NV  +PYTW T+D L   W++L  IIKEREQEL +E  RQ +N ++ +EF +
Sbjct: 2103 DQQIKALNVSSSPYTWLTVDVLGRIWKHLPEIIKEREQELQKEEARQIKNFEMCQEFEQN 2162

Query: 765  ANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILD 586
            A+AF  W+  TR   ++             RK KEI+A K  L +IE+ G  +E  LILD
Sbjct: 2163 ASAFLQWIQETRAYFLDG--------SVFSRKQKEIQAMKRHLTKIEDLGDSMEEALILD 2214

Query: 585  NRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEK 406
             +Y   ST+G+AQ WDQL QL MRMQHNLEQQIQA                  KHFD+
Sbjct: 2215 IKY---STIGLAQQWDQLHQLGMRMQHNLEQQIQA------------------KHFDENL 2253

Query: 405  TGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKE 226
            TGRL H++F+SCLR L Y LPMV+EG+PEP+F++ L+ VDP R GYV+L++Y +F+I KE
Sbjct: 2254 TGRLTHKEFRSCLRGLNYYLPMVEEGEPEPKFEKFLNAVDPGRKGYVSLEDYTSFLIDKE 2313

Query: 225  TENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQG 46
            +ENI++S++IE  F+AL+ E + Y+T E++   LTPEQ  FC   M+ YMD   GRS
Sbjct: 2314 SENIKTSDDIESGFQALA-EGKAYITKEDMKQALTPEQVSFCTIHMQQYMDP-RGRSQPA 2371

Query: 45   GLDYEQFVHALF 10
            G DY  F ++ F
Sbjct: 2372 GYDYVGFTNSFF 2383


>gi|34880958|ref|XP_222913.2| similar to erythroid alpha-spectrin
            [Rattus norvegicus]
          Length = 2417

 Score = 1893 bits (4903), Expect = 0.0
 Identities = 1017/2454 (41%), Positives = 1505/2454 (60%), Gaps = 52/2454 (2%)
 Frame = -1

Query: 7215 RILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT 7036
            ++LETA++I  RRQEVL  Y  FK+    +  +LEE+  +Q F+RDAD+L  WI+EKL+
Sbjct: 12   KVLETAEEIQHRRQEVLDQYQRFKERVAERGQKLEESYHYQVFRRDADDLEKWIMEKLEI 71

Query: 7035 AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
             +++ + +P+N+Q K QKHE+F +EVQA ++ +  L++   A    +HFA E  K  L+E
Sbjct: 72   TKDKTY-EPTNIQGKYQKHESFVSEVQAKSRVLPELEEIREARFAEDHFAHEATKTHLKE 130

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L  LW         K   L +ALK   + ++C++IL W++EKE  VT  ++G D E  E+
Sbjct: 131  LRHLWDLLLELTQEKSDILLRALKFYQYCQECEDILEWVKEKEAIVTLVELGDDWERTEV 190

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L +KF++F +EL   + +++ +NQ A++  +E H +  +I  K+D+VN AW RL +LA
Sbjct: 191  LHKKFEEFQEELTARKGKVDRVNQYANECAQEQHPKLPEIKAKQDEVNAAWDRLWSLALK 250

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
            R+E L  A  +QRF RD +E + W+ EK+  L+S+DYG+DL + +AL   H+  ER+LA
Sbjct: 251  RRESLSNAADLQRFKRDVNEAIQWMEEKEPLLTSEDYGKDLVSSEALFHSHKRLERNLAV 310

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            ++ K+ +L  +A KL  +H   A  I Q   D  + W  ++  A +R   L+ S+  HRF
Sbjct: 311  MDDKVKELCAKADKLMVSHSADAPQIQQMKMDLVSNWELIRALATNRYAKLKASYGYHRF 370

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
            L+DY +L  W+ +  A+I ADEL  DVA  EALL  HQ+HK EID+  D F    + GQ
Sbjct: 371  LSDYDELTGWMEEKTALINADELPTDVASGEALLARHQQHKHEIDSYDDRFQTAEATGQD 430

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            L++     S E++EK+  L H+ ++L  LW + +  Y Q +D  LFYRD+EQ ++WM++Q
Sbjct: 431  LLDGNHEASDEIREKMTILAHDWAALRELWNKCQHQYRQSLDFHLFYRDSEQVDSWMSRQ 490

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            EAFL N DLG+S+ SVE L++KH+DFE++  AQEEKI  LDE ATKLI   HY ++++A
Sbjct: 491  EAFLENEDLGNSVGSVEALLQKHDDFEEAFTAQEEKIITLDETATKLIDNDHYDSENIAA 550

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY----- 5431
                              R   L +S   Q   +D D++ +WI +K   A D+ Y
Sbjct: 551  IRDGLLARRDALRERAATRRKLLVDSQLLQQLYQDSDDLKTWINKKKKLADDEDYKNDFP 610

Query: 5430 ------LDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQ 5269
                   D  N++ ++QK  +FE+EL ANE  L+++  TG+ +I++ H+A+D +  R+ +
Sbjct: 611  DFPILSQDVQNLKSRVQKQQDFEEELAANEIMLNNLERTGQDMIENDHYASDAVAARMSE 670

Query: 5268 VNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQN 5089
            V NLW EL++AT +KG +L EA    QF  N ED++ WL E+E QVASEDYGK L  VQN
Sbjct: 671  VANLWKELLEATAQKGTQLYEANQLLQFENNAEDLKRWLEEVERQVASEDYGKGLADVQN 730

Query: 5088 LQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEK 4909
            L +K GL+ES   A  D+VD +  +A  F+E  H ++  I  +QE+L  R+ AL++PL
Sbjct: 731  LLRKHGLLESAVLARQDQVDTLTDMAAHFEEIGHPDSENICARQESLLSRFEALKEPLAT 790

Query: 4908 RKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIAN 4729
            RK+KL +  +  Q+ RD EDE AWI+E E  A ST+ G+DL+  +NL+ + + ++A+IA+
Sbjct: 791  RKKKLIDLLKLQQICRDSEDEEAWIQETEPSAASTHLGKDLVAAKNLLNRHEVILADIAS 850

Query: 4728 HDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQY 4549
            H+ +I++++   N M+++GHF + +I  ++  L  N   L+++A +R  DL  ++Q  QY
Sbjct: 851  HEPRIQTITERGNKMVEEGHFASEDIASRVESLNKNMESLRARAIRRENDLKANVQLQQY 910

Query: 4548 LSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQ 4369
            L+D +EA+AW+ EKEPIV + +YG DE++A ALLKKH A L DL AF  +I+ L  QA
Sbjct: 911  LADLHEAEAWIKEKEPIVDNKNYGADEEAAGALLKKHEAFLVDLNAFGNSIKALGDQAEA 970

Query: 4368 CKYQE-QPMGQLGRDC-VLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQG 4195
            C+ Q+  P+ + GR+  V+ALYD++ +S REVSMKK DVLTLL++ N+DWWKVE +D QG
Sbjct: 971  CQQQQAAPVDEAGREARVIALYDFEARSRREVSMKKNDVLTLLSSINKDWWKVEADDHQG 1030

Query: 4194 FVPAAYVKRIE----PGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACK 4027
            FVPA YV+++     PG  QQ  ++ VN I   Q +IE  Y  L+   E R+R+L +
Sbjct: 1031 FVPAVYVRKLAHDELPGFPQQRREEPVN-IPQLQEQIETLYHSLLDRAEERRRRLLQRYN 1089

Query: 4026 GYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQ 3847
             + L  EA D+ EWI+ ++     +  G +L+ V  LQKKFD+F+ DLK+NE RL+++N+
Sbjct: 1090 EFLLAYEAGDMLEWIQEKKT----ENTGVELDDVWELQKKFDEFQRDLKSNEPRLKDINK 1145

Query: 3846 IATALTSVG-QTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETR 3670
            +A  L      T     IRQ   +LN RW +L          L SAH V+ F R+ D+ +
Sbjct: 1146 VADELLFEDLLTPEGSHIRQ---ELNTRWSSLKRLADEQYQLLSSAHAVEMFLREADDVK 1202

Query: 3669 DWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEA 3490
            + I +K  AL++ D G DL SVQALQR+HE  ERD+  LG+K+ +L E A RL +SHP+A
Sbjct: 1203 EQIDKKCQALNAADPGSDLLSVQALQRQHEVFERDIIPLGEKVTTLGETAERLCESHPDA 1262

Query: 3489 AEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQE 3310
             E +   + ELNE W+ L    ++RKE L +++ +  FLS   DL  WI ++  ++SS E
Sbjct: 1263 TEDLQKQRTELNEAWDTLQGLTSDRKESLNEAHKFFLFLSKASDLENWIKAIGGVISSPE 1322

Query: 3309 LANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEA 3130
            LA D+TG E LLERHQE+  +I     TFQA + FG +L++  H  + +IE  LQ +
Sbjct: 1323 LAEDLTGTEILLERHQEHYDDIKREDPTFQALEDFGRELIDRGHRNSHEIETTLQDIKLK 1382

Query: 3129 RKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSG-DNVESLIKKH 2953
            R  LE  W  R+ +LDQCLELQLF   CEQ ++WM ARE  L  +D    +++++L+KK
Sbjct: 1383 RDDLEKNWENRKKMLDQCLELQLFRGKCEQVESWMVARENSLRSDDRDHLNSLQALMKKR 1442

Query: 2952 EDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKL 2773
            +D DKAI  QE KI  L+  A  L+ N+HY    +  +  ++LDRW  LK  L+ +  KL
Sbjct: 1443 DDLDKAIAAQEGKIADLENHATRLMDNDHYAKEEIAARLQRVLDRWKDLKTQLLAELGKL 1502

Query: 2772 GESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIA 2593
            G+   L+QF RD +++E W++E               + +K+ K QAFE E++  ++++
Sbjct: 1503 GDYADLKQFYRDLEDLEEWISEM--------------LPRKYLKHQAFENEVNGRAEQVE 1548

Query: 2592 AIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAV 2413
             +I  G +LIE   C G E  +  +L  L + WD L++ TT+K  +L EA++Q+ F  ++
Sbjct: 1549 GVINLGKSLIERRVCDGDEENMQEQLDKLKENWDYLLERTTDKGQKLNEASRQQRFNTSI 1608

Query: 2412 KDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLEN 2233
            +D EFWL E E LL  +D  +DL S  NLLKKH LLEA+++A +D + ++N  A  L+ +
Sbjct: 1609 RDFEFWLSEAEGLLAMKDQARDLTSAGNLLKKHQLLEAEMLAREDPLKDLNGLAKELISS 1668

Query: 2232 DQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLV 2053
              F  +QI E+   + +R+  V+ +A    +KL +   + QFF+D+DDEE+WI+EK L V
Sbjct: 1669 GTFNIEQIEEKMNGVNERFKNVQSLAAAHHEKLKETYALFQFFQDLDDEEAWIEEKLLRV 1728

Query: 2052 SSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKR 1873
            SS D GRDL  VQNL +KHRR++ EL +HEP V  V    E L   AA   VG+++I++R
Sbjct: 1729 SSQDCGRDLQSVQNLLKKHRRLEGELVAHEPAVQNVLDTAESLKDKAA---VGKEEIQER 1785

Query: 1872 MEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAG 1693
            +    Q W ++++L   R   L+ES  +  F+ + EEEEAW+ EK  ++   + G+ +A
Sbjct: 1786 LAQFVQHWEKLKELAKTRGVNLEESLQYLQFMENAEEEEAWLGEKDALVSRGDSGDTLAA 1845

Query: 1692 VQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHN---------GNH------------- 1579
             Q LLKKH+  + D  +HK RV D+  +G+ +++          GNH
Sbjct: 1846 TQSLLKKHEALENDFAVHKNRVQDVCAQGEDILNKKISSFLMVLGNHVSSSFAWLPNSSS 1905

Query: 1578 -----------HAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESW 1432
                       +   I  + + L  +   +        ++L +  A+ QF WK DVVESW
Sbjct: 1906 HLTLASQEETQNKDKISTKIEVLNEKTASLTKALAAWKSQLDEVHAFQQFNWKADVVESW 1965

Query: 1431 IAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQS 1252
            I EKE  ++++  G DL++   LL KQ+  DA L +F+ E +  IT+LKD+L+++EH QS
Sbjct: 1966 IGEKEASLKTKSNGADLTAFLTLLAKQDTLDASLQSFQQERLSEITDLKDELLAAEHSQS 2025

Query: 1251 PAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAE 1072
             AIE+RH  +++RW+ LL      R           + EEL++ FA KAS FN+W ENAE
Sbjct: 2026 KAIEERHAALLRRWEQLLEACRVHRQKLLEKQLPLQKAEELFMEFAHKASAFNNWCENAE 2085

Query: 1071 EDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFT 892
            EDL++PV C SL EIR L+  H  F  S+  A+EDF  L  LD++IK+ NV  +PYTW T
Sbjct: 2086 EDLSEPVHCVSLNEIRQLQKEHEAFLASMVGAQEDFNYLLALDQQIKALNVSSSPYTWLT 2145

Query: 891  MDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEA 712
            +D L   W++L  IIKEREQEL +E  RQ +N ++ +EF + A+AF  W+  TR  + E
Sbjct: 2146 VDVLGRIWKHLPEIIKEREQELQKEEARQIKNFEMCQEFEQNASAFLQWIQETRSLLKET 2205

Query: 711  GGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQL 532
             GTLE QL+A +RK KEI+A K  L +IE+ G  +E  LILD +Y   ST+G+AQ WDQL
Sbjct: 2206 -GTLESQLEANKRKQKEIQAMKRHLTKIEDLGDSMEEALILDIKY---STIGLAQQWDQL 2261

Query: 531  DQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGY 352
             QL MRMQHNLEQQIQA                  KHFD+  TGRL H++F+SCLR L Y
Sbjct: 2262 HQLGMRMQHNLEQQIQA------------------KHFDENLTGRLTHKEFRSCLRGLNY 2303

Query: 351  DLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALS 172
             LPMV+EG+PEP+F++ L+ VDP R GYV+L++Y +F+I KE+ENI++S++IE  F+AL+
Sbjct: 2304 YLPMVEEGEPEPKFEKFLNAVDPGRKGYVSLEDYTSFLIDKESENIKTSDDIESGFQALA 2363

Query: 171  KEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
             E + Y+T E++   LTPEQ  FC   M+ YMD   GRS   G DY  F ++ F
Sbjct: 2364 -EGKAYITKEDMKQALTPEQVSFCTIHMQQYMDP-RGRSQPAGYDYVGFTNSFF 2415


>gi|46577681|sp|P16546|SPCN_MOUSE Spectrin alpha chain, brain
            (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin)
            (Fodrin alpha chain)
          Length = 1458

 Score = 1727 bits (4473), Expect = 0.0
 Identities = 862/1459 (59%), Positives = 1090/1459 (74%), Gaps = 45/1459 (3%)
 Frame = -1

Query: 4251 LLNASNRDWWKVEVNDRQGFVPAAYVKRIEPG--TAQQHAQQQVNSIGGKQSEIEDKYQR 4078
            LLN++N+DWWKVEVNDRQGFVPAAYVK+++P    ++++  ++  SI  +Q +I+++YQ
Sbjct: 2    LLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQGQIDNQYQS 61

Query: 4077 LMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDD 3898
            L+ LGE RK  LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDD
Sbjct: 62   LLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNEEVGADLEQVEVLQKKFDD 121

Query: 3897 FKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ----------------------- 3787
            F+ DLKANE RL+++N++A  L S G     V+  QQ
Sbjct: 122  FQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSA 181

Query: 3786 ------------IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDA 3643
                        I++LN RWR+L          LGSAHEVQRFHRD DET++WI+EK+ A
Sbjct: 182  RLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQA 241

Query: 3642 LDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQR 3463
            L+++++G DL SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE + +
Sbjct: 242  LNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCT 301

Query: 3462 ELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAE 3283
            ELN+ W  L  +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAE
Sbjct: 302  ELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAE 361

Query: 3282 ALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWV 3103
            ALLERHQE+RTEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV
Sbjct: 362  ALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWV 421

Query: 3102 ARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP--SGDNVESLIKKHEDFDKAIN 2929
             RR +LD CLELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN
Sbjct: 422  QRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAIN 481

Query: 2928 TQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQ 2749
             QEEKI  L+ FA+ LI  +HY    +  +R+++LDRW  LK  +I+KR KLGESQTLQQ
Sbjct: 482  VQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQ 541

Query: 2748 FSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNN 2569
            FSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I  GN+
Sbjct: 542  FSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNS 601

Query: 2568 LIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLG 2389
            LIE   C G E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +FWL
Sbjct: 602  LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS 661

Query: 2388 EVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQI 2209
            EVE LL SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F   Q+
Sbjct: 662  EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV 721

Query: 2208 AERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRD 2029
             E+R  I  R+  +K MAT RR KLS++  +HQFFRD+DDEESWIKEKKLLVSS+DYGRD
Sbjct: 722  KEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD 781

Query: 2028 LPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSW 1849
            L GVQNLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+    + W
Sbjct: 782  LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGQEEIQQRLAQFVEHW 838

Query: 1848 GQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKH 1669
             +++ L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGLLKKH
Sbjct: 839  KELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKH 898

Query: 1668 DTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKL 1489
            + F+ D  +HK RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R AKL
Sbjct: 899  EAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKL 958

Query: 1488 RDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEG 1309
             +NSA+LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EG
Sbjct: 959  DENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEG 1018

Query: 1308 IQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEEL 1129
            I  IT LKDQL++++H QS AIE RH ++++RW  LLA+S  R+           ++E+L
Sbjct: 1019 IANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDL 1078

Query: 1128 YLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQD 949
            +L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +
Sbjct: 1079 FLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAE 1138

Query: 948  LDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAK 769
            LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+
Sbjct: 1139 LDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQ 1198

Query: 768  LANAFHAWLTNTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAML 607
             ANAFH W+  TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +
Sbjct: 1199 HANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAM 1258

Query: 606  ERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMF 427
            E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMF
Sbjct: 1259 EEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMF 1318

Query: 426  KHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYM 247
            KHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYM
Sbjct: 1319 KHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYM 1378

Query: 246  AFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAI 67
            AFMIS+ETEN++SSEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D
Sbjct: 1379 AFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG- 1437

Query: 66   SGRSIQGGLDYEQFVHALF 10
             GR +    DY +F  +LF
Sbjct: 1438 KGRELPTAFDYVEFTRSLF 1456



 Score =  674 bits (1738), Expect = 0.0
 Identities = 420/1228 (34%), Positives = 644/1228 (52%), Gaps = 106/1228 (8%)
 Frame = -1

Query: 6801 LQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYR 6622
            L+++ K     R+ +E+  WI EKE  +T E++G DLE VE+LQ+KFDDF K+L  ++ R
Sbjct: 73   LEKSCKKFMLFREANELQQWITEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESR 132

Query: 6621 INEINQAADKLVEEG-HSEHDQIYKKRD-------------------------------- 6541
            + +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 133  LKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFN 192

Query: 6540 ---DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLN 6370
               ++N+ W  L  LA  R + L  AH+VQRF+RDADET  WI EK+ AL++D+YG DL
Sbjct: 193  SIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLA 252

Query: 6369 NVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKE 6190
            +VQALQRKHEG ERDLAAL  K+  L + A +L ++HP+ AE + +K  +   AW +L +
Sbjct: 253  SVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGK 312

Query: 6189 KAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKG 6010
            +A  RK  L  S  L RFL+D+RDL+SWI  ++ ++ +DELAKDV GAEALLE HQEH+
Sbjct: 313  RADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRT 372

Query: 6009 EIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMD 5830
            EIDARA +F      GQ+L+  G   SPE++EKL+ LD E++ L   W +RR++ + C++
Sbjct: 373  EIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLE 432

Query: 5829 LQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDE 5650
            LQLF+RD EQAE WM  +EAFL   D GDSLDSVE LIKKHEDF+K++  QEEKI AL
Sbjct: 433  LQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQA 492

Query: 5649 FATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSW 5470
            FA +LI   HYA  D+A                   + + L ES   Q F RD DE+ +W
Sbjct: 493  FADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAW 552

Query: 5469 ITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAA-- 5296
            I+EKL TA D+SY DPTNI+ K QKH  FE EL AN +R+  +   G  +I+ G  A
Sbjct: 553  ISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSE 612

Query: 5295 DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDY 5116
            D +  RL  + + W  LV  + +K  KL+EA  +Q FN  I+D + WLSE+E  +ASEDY
Sbjct: 613  DAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDY 672

Query: 5115 GKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRY 4936
            GKDL SV NL KK  L+E+D +AH DR+  +   A        F+   +  K++ +  R+
Sbjct: 673  GKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRF 732

Query: 4935 NALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQ 4756
              ++     R+ KL ESH+ +Q FRD++DE +WI+EK+ +  S + GRDL GVQNL KK
Sbjct: 733  QKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKH 792

Query: 4755 QALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDL 4576
            + L AE+A H+  I+ V      +         EI+ +LAQ  ++W+ LK  A  R   L
Sbjct: 793  KRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRL 852

Query: 4575 DDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSD-------- 4420
            ++SL+  Q++++  E +AW++EK  +V S DYG    + + LLKKH A  +D
Sbjct: 853  EESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRV 912

Query: 4419 ------------------------LEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLAL 4312
                                    ++   G + DL K A+Q K       +L  +
Sbjct: 913  NDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRK------AKLDENSAFLQ 966

Query: 4311 YDYQEK------SPREVSMKKGD-------VLTLLNASNRDWWKVEVNDRQGFVPAAYVK 4171
            ++++          +E S+K  D       V TLL         ++   ++G      +K
Sbjct: 967  FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK 1026

Query: 4170 RIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQ--------L 4015
              +   A +H Q +  +I  + + +  ++ +L+    TRK+KL EA   ++
Sbjct: 1027 --DQLLAAKHIQSK--AIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTF 1082

Query: 4014 LREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATA 3835
             ++A+    W ++ E           LE+++ L++  D F+  L + +    ++ ++
Sbjct: 1083 AKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQ 1142

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGS---------------AHEVQ 3700
            + S  +  +       +E L   WR L         +L                 A
Sbjct: 1143 IKSF-RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN 1201

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
             FH+ + ETR ++   D +   E+ G     ++A +RKH+    ++ A+  ++K +++
Sbjct: 1202 AFHQWIQETRTYL--LDGSCMVEESGTLESQLEATKRKHQ----EIRAMRSQLKKIEDLG 1255

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRL 3436
              + ++     +        L +QW++L
Sbjct: 1256 AAMEEALILDNKYTEHSTVGLAQQWDQL 1283



 Score =  344 bits (882), Expect = 2e-92
 Identities = 296/1278 (23%), Positives = 564/1278 (43%), Gaps = 105/1278 (8%)
 Frame = -1

Query: 5280 RLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLV 5101
            R  Q++N +  L++   K+   L ++  +    R   +++ W++E E  + +E+ G DL
Sbjct: 51   RQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNEEVGADLE 110

Query: 5100 SVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPV-IVRKQE---------- 4954
             V+ LQKK    + D  A+  R+  I ++A+  + E      V  V++QE
Sbjct: 111  QVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEA 170

Query: 4953 -------------------------NLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIED 4849
                                      L +R+ +L+   E+R + LG +H+  +  RD ++
Sbjct: 171  DSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADE 230

Query: 4848 ELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGH 4669
               WI EK Q   + N G DL  VQ L +K +    ++A    ++ S+   A  +IQ
Sbjct: 231  TKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHP 290

Query: 4668 FLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGS 4489
              A ++++K  +L   W  L  +A++R+  L DS    ++LSD  +  +W++    +V S
Sbjct: 291  ESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSS 350

Query: 4488 TDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC------------------- 4366
             +  KD   AEALL++H+   ++++A  GT +   +   Q
Sbjct: 351  DELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILD 410

Query: 4365 -------KYQEQPMGQLGRDCVLALYDYQ-EKSPREVSMKKGDVLTLLNASNRDWWKVEV 4210
                   K   Q    L     L L+    E++   ++ ++  + T     + D  +  +
Sbjct: 411  QERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALI 470

Query: 4209 NDRQGFVPAAYVKRIEPGTAQQHAQQQV-------NSIGGKQSEIEDKYQRLMMLGETRK 4051
               + F  A  V+  +    Q  A Q +         I  +++E+ D+++RL      ++
Sbjct: 471  KKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKR 530

Query: 4050 RKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANE 3871
             KL E+    Q  R+ +++  WI S +   A  E   D   ++   +K   F+ +L AN
Sbjct: 531  SKLGESQTLQQFSRDVDEIEAWI-SEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANA 589

Query: 3870 VRLQEMNQIATALTSVGQ---TETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQ 3700
             R++ +  +  +L   G    +E AV+ R  +  L  +W+ L         +L  A++ Q
Sbjct: 590  DRIRGVIDMGNSLIERGACAGSEDAVKAR--LAALADQWQFLVQKSAEKSQKLKEANKQQ 647

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
             F+  + +   W+ E +  L SED+G+DL SV  L +KH+ +E D++A  D++K L+ +A
Sbjct: 648  NFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQA 707

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA 3340
            + L  S      Q+ + +  +N ++ ++ S A +R+ KL +S+   +F  D  D   WI
Sbjct: 708  DSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIK 767

Query: 3339 SMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDI 3160
                LVSS++   D+TG + L ++H+    E+ +     Q     G +L + +     +I
Sbjct: 768  EKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEI 827

Query: 3159 ENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD 2980
            + RL    E  K L+    AR   L++ LE Q F  + E+ + W++ +   +A ED  GD
Sbjct: 828  QQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASED-YGD 886

Query: 2979 N---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNG 2809
                ++ L+KKHE F+      ++++  +    + LIK N++    ++ K   +  + +
Sbjct: 887  TLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSD 946

Query: 2808 LKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQA 2632
            L++A  Q++ KL E+    QF+  AD +E+W+ EK    + ++Y RD +++Q    KQ+
Sbjct: 947  LEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQET 1006

Query: 2631 FEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRL 2452
            F+A L A      A I A  + +  AK    + A+ AR  +L  +W  L+  +  +  +L
Sbjct: 1007 FDAGLQAFQQEGIANITALKDQLLAAKHIQSK-AIEARHASLMKRWTQLLANSATRKKKL 1065

Query: 2451 KEANKQ--------KSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEAD 2296
             EA            +F         W    E  L        L  ++ L + H    +
Sbjct: 1066 LEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSS 1125

Query: 2295 IVAHQ---DRVGEMNEQADSL--------------LENDQFQGQQIAERRKLIADRYDGV 2167
            + + Q   +++ E++ Q  S               LE      Q+I + R+L   +
Sbjct: 1126 LSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQK---- 1181

Query: 2166 KKMATDRRDKLSK--ALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHR 1993
            ++   +  DKL +  A + + F + I +  +++ +   +V  ++ G     ++  +RKH+
Sbjct: 1182 EQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMV--EESGTLESQLEATKRKHQ 1239

Query: 1992 RIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRME-DLEQSWGQIRDLTGNRH 1816
                E+ +   Q+     K E+L  +  EA + +++  +     L Q W Q+  L
Sbjct: 1240 ----EIRAMRSQLK----KIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQ 1291

Query: 1815 QRLDESEAFQAFLGDVEE 1762
              L++    +   G  EE
Sbjct: 1292 HNLEQQIQARNTTGVTEE 1309



 Score =  340 bits (873), Expect = 2e-91
 Identities = 250/940 (26%), Positives = 429/940 (45%), Gaps = 15/940 (1%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 208  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 267

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   +IQ +  ++E +K++  EL+  W         +  KL  +  L
Sbjct: 268  LAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDL 327

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +  +   E+           Q
Sbjct: 328  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQF 387

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 388  GQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWM 447

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAE 6244
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L A  H  + +
Sbjct: 448  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGD 507

Query: 6243 AIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELA 6064
              +++N +    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE
Sbjct: 508  IANRRN-EVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESY 565

Query: 6063 KDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHE 5890
            KD    ++  + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +
Sbjct: 566  KDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQ 625

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L+    E+    ++    Q F    +  + W+++ EA LA+ D G  L SV +L+KK
Sbjct: 626  WQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKK 685

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  ++A E+++  L+  A  L+    +    V E                  R
Sbjct: 686  HQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAK 745

Query: 5529 LKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
            L ES++   F RD D+  SWI E KL  + +D   D T ++   +KH   E EL A+E
Sbjct: 746  LSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPA 805

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +  +  TG+++ D      + I  RL Q    W EL      +G +L E+   QQF  N+
Sbjct: 806  IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 865

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
            E+ EAW++E    VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++
Sbjct: 866  EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 925

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
             + +   I  K + L  + + L     +RK KL E+    Q     +   +WI EKE
Sbjct: 926  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 985

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLA 4636
             + + GRDL  VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A
Sbjct: 986  KTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHA 1045

Query: 4635 QLRDNWRILKSKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTD 4483
             L   W  L + +  R+  L ++ Q+H       +L+ A +A A   W    E  +
Sbjct: 1046 SLMKRWTQLLANSATRKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPV 1104

Query: 4482 YGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                 +  +AL + H A  S L + +     L +   Q K
Sbjct: 1105 RCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIK 1144



 Score =  315 bits (808), Expect = 8e-84
 Identities = 306/1278 (23%), Positives = 544/1278 (41%), Gaps = 123/1278 (9%)
 Frame = -1

Query: 6207 WNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLES 6028
            + +L E  + RK  LE+S +      +  +L  WI + +A +  +E+  D+   E L +
Sbjct: 59   YQSLLELGEKRKGMLEKSCKKFMLFREANELQQWITEKEAALTNEEVGADLEQVEVLQKK 118

Query: 6027 HQEHKGEIDARADSFNQTASAGQKLVEMGI--PESPEVQEK------------------- 5911
              + + ++ A            + L   G+   E   VQ++
Sbjct: 119  FDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGAMPRDEADSKTASPW 178

Query: 5910 ---------------LEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
                           +++L+    SL  L EER  L     ++Q F+RD ++ + W+ ++
Sbjct: 179  KSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEK 238

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
               L   + G  L SV+ L +KHE FE+ LAA  +K+N+L E A +LIQ    +A+D+ E
Sbjct: 239  NQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKE 298

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPT 5419
                              R   L +S+  Q F  D  +++SWI   +   + D+   D T
Sbjct: 299  KCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVT 358

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
                 L++H     E+ A           G+Q++  GH+A+  I ++L  ++    +L
Sbjct: 359  GAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEK 418

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            A  ++   L      Q F+R+ E  E W++  E  + +ED G  L SV+ L KK    +
Sbjct: 419  AWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDK 478

Query: 5058 DFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQ 4879
              N   +++  ++  A Q    +H+    I  ++  +  R+  L+  + +++ KLGES
Sbjct: 479  AINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQT 538

Query: 4878 GNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSS 4699
              Q  RD+++  AWI EK Q A S    +D   +Q+  +K QA  AE+  +  +I  V
Sbjct: 539  LQQFSRDVDEIEAWISEKLQTA-SDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVID 597

Query: 4698 AANDMIQQGHFLAPE--IRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
              N +I++G     E  ++ +LA L D W+ L  K+ ++   L ++ +   + +   + D
Sbjct: 598  MGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFD 657

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA---------- 4375
             W+SE E ++ S DYGKD  S   LLKKH+ L +D+ A +  ++DL  QA
Sbjct: 658  FWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFD 717

Query: 4374 -SQCK---------YQEQPMGQLGRDCVLA----LYD-YQEKSPREVSMKKGDVLTLLNA 4240
             SQ K         +Q+       R   L+    L+  +++    E  +K+  +L
Sbjct: 718  TSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSED 777

Query: 4239 SNRDWWKVEVNDRQGFVPAAYVKRIEPG-TAQQHAQQQVNSIGGK--------QSEIEDK 4087
              RD   V+ N R+        KR+E    A + A Q V   G K        Q EI+ +
Sbjct: 778  YGRDLTGVQ-NLRKKH------KRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQR 830

Query: 4086 -------YQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQ 3928
                   ++ L  L   R ++LEE+ +  Q +    +   WI  +  + A ++ G  L
Sbjct: 831  LAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAA 890

Query: 3927 VEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXX 3748
            ++ L KK + F+ D   ++ R+ ++      L           I  +++ LN +   L
Sbjct: 891  IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEE-NISSKMKGLNGKVSDLEK 949

Query: 3747 XXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVER 3568
                   +L       +F+   D    WI EK+++L ++D+GRDL SVQ L  K E  +
Sbjct: 950  AAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDA 1009

Query: 3567 DLAALGDK-IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSY 3391
             L A   + I ++    ++L  +    ++ I      L ++W +L + +  RK+KLL++
Sbjct: 1010 GLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQ 1069

Query: 3390 DYQRFLSDY--------RDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSR 3235
             + R + D              W  +  + ++     N +   +AL E H  +R+ + S
Sbjct: 1070 SHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSA 1129

Query: 3234 AATFQAFDQFGNQL----LNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNIL-DQCLE 3070
             A F    +   Q+    + S+ Y    +E            LE+ W   + I+ ++ LE
Sbjct: 1130 QADFNQLAELDRQIKSFRVASNPYTWFTME-----------ALEETWRNLQKIIKERELE 1178

Query: 3069 LQLFYRDCEQAD--------------TWMSAREAFL----AQEDPSG---DNVESLIKKH 2953
            LQ   R  E+ D               W+     +L       + SG     +E+  +KH
Sbjct: 1179 LQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKH 1238

Query: 2952 EDFDKAINTQEEKIKGL-KLFAESLIKNNHYDSPAVT------RKRDQILDRWNGLKEAL 2794
            ++  +A+ +Q +KI+ L     E+LI +N Y   +         + DQ+  R     E
Sbjct: 1239 QEI-RAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQ 1297

Query: 2793 IQKRFKLG-ESQTLQQFS 2743
            IQ R   G   + L++FS
Sbjct: 1298 IQARNTTGVTEEALKEFS 1315



 Score =  311 bits (797), Expect = 2e-82
 Identities = 288/1299 (22%), Positives = 555/1299 (42%), Gaps = 121/1299 (9%)
 Frame = -1

Query: 5979 QTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQ 5800
            Q+AS    L E G      +  +  ++D++  SLL L E+R+ + E+     + +R+  +
Sbjct: 34   QSASRENLLEEQG-----SIALRQGQIDNQYQSLLELGEKRKGMLEKSCKKFMLFREANE 88

Query: 5799 AETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL----- 5635
             + W+ ++EA L N ++G  L+ VE L KK +DF+K L A E ++  +++ A  L
Sbjct: 89   LQQWITEKEAALTNEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGL 148

Query: 5634 -------IQGQH-YAA--DDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKR-------- 5509
                   +Q Q  Y A   D A+                    N++KE  +R
Sbjct: 149  MAEEVQAVQQQEVYGAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA 208

Query: 5508 -------------QTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQEL 5371
                         Q F RD DE   WI EK      D+Y  D  +++   +KH  FE++L
Sbjct: 209  EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 268

Query: 5370 KANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
             A  ++++ +  T +++I S   +A+ + ++  ++N  W  L    +++ AKL ++ + Q
Sbjct: 269  AALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQ 328

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
            +F  +  D+ +W++ + G V+S++  KD+   + L ++     ++ +A        +Q
Sbjct: 329  RFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFG 388

Query: 5010 QQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIR 4831
            QQ     H+ +P I  K + L Q    L     +R+  L    +     RD E    W+
Sbjct: 389  QQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMA 448

Query: 4830 EKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEI 4651
             +E    + ++G  L  V+ LIKK +     I   + +I ++ + A+ +I   H+   +I
Sbjct: 449  AREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDI 508

Query: 4650 RDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKD 4471
             ++  ++ D WR LK++  ++R+ L +S    Q+  D +E +AW+SEK        Y KD
Sbjct: 509  ANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESY-KD 567

Query: 4470 EDSAEALLKKHRALLSDLEA----FKGTIE---DLRKQASQCKYQEQPMGQLGRDCVLAL 4312
              + ++  +KH+A  ++L A     +G I+    L ++ +    ++    +L
Sbjct: 568  PTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQ 627

Query: 4311 YDYQEKSPREVSMKKGDVLTLLNASNR--DWWKVEVN-------------------DRQG 4195
            +  Q+ + +   +K+ +     N   +  D+W  EV                     +
Sbjct: 628  FLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQ 687

Query: 4194 FVPA---AYVKRIEPGTAQQHAQQ-----QVNSIGGKQSEIEDKYQRLMMLGETRKRKLE 4039
             + A   A+  R++   +Q  +         + +  K+  I  ++Q++  +  +R+ KL
Sbjct: 688  LLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLS 747

Query: 4038 EACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQ 3859
            E+ + +Q  R+ +D   WIK ++ + + ++ G DL  V+ L+KK    + +L A+E  +Q
Sbjct: 748  ESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQ 807

Query: 3858 EMNQIATALT---SVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHR 3688
             +      L+   ++GQ E   R+ Q +E     W+ L         +L  + E Q+F
Sbjct: 808  GVLDTGKKLSDDNTIGQEEIQQRLAQFVE----HWKELKQLAAARGQRLEESLEYQQFVA 863

Query: 3687 DVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLR 3508
            +V+E   WI EK   + SED+G  L ++Q L +KHE  E D     D++  +      L
Sbjct: 864  NVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLI 923

Query: 3507 QSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQ 3328
            + +    E I    + LN + + L   A  RK KL ++  + +F      +  WI
Sbjct: 924  KKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKEN 983

Query: 3327 LVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFG--------NQLLNSHHYA 3172
             + + +   D++  + LL + + +        A  QAF Q G        +QLL + H
Sbjct: 984  SLKTDDYGRDLSSVQTLLTKQETF-------DAGLQAFQQEGIANITALKDQLLAAKHIQ 1036

Query: 3171 AGDIENR-----------LQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWM 3025
            +  IE R           L      +K L +A    R + D  L    F +     ++W
Sbjct: 1037 SKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFL---TFAKKASAFNSWF 1093

Query: 3024 SAREAFLAQEDP----SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDS 2857
               E  L   DP    S + +++L + H+ F  ++++ +     L      +       +
Sbjct: 1094 ENAEEDLT--DPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASN 1151

Query: 2856 PAVTRKRDQILDRWNGLKEALIQKRFKLGESQ--------TLQQFSRDADEIENWMTEKF 2701
            P      + + + W  L++ + ++  +L + Q          Q+F++ A+    W+ E
Sbjct: 1152 PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETR 1211

Query: 2700 QIAQE-----------ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQA---GNNLI 2563
                +           E+  + T  ++KHQ+ +A  ++L    D  AA+ +A    N
Sbjct: 1212 TYLLDGSCMVEESGTLESQLEAT--KRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYT 1269

Query: 2562 ENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKE 2446
            E++  G            L  QWD L +      + L++
Sbjct: 1270 EHSTVG------------LAQQWDQLDQLGMRMQHNLEQ 1296



 Score =  281 bits (719), Expect = 2e-73
 Identities = 205/801 (25%), Positives = 359/801 (44%), Gaps = 46/801 (5%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            DI  RR EVL  +   K     KR +L E++  Q F RD DE+  WI EKLQTA +E+++
Sbjct: 507  DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK 566

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEH--IKKRLEELHALW 6841
            DP+N+Q+K QKH+AFEAE+ A+A  I  +   GN++I+    A     +K RL  L   W
Sbjct: 567  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 626

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KL++A K  +F     +  +W+ E E  + +ED G DL  V  L +K
Sbjct: 627  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 686

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 ++  H+ R+ ++N  AD L+     +  Q+ +KRD +N  + ++ ++A +R+  L
Sbjct: 687  QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 746

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +H++ +F RD D+  +WI EK L +SS+DYGRDL  VQ L++KH+  E +LAA E  +
Sbjct: 747  SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 806

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              +     KL++ +    E I Q+       W  LK+ A  R   LE S +  +F+A+
Sbjct: 807  QGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 866

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +WI +   ++ +++    +A  + LL+ H+  + +     D  N   + GQ L++
Sbjct: 867  EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN 926

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
                  +  K++ L+ + S L     +R+   ++      F    +  E+W+ ++E  L
Sbjct: 927  NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 986

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAA-QEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
              D G  L SV+ L+ K E F+  L A Q+E I  +     +L+  +H  +  +
Sbjct: 987  TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHAS 1046

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTAR------DDSYLDP 5422
                          R   L E+   Q+  R  +++     +K S         ++   DP
Sbjct: 1047 LMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDP 1103

Query: 5421 T------NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
                    I+   + H  F   L + +   + +     QI      +  +    +  +
Sbjct: 1104 VRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEE 1163

Query: 5259 LWNELVDATNKKGAKL-----REAGNE---QQFNRNIEDVEAWLSE-----LEGQVASED 5119
             W  L     ++  +L     R+  N+   Q+F ++      W+ E     L+G    E+
Sbjct: 1164 TWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEE 1223

Query: 5118 YG---KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQ---------------LAQQFQEE 4993
             G     L + +   ++I  + S      D    +++               LAQQ+ +
Sbjct: 1224 SGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 1283

Query: 4992 EHFNAPVIVRKQENLQQRYNA 4930
            +       +R Q NL+Q+  A
Sbjct: 1284 DQLG----MRMQHNLEQQIQA 1300



 Score =  107 bits (268), Expect = 3e-21
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 10/312 (3%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            ++I QR  + + H+   K  +  +  RLEE+ ++Q F  + +E   WI EK+     E++
Sbjct: 825  EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDY 884

Query: 7017 RDP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
             D  + +Q  ++KHEAFE +   H   + ++   G  +I+ N+   E+I  +++ L+
Sbjct: 885  GDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKV 944

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  KL +    L F  + D +  WI EKE  +  +D G DL  V+ L  K
Sbjct: 945  SDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQ 1004

Query: 6660 DDFLKELGNHQYR-INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            + F   L   Q   I  I    D+L+   H +   I  +   +   W +L   +ATRK+
Sbjct: 1005 ETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKK 1064

Query: 6483 LFGAHQVQR--------FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTER 6328
            L  A    R        F + A    +W    +  L+       L  ++AL+  H+
Sbjct: 1065 LLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRS 1124

Query: 6327 DLAALEGKMLQL 6292
             L++ +    QL
Sbjct: 1125 SLSSAQADFNQL 1136


>gi|20380003|gb|AAH27791.1| Spna2 protein [Mus musculus]
          Length = 1359

 Score = 1618 bits (4191), Expect = 0.0
 Identities = 811/1358 (59%), Positives = 1015/1358 (74%), Gaps = 43/1358 (3%)
 Frame = -1

Query: 3954 QEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ---- 3787
            +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G     V+  QQ
Sbjct: 4    REVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVY 63

Query: 3786 -------------------------------IEDLNARWRALXXXXXXXXXQLGSAHEVQ 3700
                                           I++LN RWR+L          LGSAHEVQ
Sbjct: 64   GAMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQ 123

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
            RFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAALGDK+ SL E A
Sbjct: 124  RFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETA 183

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA 3340
             RL QSHPE+AE + +   ELN+ W  L  +A+ RK KL DS+D QRFLSD+RDLM WI
Sbjct: 184  QRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWIN 243

Query: 3339 SMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDI 3160
             +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL   HYA+ +I
Sbjct: 244  GIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEI 303

Query: 3159 ENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP--S 2986
            + +L  +++ R  LE AWV RR +LD CLELQLF+RDCEQA+ WM+AREAFL  ED   S
Sbjct: 304  KEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDS 363

Query: 2985 GDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGL 2806
             D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI  +HY    +  +R+++LDRW  L
Sbjct: 364  LDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRL 423

Query: 2805 KEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFE 2626
            K  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK QAFE
Sbjct: 424  KAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFE 483

Query: 2625 AELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKE 2446
            AELHAN+DRI  +I  GN+LIE   C G E AV ARL AL DQW  LV+ + EKS +LKE
Sbjct: 484  AELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKE 543

Query: 2445 ANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGE 2266
            ANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH LLEADI AH+DR+ +
Sbjct: 544  ANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKD 603

Query: 2265 MNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDE 2086
            +N QADSL+ +  F   Q+ E+R  I  R+  +K MAT RR KLS++  +HQFFRD+DDE
Sbjct: 604  LNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDE 663

Query: 2085 ESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAE 1906
            ESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V   G++L   + +
Sbjct: 664  ESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDD 720

Query: 1905 AGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQIL 1726
              +G+++I++R+    + W +++ L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++
Sbjct: 721  NTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLV 780

Query: 1725 GSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQ 1546
             S+++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G  LI   NHH  +I  +
Sbjct: 781  ASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKG 840

Query: 1545 LRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
            L  ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDLSSVQ
Sbjct: 841  LNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQT 900

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSE 1186
            LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH ++++RW  LLA+S
Sbjct: 901  LLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSA 960

Query: 1185 ARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAH 1006
             R+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH
Sbjct: 961  TRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAH 1020

Query: 1005 GEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQEL 826
              F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL
Sbjct: 1021 DAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELEL 1080

Query: 825  AREHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGTLEEQLDAVERKAK 664
             +E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GTLE QL+A +RK +
Sbjct: 1081 QKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQ 1140

Query: 663  EIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQ 484
            EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQ
Sbjct: 1141 EIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQ 1200

Query: 483  ARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQR 304
            ARN +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+
Sbjct: 1201 ARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEA 1260

Query: 303  ILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANL 124
            ILD VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +PYVT EELY NL
Sbjct: 1261 ILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNL 1320

Query: 123  TPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            T EQA++C+  MKPY+D   GR +    DY +F  +LF
Sbjct: 1321 TREQADYCVSHMKPYVDG-KGRELPTAFDYVEFTRSLF 1357



 Score =  652 bits (1682), Expect = 0.0
 Identities = 409/1197 (34%), Positives = 626/1197 (52%), Gaps = 106/1197 (8%)
 Frame = -1

Query: 6708 DMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEG-HSEHDQIYKKRD--- 6541
            ++G DLE VE+LQ+KFDDF K+L  ++ R+ +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 5    EVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYG 64

Query: 6540 --------------------------------DVNDAWHRLNTLAATRKEGLFGAHQVQR 6457
                                            ++N+ W  L  LA  R + L  AH+VQR
Sbjct: 65   AMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQR 124

Query: 6456 FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAH 6277
            F+RDADET  WI EK+ AL++D+YG DL +VQALQRKHEG ERDLAAL  K+  L + A
Sbjct: 125  FHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQ 184

Query: 6276 KLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGD 6097
            +L ++HP+ AE + +K  +   AW +L ++A  RK  L  S  L RFL+D+RDL+SWI
Sbjct: 185  RLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWING 244

Query: 6096 MKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQ 5917
            ++ ++ +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G   SPE++
Sbjct: 245  IRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIK 304

Query: 5916 EKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSL 5737
            EKL+ LD E++ L   W +RR++ + C++LQLF+RD EQAE WM  +EAFL   D GDSL
Sbjct: 305  EKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSL 364

Query: 5736 DSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXX 5557
            DSVE LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D+A
Sbjct: 365  DSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLK 424

Query: 5556 XXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQ 5377
                 + + L ES   Q F RD DE+ +WI+EKL TA D+SY DPTNI+ K QKH  FE
Sbjct: 425  AQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEA 484

Query: 5376 ELKANENRLDDIRSTGEQIIDSGHFAA--DHIGDRLRQVNNLWNELVDATNKKGAKLREA 5203
            EL AN +R+  +   G  +I+ G  A   D +  RL  + + W  LV  + +K  KL+EA
Sbjct: 485  ELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEA 544

Query: 5202 GNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGI 5023
              +Q FN  I+D + WLSE+E  +ASEDYGKDL SV NL KK  L+E+D +AH DR+  +
Sbjct: 545  NKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDL 604

Query: 5022 KQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDEL 4843
               A        F+   +  K++ +  R+  ++     R+ KL ESH+ +Q FRD++DE
Sbjct: 605  NSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEE 664

Query: 4842 AWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFL 4663
            +WI+EK+ +  S + GRDL GVQNL KK + L AE+A H+  I+ V      +
Sbjct: 665  SWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIG 724

Query: 4662 APEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTD 4483
              EI+ +LAQ  ++W+ LK  A  R   L++SL+  Q++++  E +AW++EK  +V S D
Sbjct: 725  QEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASED 784

Query: 4482 YGKDEDSAEALLKKHRALLSD--------------------------------LEAFKGT 4399
            YG    + + LLKKH A  +D                                ++   G
Sbjct: 785  YGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGK 844

Query: 4398 IEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEK------SPREVSMKKGD-------V 4258
            + DL K A+Q K       +L  +     ++++          +E S+K  D       V
Sbjct: 845  VSDLEKAAAQRK------AKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSV 898

Query: 4257 LTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQR 4078
             TLL         ++   ++G      +K  +   A +H Q +  +I  + + +  ++ +
Sbjct: 899  QTLLTKQETFDAGLQAFQQEGIANITALK--DQLLAAKHIQSK--AIEARHASLMKRWTQ 954

Query: 4077 LMMLGETRKRKLEEACKGYQ--------LLREANDLAEWIKSREAVAAQQEIGTDLEQVE 3922
            L+    TRK+KL EA   ++          ++A+    W ++ E           LE+++
Sbjct: 955  LLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIK 1014

Query: 3921 VLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXX 3742
             L++  D F+  L + +    ++ ++   + S  +  +       +E L   WR L
Sbjct: 1015 ALREAHDAFRSSLSSAQADFNQLAELDRQIKSF-RVASNPYTWFTMEALEETWRNLQKII 1073

Query: 3741 XXXXXQLGS---------------AHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRS 3607
                 +L                 A     FH+ + ETR ++   D +   E+ G
Sbjct: 1074 KERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYL--LDGSCMVEESGTLESQ 1131

Query: 3606 VQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRL 3436
            ++A +RKH+    ++ A+  ++K +++    + ++     +        L +QW++L
Sbjct: 1132 LEATKRKHQ----EIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 1184



 Score =  397 bits (1020), Expect = e-108
 Identities = 272/1153 (23%), Positives = 539/1153 (46%), Gaps = 23/1153 (1%)
 Frame = -1

Query: 4143 HAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAV 3964
            H     NSI     E+ ++++ L  L E R + L  A +  +  R+A++  EWI+ +
Sbjct: 87   HTVATFNSI----KELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQA 142

Query: 3963 AAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQI 3784
                  G DL  V+ LQ+K + F+ DL A   ++  + + A  L      E+A  ++++
Sbjct: 143  LNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQ-SHPESAEDLKEKC 201

Query: 3783 EDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSV 3604
             +LN  W +L         +LG +H++QRF  D  +   WI      + S++  +D+
Sbjct: 202  TELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGA 261

Query: 3603 QALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKA 3424
            +AL  +H+    ++ A     ++ ++   +L      A+ +I +    L+++   L
Sbjct: 262  EALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAW 321

Query: 3423 NNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEI 3244
              R+  L    + Q F  D      W+A+    +++++  + +   EAL+++H+++   I
Sbjct: 322  VQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAI 381

Query: 3243 DSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQ 3064
            + +     A   F +QL+   HYA GDI NR   V +  + L+   + +R+ L +   LQ
Sbjct: 382  NVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQ 441

Query: 3063 LFYRDCEQADTWMSAREAFLAQE---DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLF 2893
             F RD ++ + W+S +    + E   DP+  N++S  +KH+ F+  ++   ++I+G+
Sbjct: 442  QFSRDVDEIEAWISEKLQTASDESYKDPT--NIQSKHQKHQAFEAELHANADRIRGVIDM 499

Query: 2892 AESLIKNNHY--DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIEN 2719
              SLI+         AV  +   + D+W  L +   +K  KL E+   Q F+    + +
Sbjct: 500  GNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDF 559

Query: 2718 WMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGG 2542
            W++E   +   E+Y +D  ++    +K Q  EA++ A+ DR+  +    ++L+ ++
Sbjct: 560  WLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDT 619

Query: 2541 GEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSE 2362
             +  V  +   +N ++  +    T +  +L E+++   F   + D E W+ E ++L+ SE
Sbjct: 620  SQ--VKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSE 677

Query: 2361 DYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIAD 2182
            DYG+DL  V+NL KKH  LEA++ AH+  +  + +    L +++    ++I +R     +
Sbjct: 678  DYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVE 737

Query: 2181 RYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRR 2002
             +  +K++A  R  +L ++L   QF  ++++EE+WI EK  LV+S+DYG  L  +Q L +
Sbjct: 738  HWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLK 797

Query: 2001 KHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGN 1822
            KH   +T+   H+ +V+ V   G++L++   +    E+ I  +M+ L      +
Sbjct: 798  KHEAFETDFTVHKDRVNDVCTNGQDLIK---KNNHHEENISSKMKGLNGKVSDLEKAAAQ 854

Query: 1821 RHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLEL 1642
            R  +LDE+ AF  F    +  E+W+ EK+  L +D++G +++ VQ LL K +TF   L+
Sbjct: 855  RKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 914

Query: 1641 HKQR-VADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRD------ 1483
             +Q  +A++    D L+   +  +  I+ R   L  R  ++ + +  R  KL +
Sbjct: 915  FQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFR 974

Query: 1482 --NSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEG 1309
                 +L F  K     SW    E+ +        L  ++ L    +AF + L++ + +
Sbjct: 975  KVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQAD- 1033

Query: 1308 IQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEEL 1129
              ++ EL  Q+ S     +P        + + W+NL    + R            + ++L
Sbjct: 1034 FNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKL 1093

Query: 1128 YLAFAKKASTFNSWFENAEEDLTD----PVRCNSLE-EIRALRDAHGEFQRSLSSAEEDF 964
               FA+ A+ F+ W +     L D         +LE ++ A +  H E    + +
Sbjct: 1094 RQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQE----IRAMRSQL 1149

Query: 963  RQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEE---ND 793
            ++++DL   ++   +  N YT  +   L   W  L ++    +  L ++ Q +      +
Sbjct: 1150 KKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTE 1209

Query: 792  KLRREFAKLANAF 754
            +  +EF+ +   F
Sbjct: 1210 EALKEFSMMFKHF 1222



 Score =  340 bits (873), Expect = 2e-91
 Identities = 250/940 (26%), Positives = 429/940 (45%), Gaps = 15/940 (1%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 109  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 168

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   +IQ +  ++E +K++  EL+  W         +  KL  +  L
Sbjct: 169  LAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDL 228

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +  +   E+           Q
Sbjct: 229  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQF 288

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 289  GQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWM 348

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAE 6244
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L A  H  + +
Sbjct: 349  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGD 408

Query: 6243 AIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELA 6064
              +++N +    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE
Sbjct: 409  IANRRN-EVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESY 466

Query: 6063 KDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHE 5890
            KD    ++  + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +
Sbjct: 467  KDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQ 526

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L+    E+    ++    Q F    +  + W+++ EA LA+ D G  L SV +L+KK
Sbjct: 527  WQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKK 586

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  ++A E+++  L+  A  L+    +    V E                  R
Sbjct: 587  HQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAK 646

Query: 5529 LKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
            L ES++   F RD D+  SWI E KL  + +D   D T ++   +KH   E EL A+E
Sbjct: 647  LSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPA 706

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +  +  TG+++ D      + I  RL Q    W EL      +G +L E+   QQF  N+
Sbjct: 707  IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 766

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
            E+ EAW++E    VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++
Sbjct: 767  EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 826

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
             + +   I  K + L  + + L     +RK KL E+    Q     +   +WI EKE
Sbjct: 827  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 886

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLA 4636
             + + GRDL  VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A
Sbjct: 887  KTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHA 946

Query: 4635 QLRDNWRILKSKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTD 4483
             L   W  L + +  R+  L ++ Q+H       +L+ A +A A   W    E  +
Sbjct: 947  SLMKRWTQLLANSATRKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPV 1005

Query: 4482 YGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                 +  +AL + H A  S L + +     L +   Q K
Sbjct: 1006 RCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIK 1045



 Score =  281 bits (719), Expect = 2e-73
 Identities = 205/801 (25%), Positives = 359/801 (44%), Gaps = 46/801 (5%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            DI  RR EVL  +   K     KR +L E++  Q F RD DE+  WI EKLQTA +E+++
Sbjct: 408  DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK 467

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEH--IKKRLEELHALW 6841
            DP+N+Q+K QKH+AFEAE+ A+A  I  +   GN++I+    A     +K RL  L   W
Sbjct: 468  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 527

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KL++A K  +F     +  +W+ E E  + +ED G DL  V  L +K
Sbjct: 528  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 587

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 ++  H+ R+ ++N  AD L+     +  Q+ +KRD +N  + ++ ++A +R+  L
Sbjct: 588  QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 647

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +H++ +F RD D+  +WI EK L +SS+DYGRDL  VQ L++KH+  E +LAA E  +
Sbjct: 648  SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 707

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              +     KL++ +    E I Q+       W  LK+ A  R   LE S +  +F+A+
Sbjct: 708  QGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 767

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +WI +   ++ +++    +A  + LL+ H+  + +     D  N   + GQ L++
Sbjct: 768  EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN 827

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
                  +  K++ L+ + S L     +R+   ++      F    +  E+W+ ++E  L
Sbjct: 828  NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 887

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAA-QEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
              D G  L SV+ L+ K E F+  L A Q+E I  +     +L+  +H  +  +
Sbjct: 888  TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHAS 947

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTAR------DDSYLDP 5422
                          R   L E+   Q+  R  +++     +K S         ++   DP
Sbjct: 948  LMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDP 1004

Query: 5421 T------NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
                    I+   + H  F   L + +   + +     QI      +  +    +  +
Sbjct: 1005 VRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEE 1064

Query: 5259 LWNELVDATNKKGAKL-----REAGNE---QQFNRNIEDVEAWLSE-----LEGQVASED 5119
             W  L     ++  +L     R+  N+   Q+F ++      W+ E     L+G    E+
Sbjct: 1065 TWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEE 1124

Query: 5118 YG---KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQ---------------LAQQFQEE 4993
             G     L + +   ++I  + S      D    +++               LAQQ+ +
Sbjct: 1125 SGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 1184

Query: 4992 EHFNAPVIVRKQENLQQRYNA 4930
            +       +R Q NL+Q+  A
Sbjct: 1185 DQLG----MRMQHNLEQQIQA 1201



 Score =  107 bits (268), Expect = 3e-21
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 10/312 (3%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            ++I QR  + + H+   K  +  +  RLEE+ ++Q F  + +E   WI EK+     E++
Sbjct: 726  EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDY 785

Query: 7017 RDP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
             D  + +Q  ++KHEAFE +   H   + ++   G  +I+ N+   E+I  +++ L+
Sbjct: 786  GDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKV 845

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  KL +    L F  + D +  WI EKE  +  +D G DL  V+ L  K
Sbjct: 846  SDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQ 905

Query: 6660 DDFLKELGNHQYR-INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            + F   L   Q   I  I    D+L+   H +   I  +   +   W +L   +ATRK+
Sbjct: 906  ETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKK 965

Query: 6483 LFGAHQVQR--------FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTER 6328
            L  A    R        F + A    +W    +  L+       L  ++AL+  H+
Sbjct: 966  LLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRS 1025

Query: 6327 DLAALEGKMLQL 6292
             L++ +    QL
Sbjct: 1026 SLSSAQADFNQL 1037


>gi|7512790|pir||T14790 hypothetical protein DKFZp564P0562.1 - human
            (fragment)
 gi|5817092|emb|CAB53710.1| hypothetical protein [Homo sapiens]
          Length = 1325

 Score = 1536 bits (3976), Expect = 0.0
 Identities = 769/1328 (57%), Positives = 979/1328 (72%), Gaps = 45/1328 (3%)
 Frame = -1

Query: 4263 DVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPG--TAQQHAQQQVNSIGGKQSEIED 4090
            D+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++P    ++++  ++  SI  +Q +I++
Sbjct: 1    DILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQIDN 60

Query: 4089 KYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQK 3910
            +Y  L+ LGE RK  LE++CK + L REAN+L +WI  +EA    +E+G DLEQVEVLQK
Sbjct: 61   QYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQK 120

Query: 3909 KFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ------------------- 3787
            KFDDF+ DLKANE RL+++N++A  L S G     V+  QQ
Sbjct: 121  KFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASP 180

Query: 3786 ----------------IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQE 3655
                            I++LN RWR+L          LGSAHEVQRFHRD DET++WI+E
Sbjct: 181  WKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEE 240

Query: 3654 KDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIY 3475
            K+ AL+++++G DL SVQALQRKHEG ERDLAALGDK+ SL E A RL QSHPE+AE +
Sbjct: 241  KNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQ 300

Query: 3474 DLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDV 3295
            +   ELN+ W+ L  +A+ RK KL DS+D QRFLSD+RDLM WI  +  LVSS ELA DV
Sbjct: 301  EKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDV 360

Query: 3294 TGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLE 3115
            TGAEALLERHQ +RTEID+RA TFQAF+QFG QLL   HYA+ +I+ +L  +++ R  LE
Sbjct: 361  TGAEALLERHQGHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLE 420

Query: 3114 DAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP--SGDNVESLIKKHEDFD 2941
             AWV RR +LDQCLELQLF+RDCEQA+ WM+AREAFL  ED   S D+VE+LIKKHEDFD
Sbjct: 421  KAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFD 480

Query: 2940 KAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQ 2761
            KAIN QEEKI  L+ FA+ LI   HY    ++ +R+++LDRW  LK  +I+KR KLGESQ
Sbjct: 481  KAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQ 540

Query: 2760 TLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQ 2581
            TLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK QAFEAELHAN+DRI  +I
Sbjct: 541  TLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVID 600

Query: 2580 AGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLE 2401
             GN+LIE   C G E AV ARL AL DQW  LV+ + EKS +LKEANKQ++F   +KD +
Sbjct: 601  MGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFD 660

Query: 2400 FWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQ 2221
            FWL EVE LL SEDYGKDLASV NLLKKH LLEADI AH+DR+ ++N QADSL+ +  F
Sbjct: 661  FWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFD 720

Query: 2220 GQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDD 2041
              Q+ ++R  I  R+  +K MA  RR KL+++  +HQFFRD+DDEESWIKEKKLLV S+D
Sbjct: 721  TSQVKDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSED 780

Query: 2040 YGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDL 1861
            YGRDL GVQNLR+KH+R++ ELA+HEP +  V   G++L   + +  +G+++I++R+
Sbjct: 781  YGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDDNTIGKEEIQQRLAQF 837

Query: 1860 EQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGL 1681
             + W +++ L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S+++G+ +A +QGL
Sbjct: 838  VEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGL 897

Query: 1680 LKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGR 1501
            LKKH+ F+ D  +HK RV D+   G  LI   NHH  +I  +   L  ++ ++E  A  R
Sbjct: 898  LKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQR 957

Query: 1500 LAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAF 1321
             AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF
Sbjct: 958  KAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAF 1017

Query: 1320 EHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQ 1141
            + EGI  IT LKDQL++++H QS AIE RH ++++RW  LLA+S AR+           +
Sbjct: 1018 QQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRK 1077

Query: 1140 IEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFR 961
            +E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF
Sbjct: 1078 VEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFN 1137

Query: 960  QLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRR 781
            QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+
Sbjct: 1138 QLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQ 1197

Query: 780  EFAKLANAFHAWLTNTRQE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEK 619
            EFA+ ANAFH W+  TR        M+E  GTLE QL+A +RK +EI+A + QL++IE+
Sbjct: 1198 EFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDL 1257

Query: 618  GAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREF 439
            GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EF
Sbjct: 1258 GAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEF 1317

Query: 438  SMMFKHFD 415
            SMMFKHFD
Sbjct: 1318 SMMFKHFD 1325



 Score =  674 bits (1738), Expect = 0.0
 Identities = 418/1228 (34%), Positives = 646/1228 (52%), Gaps = 106/1228 (8%)
 Frame = -1

Query: 6801 LQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYR 6622
            L+++ K     R+ +E+  WI EKE  +T+E++G DLE VE+LQ+KFDDF K+L  ++ R
Sbjct: 76   LEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESR 135

Query: 6621 INEINQAADKLVEEG-HSEHDQIYKKRD-------------------------------- 6541
            + +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 136  LKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFN 195

Query: 6540 ---DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLN 6370
               ++N+ W  L  LA  R + L  AH+VQRF+RDADET  WI EK+ AL++D+YG DL
Sbjct: 196  SIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLA 255

Query: 6369 NVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKE 6190
            +VQALQRKHEG ERDLAAL  K+  L + A +L ++HP+ AE + +K  +   AW++L +
Sbjct: 256  SVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGK 315

Query: 6189 KAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKG 6010
            +A  RK  L  S  L RFL+D+RDL+SWI  ++ ++ +DELAKDV GAEALLE HQ H+
Sbjct: 316  RADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQGHRT 375

Query: 6009 EIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMD 5830
            EIDARA +F      GQ+L+  G   SPE+++KL+ LD E++ L   W +RR++ +QC++
Sbjct: 376  EIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLE 435

Query: 5829 LQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDE 5650
            LQLF+RD EQAE WM  +EAFL   D GDSLDSVE LIKKHEDF+K++  QEEKI AL
Sbjct: 436  LQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQA 495

Query: 5649 FATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSW 5470
            FA +LI   HYA  D++                   + + L ES   Q F RD DE+ +W
Sbjct: 496  FADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAW 555

Query: 5469 ITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAA-- 5296
            I+EKL TA D+SY DPTNI+ K QKH  FE EL AN +R+  +   G  +I+ G  A
Sbjct: 556  ISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSE 615

Query: 5295 DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDY 5116
            D +  RL  + + W  LV  + +K  KL+EA  +Q FN  I+D + WLSE+E  +ASEDY
Sbjct: 616  DAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDY 675

Query: 5115 GKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRY 4936
            GKDL SV NL KK  L+E+D +AH DR+  +   A        F+   +  K++ +  R+
Sbjct: 676  GKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRF 735

Query: 4935 NALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQ 4756
              ++     R+ KL ESH+ +Q FRD++DE +WI+EK+ + GS + GRDL GVQNL KK
Sbjct: 736  QKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKH 795

Query: 4755 QALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDL 4576
            + L AE+A H+  I+ V      +         EI+ +LAQ  ++W+ LK  A  R   L
Sbjct: 796  KRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRL 855

Query: 4575 DDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSD-------- 4420
            ++SL+  Q++++  E +AW++EK  +V S DYG    + + LLKKH A  +D
Sbjct: 856  EESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRV 915

Query: 4419 ------------------------LEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLAL 4312
                                    ++   G + DL K A+Q K       +L  +
Sbjct: 916  NDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRK------AKLDENSAFLQ 969

Query: 4311 YDYQEK------SPREVSMKKGD-------VLTLLNASNRDWWKVEVNDRQGFVPAAYVK 4171
            ++++          +E S+K  D       V TLL         ++   ++G      +K
Sbjct: 970  FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK 1029

Query: 4170 RIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQ--------L 4015
              +   A +H Q +  +I  + + +  ++ +L+     RK+KL EA   ++
Sbjct: 1030 --DQLLAAKHVQSK--AIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTF 1085

Query: 4014 LREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATA 3835
             ++A+    W ++ E           LE+++ L++  D F+  L + +    ++ ++
Sbjct: 1086 AKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQ 1145

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGS---------------AHEVQ 3700
            + S  +  +       +E L   WR L         +L                 A
Sbjct: 1146 IKSF-RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN 1204

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
             FH+ + ETR ++   D +   E+ G     ++A +RKH+    ++ A+  ++K +++
Sbjct: 1205 AFHQWIQETRTYL--LDGSCMVEESGTLESQLEATKRKHQ----EIRAMRSQLKKIEDLG 1258

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRL 3436
              + ++     +        L +QW++L
Sbjct: 1259 AAMEEALILDNKYTEHSTVGLAQQWDQL 1286



 Score =  335 bits (860), Expect = 7e-90
 Identities = 246/939 (26%), Positives = 422/939 (44%), Gaps = 14/939 (1%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 211  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 270

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   +IQ +  ++E ++++  EL+  W         +  KL  +  L
Sbjct: 271  LAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDL 330

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +      E+           Q
Sbjct: 331  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQGHRTEIDARAGTFQAFEQF 390

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 391  GQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWM 450

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEA 6241
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L
Sbjct: 451  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGD 510

Query: 6240 IHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAK 6061
            I  + ++    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE  K
Sbjct: 511  ISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYK 569

Query: 6060 DVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHEK 5887
            D    ++  + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +
Sbjct: 570  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 629

Query: 5886 SSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKH 5707
              L+    E+    ++    Q F    +  + W+++ EA LA+ D G  L SV +L+KKH
Sbjct: 630  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 689

Query: 5706 EDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNAL 5527
            +  E  ++A E+++  L+  A  L+    +    V +                  R   L
Sbjct: 690  QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKL 749

Query: 5526 KESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRL 5350
             ES++   F RD D+  SWI E KL    +D   D T ++   +KH   E EL A+E  +
Sbjct: 750  NESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 809

Query: 5349 DDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIE 5170
              +  TG+++ D      + I  RL Q    W EL      +G +L E+   QQF  N+E
Sbjct: 810  QGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 869

Query: 5169 DVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEE 4990
            + EAW++E    VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++
Sbjct: 870  EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN 929

Query: 4989 HFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAG 4810
            + +   I  K + L  + + L     +RK KL E+    Q     +   +WI EKE
Sbjct: 930  NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 989

Query: 4809 STNRGRDLIGVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQ 4633
            + + GRDL  VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A
Sbjct: 990  TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHAS 1049

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTDY 4480
            L   W  L + +  R+  L ++ Q+H       +L+ A +A A   W    E  +
Sbjct: 1050 LMKRWSQLLANSAARKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVR 1108

Query: 4479 GKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                +  +AL + H A  S L + +     L +   Q K
Sbjct: 1109 CNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIK 1147



 Score =  315 bits (808), Expect = 8e-84
 Identities = 288/1299 (22%), Positives = 557/1299 (42%), Gaps = 121/1299 (9%)
 Frame = -1

Query: 5979 QTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQ 5800
            Q+AS    L E G      +  + E++D++  SLL L E+R+ + E+     + +R+  +
Sbjct: 37   QSASRENLLEEQG-----SIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREANE 91

Query: 5799 AETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL----- 5635
             + W+N++EA L + ++G  L+ VE L KK +DF+K L A E ++  +++ A  L
Sbjct: 92   LQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGL 151

Query: 5634 -------IQGQH---YAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKR-------- 5509
                   +Q Q        D  +                    N++KE  +R
Sbjct: 152  MAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA 211

Query: 5508 -------------QTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQEL 5371
                         Q F RD DE   WI EK      D+Y  D  +++   +KH  FE++L
Sbjct: 212  EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 271

Query: 5370 KANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
             A  ++++ +  T E++I S   +A+ + ++  ++N  W+ L    +++ AKL ++ + Q
Sbjct: 272  AALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQ 331

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
            +F  +  D+ +W++ + G V+S++  KD+   + L ++     ++ +A        +Q
Sbjct: 332  RFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQGHRTEIDARAGTFQAFEQFG 391

Query: 5010 QQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIR 4831
            QQ     H+ +P I +K + L Q    L     +R+  L +  +     RD E    W+
Sbjct: 392  QQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMA 451

Query: 4830 EKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEI 4651
             +E    + ++G  L  V+ LIKK +     I   + +I ++ + A+ +I  GH+   +I
Sbjct: 452  AREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDI 511

Query: 4650 RDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKD 4471
              +  ++ D WR LK++  ++R+ L +S    Q+  D +E +AW+SEK        Y KD
Sbjct: 512  SSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESY-KD 570

Query: 4470 EDSAEALLKKHRALLSDLEA----FKGTIE---DLRKQASQCKYQEQPMGQLGRDCVLAL 4312
              + ++  +KH+A  ++L A     +G I+    L ++ +    ++    +L
Sbjct: 571  PTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQ 630

Query: 4311 YDYQEKSPREVSMKKGDVLTLLNASNR--DWWKVEVN-------------------DRQG 4195
            +  Q+ + +   +K+ +     N   +  D+W  EV                     +
Sbjct: 631  FLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQ 690

Query: 4194 FVPA---AYVKRIEPGTAQQHAQQ-----QVNSIGGKQSEIEDKYQRLMMLGETRKRKLE 4039
             + A   A+  R++   +Q  +         + +  K+  I  ++Q++  +  +R+ KL
Sbjct: 691  LLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKLN 750

Query: 4038 EACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQ 3859
            E+ + +Q  R+ +D   WIK ++ +   ++ G DL  V+ L+KK    + +L A+E  +Q
Sbjct: 751  ESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQ 810

Query: 3858 EMNQIATALT---SVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHR 3688
             +      L+   ++G+ E   R+ Q +E     W+ L         +L  + E Q+F
Sbjct: 811  GVLDTGKKLSDDNTIGKEEIQQRLAQFVE----HWKELKQLAAARGQRLEESLEYQQFVA 866

Query: 3687 DVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLR 3508
            +V+E   WI EK   + SED+G  L ++Q L +KHE  E D     D++  +      L
Sbjct: 867  NVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLI 926

Query: 3507 QSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQ 3328
            + +    E I    + LN + + L   A  RK KL ++  + +F      +  WI
Sbjct: 927  KKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKEN 986

Query: 3327 LVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFG--------NQLLNSHHYA 3172
             + + +   D++  + LL + + +        A  QAF Q G        +QLL + H
Sbjct: 987  SLKTDDYGRDLSSVQTLLTKQETF-------DAGLQAFQQEGIANITALKDQLLAAKHVQ 1039

Query: 3171 AGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQA-----------DTWM 3025
            +  IE R   + +    L     AR+  L   LE Q  +R  E             ++W
Sbjct: 1040 SKAIEARHASLMKRWSQLLANSAARKKKL---LEAQSHFRKVEDLFLTFAKKASAFNSWF 1096

Query: 3024 SAREAFLAQEDP----SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDS 2857
               E  L   DP    S + +++L + H+ F  ++++ +     L      +       +
Sbjct: 1097 ENAEEDLT--DPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASN 1154

Query: 2856 PAVTRKRDQILDRWNGLKEALIQKRFKLGESQ--------TLQQFSRDADEIENWMTEKF 2701
            P      + + + W  L++ + ++  +L + Q          Q+F++ A+    W+ E
Sbjct: 1155 PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETR 1214

Query: 2700 QIAQE-----------ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQA---GNNLI 2563
                +           E+  + T  ++KHQ+ +A  ++L    D  AA+ +A    N
Sbjct: 1215 TYLLDGSCMVEESGTLESQLEAT--KRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYT 1272

Query: 2562 ENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKE 2446
            E++  G            L  QWD L +      + L++
Sbjct: 1273 EHSTVG------------LAQQWDQLDQLGMRMQHNLEQ 1299



 Score =  280 bits (717), Expect = 3e-73
 Identities = 205/801 (25%), Positives = 358/801 (44%), Gaps = 46/801 (5%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            DI  RR EVL  +   K     KR +L E++  Q F RD DE+  WI EKLQTA +E+++
Sbjct: 510  DISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK 569

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEH--IKKRLEELHALW 6841
            DP+N+Q+K QKH+AFEAE+ A+A  I  +   GN++I+    A     +K RL  L   W
Sbjct: 570  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 629

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KL++A K  +F     +  +W+ E E  + +ED G DL  V  L +K
Sbjct: 630  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 689

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 ++  H+ R+ ++N  AD L+     +  Q+  KRD +N  + ++ ++AA+R+  L
Sbjct: 690  QLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRDTINGRFQKIKSMAASRRAKL 749

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +H++ +F RD D+  +WI EK L + S+DYGRDL  VQ L++KH+  E +LAA E  +
Sbjct: 750  NESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 809

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              +     KL++ +    E I Q+       W  LK+ A  R   LE S +  +F+A+
Sbjct: 810  QGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 869

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +WI +   ++ +++    +A  + LL+ H+  + +     D  N   + GQ L++
Sbjct: 870  EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKN 929

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
                  +  K++ L+ + S L     +R+   ++      F    +  E+W+ ++E  L
Sbjct: 930  NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 989

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAA-QEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
              D G  L SV+ L+ K E F+  L A Q+E I  +     +L+  +H  +  +
Sbjct: 990  TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHAS 1049

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTAR------DDSYLDP 5422
                          R   L E+   Q+  R  +++     +K S         ++   DP
Sbjct: 1050 LMKRWSQLLANSAARKKKLLEA---QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDP 1106

Query: 5421 T------NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
                    I+   + H  F   L + +   + +     QI      +  +    +  +
Sbjct: 1107 VRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEE 1166

Query: 5259 LWNELVDATNKKGAKL-----REAGNE---QQFNRNIEDVEAWLSE-----LEGQVASED 5119
             W  L     ++  +L     R+  N+   Q+F ++      W+ E     L+G    E+
Sbjct: 1167 TWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEE 1226

Query: 5118 YG---KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQ---------------LAQQFQEE 4993
             G     L + +   ++I  + S      D    +++               LAQQ+ +
Sbjct: 1227 SGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 1286

Query: 4992 EHFNAPVIVRKQENLQQRYNA 4930
            +       +R Q NL+Q+  A
Sbjct: 1287 DQLG----MRMQHNLEQQIQA 1303



 Score =  106 bits (264), Expect = 1e-20
 Identities = 77/312 (24%), Positives = 135/312 (42%), Gaps = 10/312 (3%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            ++I QR  + + H+   K  +  +  RLEE+ ++Q F  + +E   WI EK+     E++
Sbjct: 828  EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDY 887

Query: 7017 RDP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
             D  + +Q  ++KHEAFE +   H   + ++   G  +I+ N+   E+I  +++ L+
Sbjct: 888  GDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKV 947

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  KL +    L F  + D +  WI EKE  +  +D G DL  V+ L  K
Sbjct: 948  SDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQ 1007

Query: 6660 DDFLKELGNHQYR-INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            + F   L   Q   I  I    D+L+   H +   I  +   +   W +L   +A RK+
Sbjct: 1008 ETFDAGLQAFQQEGIANITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKK 1067

Query: 6483 LFGAHQVQR--------FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTER 6328
            L  A    R        F + A    +W    +  L+       L  ++AL+  H+
Sbjct: 1068 LLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRS 1127

Query: 6327 DLAALEGKMLQL 6292
             L++ +    QL
Sbjct: 1128 SLSSAQADFNQL 1139


>gi|92758|pir||A32612 spectrin alpha chain, nonerythroid - rat
            (fragment)
 gi|203014|gb|AAA40770.1| nonerythroid alpha-spectrin
          Length = 1030

 Score = 1220 bits (3156), Expect = 0.0
 Identities = 608/1021 (59%), Positives = 764/1021 (74%), Gaps = 8/1021 (0%)
 Frame = -1

Query: 3534 LDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDL 3355
            L E A RL QSHPE+AE + +   ELN+ W  L  +A  RK KL DS+D QRFLSD+RDL
Sbjct: 1    LGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDL 60

Query: 3354 MQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHY 3175
            M WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL   HY
Sbjct: 61   MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHY 120

Query: 3174 AAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQE 2995
            A+ +I+ +L  +++ R  LE AWV RR +LD CLELQLF+RDCEQA+ WM+AREAFL  E
Sbjct: 121  ASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTE 180

Query: 2994 DP--SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILD 2821
            D   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI  +HY    +  +R+++LD
Sbjct: 181  DKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLD 240

Query: 2820 RWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQK 2641
            RW  LK  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK
Sbjct: 241  RWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQK 300

Query: 2640 QQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
             QAFEAELHAN+DRI  +I  GN+LIE   C G E AV ARL AL DQW  LV+ + EKS
Sbjct: 301  HQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKS 360

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             +LKEANKQ++F   +KD +FWL EVE LL SEDYGKDLASV NLLKKH  LEADI AH+
Sbjct: 361  QKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADISAHE 420

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
            DR+ ++N QADSL+ +  F   Q+ E+R  I  R+  +K MAT RR KLS++  +HQFFR
Sbjct: 421  DRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFR 480

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D+DDEESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V   G++L
Sbjct: 481  DMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL- 539

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
              + +  +G+++I++R+    + W +++ L   R QRL+ES  +Q F+ +VEEEEAW+NE
Sbjct: 540  --SDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINE 597

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            K  ++ S+++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G  LI   NHH  +I
Sbjct: 598  KMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENIS 657

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
             +   L  ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDL
Sbjct: 658  SKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDL 717

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
            SSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH ++++RW  L
Sbjct: 718  SSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQL 777

Query: 1200 LAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRA 1021
            LA+S  R+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+A
Sbjct: 778  LANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKA 837

Query: 1020 LRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKE 841
            LR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKE
Sbjct: 838  LREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKE 897

Query: 840  REQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGTLEEQLDAV 679
            RE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GTLE QL+A
Sbjct: 898  RELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEAT 957

Query: 678  ERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNL 499
            +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNL
Sbjct: 958  KRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNL 1017

Query: 498  E 496
            E
Sbjct: 1018 E 1018



 Score =  531 bits (1368), Expect = e-149
 Identities = 336/1023 (32%), Positives = 525/1023 (50%), Gaps = 70/1023 (6%)
 Frame = -1

Query: 6294 LEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDL 6115
            L + A +L ++HP+ AE + +K  +   AW +L ++A  RK  L  S  L RFL+D+RDL
Sbjct: 1    LGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDL 60

Query: 6114 ISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIP 5935
            +SWI  ++ ++ +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G
Sbjct: 61   MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHY 120

Query: 5934 ESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANT 5755
             SPE++EKL+ LD E++ L   W +RR++ + C++LQLF+RD EQAE WM  +EAFL
Sbjct: 121  ASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTE 180

Query: 5754 DLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXX 5575
            D GDSLDSVE LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D+A
Sbjct: 181  DKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLD 240

Query: 5574 XXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQK 5395
                       + + L ES   Q F RD DE+ +WI+EKL TA D+SY DPTNI+ K QK
Sbjct: 241  RWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQK 300

Query: 5394 HINFEQELKANENRLDDIRSTGEQIIDSGHFAA--DHIGDRLRQVNNLWNELVDATNKKG 5221
            H  FE EL AN +R+  +   G  +I+ G  A   D +  RL  + + W  LV  + +K
Sbjct: 301  HQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKS 360

Query: 5220 AKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHN 5041
             KL+EA  +Q FN  I+D + WLSE+E  +ASEDYGKDL SV NL KK   +E+D +AH
Sbjct: 361  QKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADISAHE 420

Query: 5040 DRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFR 4861
            DR+  +   A        F+   +  K++ +  R+  ++     R+ KL ESH+ +Q FR
Sbjct: 421  DRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFR 480

Query: 4860 DIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMI 4681
            D++DE +WI+EK+ +  S + GRDL GVQNL KK + L AE+A H+  I+ V      +
Sbjct: 481  DMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLS 540

Query: 4680 QQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEP 4501
                    EI+ +LAQ  ++W+ LK  A  R   L++SL+  Q++++  E +AW++EK
Sbjct: 541  DDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMT 600

Query: 4500 IVGSTDYGKDEDSAEALLKKHRALLSD--------------------------------L 4417
            +V S DYG    + + LLKKH A  +D                                +
Sbjct: 601  LVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKM 660

Query: 4416 EAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEK------SPREVSMKKGD-- 4261
            +   G + DL K A+Q K       +L  +     ++++          +E S+K  D
Sbjct: 661  KGLNGKVSDLEKAAAQRK------AKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYG 714

Query: 4260 -----VLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEI 4096
                 V TLL         ++   ++G      +K  +   A +H Q +  +I  + + +
Sbjct: 715  RDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK--DQLLAAKHIQSK--AIEARHASL 770

Query: 4095 EDKYQRLMMLGETRKRKLEEACKGYQ--------LLREANDLAEWIKSREAVAAQQEIGT 3940
              ++ +L+    TRK+KL EA   ++          ++A+    W ++ E
Sbjct: 771  MKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCN 830

Query: 3939 DLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWR 3760
             LE+++ L++  D F+  L + +    ++ ++   + S  +  +       +E L   WR
Sbjct: 831  SLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF-RVASNPYTWFTMEALEETWR 889

Query: 3759 ALXXXXXXXXXQLGS---------------AHEVQRFHRDVDETRDWIQEKDDALDSEDF 3625
             L         +L                 A     FH+ + ETR ++   D +   E+
Sbjct: 890  NLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYL--LDGSCMVEES 947

Query: 3624 GRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQW 3445
            G     ++A +RKH+    ++ A+  ++K +++    + ++     +        L +QW
Sbjct: 948  GTLESQLEATKRKHQ----EIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQW 1003

Query: 3444 NRL 3436
            ++L
Sbjct: 1004 DQL 1006



 Score =  362 bits (928), Expect = 1e-97
 Identities = 243/1026 (23%), Positives = 481/1026 (46%), Gaps = 20/1026 (1%)
 Frame = -1

Query: 3813 ETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDS 3634
            E+A  ++++  +LN  W +L         +LG +H++QRF  D  +   WI      + S
Sbjct: 14   ESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSS 73

Query: 3633 EDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELN 3454
            ++  +D+   +AL  +H+    ++ A     ++ ++   +L      A+ +I +    L+
Sbjct: 74   DELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILD 133

Query: 3453 EQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALL 3274
            ++   L      R+  L    + Q F  D      W+A+    +++++  + +   EAL+
Sbjct: 134  QERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALI 193

Query: 3273 ERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARR 3094
            ++H+++   I+ +     A   F +QL+   HYA GDI NR   V +  + L+   + +R
Sbjct: 194  KKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKR 253

Query: 3093 NILDQCLELQLFYRDCEQADTWMSAREAFLAQE---DPSGDNVESLIKKHEDFDKAINTQ 2923
            + L +   LQ F RD ++ + W+S +    + E   DP+  N++S  +KH+ F+  ++
Sbjct: 254  SKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT--NIQSKHQKHQAFEAELHAN 311

Query: 2922 EEKIKGLKLFAESLIKNNHY--DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQ 2749
             ++I+G+     SLI+         AV  +   + D+W  L +   +K  KL E+   Q
Sbjct: 312  ADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQN 371

Query: 2748 FSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGN 2572
            F+    + + W++E   +   E+Y +D  ++    +K QA EA++ A+ DR+  +    +
Sbjct: 372  FNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADISAHEDRLKDLNSQAD 431

Query: 2571 NLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWL 2392
            +L+ ++     +  V  +   +N ++  +    T +  +L E+++   F   + D E W+
Sbjct: 432  SLMTSSAFDTSQ--VKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWI 489

Query: 2391 GEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQ 2212
             E ++L+ SEDYG+DL  V+NL KKH  LEA++ AH+  +  + +    L +++    ++
Sbjct: 490  KEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEE 549

Query: 2211 IAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGR 2032
            I +R     + +  +K++A  R  +L ++L   QF  ++++EE+WI EK  LV+S+DYG
Sbjct: 550  IQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGD 609

Query: 2031 DLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQS 1852
             L  +Q L +KH   +T+   H+ +V+ V   G++L++   +    E+ I  +M+ L
Sbjct: 610  TLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIK---KNNHHEENISSKMKGLNGK 666

Query: 1851 WGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKK 1672
               +      R  +LDE+ AF  F    +  E+W+ EK+  L +D++G +++ VQ LL K
Sbjct: 667  VSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTK 726

Query: 1671 HDTFQVDLELHKQR-VADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLA 1495
             +TF   L+  +Q  +A++    D L+   +  +  I+ R   L  R  ++ + +  R
Sbjct: 727  QETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKK 786

Query: 1494 KLRD--------NSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFD 1339
            KL +           +L F  K     SW    E+ +        L  ++ L    +AF
Sbjct: 787  KLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFR 846

Query: 1338 AGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXX 1159
            + L++ + +   ++ EL  Q+ S     +P        + + W+NL    + R
Sbjct: 847  SSLSSAQAD-FNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKE 905

Query: 1158 XXXXXQIEELYLAFAKKASTFNSWFENAEEDLTD----PVRCNSLE-EIRALRDAHGEFQ 994
                 + ++L   FA+ A+ F+ W +     L D         +LE ++ A +  H E
Sbjct: 906  QRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQE-- 963

Query: 993  RSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREH 814
              + +     ++++DL   ++   +  N YT  +   L   W  L ++    +  L
Sbjct: 964  --IRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEHAD 1021

Query: 813  QRQEEN 796
              QE N
Sbjct: 1022 PGQEHN 1027



 Score =  330 bits (847), Expect = 2e-88
 Identities = 246/1007 (24%), Positives = 455/1007 (44%), Gaps = 35/1007 (3%)
 Frame = -1

Query: 7206 ETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILE-KLQTAQ 7030
            E+A+D+ ++  E+   ++     +  ++ +L ++   Q F  D  +L  WI   +   +
Sbjct: 14   ESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSS 73

Query: 7029 EENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELH 6850
            +E  +D +  +A +++H+    E+ A A T    ++ G  ++ H H+AS  IK++L+ L
Sbjct: 74   DELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILD 133

Query: 6849 ALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQ 6670
                        + + L   L+L  F R C++   W+  +E ++  ED G  L+ VE L
Sbjct: 134  QERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALI 193

Query: 6669 RKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRK 6490
            +K +DF K +   + +I  +   AD+L+   H     I  +R++V D W RL      ++
Sbjct: 194  KKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLDRWRRLKAQMIEKR 253

Query: 6489 EGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALE 6310
              L  +  +Q+F+RD DE  AWI EK L  +SD+  +D  N+Q+  +KH+  E +L A
Sbjct: 254  SKLGESQTLQQFSRDVDEIEAWISEK-LQTASDESYKDPTNIQSKHQKHQAFEAELHANA 312

Query: 6309 GKMLQLEKEAHKLAE--THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
             ++  +    + L E        +A+  +       W  L +K+  +   L+ + +   F
Sbjct: 313  DRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNF 372

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
                +D   W+ +++A++ +++  KD+A    LL+ HQ  + +I A  D      S
Sbjct: 373  NTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADISAHEDRLKDLNSQADS 432

Query: 5955 LVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            L+     ++ +V+EK + ++     +  +   RR    +   L  F+RD +  E+W+ ++
Sbjct: 433  LMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEK 492

Query: 5775 EAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
            +  +++ D G  L  V++L KKH+  E  LAA E  I  + +   KL        +++ +
Sbjct: 493  KLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQ 552

Query: 5595 XXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDP-T 5419
                              RG  L+ES + Q F  + +E  +WI EK++    + Y D
Sbjct: 553  RLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLA 612

Query: 5418 NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVD 5239
             I+G L+KH  FE +   +++R++D+ + G+ +I   +   ++I  +++ +N   ++L
Sbjct: 613  AIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEK 672

Query: 5238 ATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIES 5059
            A  ++ AKL E     QFN   + VE+W+ E E  + ++DYG+DL SVQ L  K    ++
Sbjct: 673  AAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDA 732

Query: 5058 DFNA-HNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESH 4882
               A   + +  I  L  Q    +H  +  I  +  +L +R+  L      RK+KL E+
Sbjct: 733  GLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQ 792

Query: 4881 QGNQLFRDIEDEL-----------AWIREKEQVAGSTNRGRDLIGVQNL----------I 4765
                 FR +ED             +W    E+      R   L  ++ L          +
Sbjct: 793  SH---FRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSL 849

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKS------ 4603
               QA   ++A  D QI+S   A+N          P     +  L + WR L+
Sbjct: 850  SSAQADFNQLAELDRQIKSFRVASN----------PYTWFTMEALEETWRNLQKIIKERE 899

Query: 4602 ---KAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRA 4432
               + E+RR + +D L+  ++   AN    W+ E      +  Y  D      ++++
Sbjct: 900  LELQKEQRRQEENDKLR-QEFAQHANAFHQWIQE------TRTYLLD---GSCMVEESGT 949

Query: 4431 LLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKS 4291
            L S LEA K   +++R   SQ K  E  +G    + ++    Y E S
Sbjct: 950  LESQLEATKRKHQEIRAMRSQLKKIED-LGAAMEEALILDNKYTEHS 995



 Score =  302 bits (773), Expect = 9e-80
 Identities = 226/870 (25%), Positives = 391/870 (43%), Gaps = 14/870 (1%)
 Frame = -1

Query: 6930 LDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEI 6751
            L +T   +IQ +  ++E +K++  EL+  W         +  KL  +  L  F+    ++
Sbjct: 1    LGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDL 60

Query: 6750 LYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHS 6571
            + WI      V+++++  D+   E L  +  +   E+           Q   +L+  GH
Sbjct: 61   MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHY 120

Query: 6570 EHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSD 6391
               +I +K D ++     L      R+  L    ++Q F+RD ++   W+  ++  L+++
Sbjct: 121  ASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTE 180

Query: 6390 DYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAEAIHQKNDDTK 6214
            D G  L++V+AL +KHE  ++ +   E K+  L+  A +L A  H  + +  +++N +
Sbjct: 181  DKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRN-EVL 239

Query: 6213 AAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALL 6034
              W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE  KD    ++
Sbjct: 240  DRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKH 298

Query: 6033 ESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHEKSSLLGLWEE 5860
            + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +   L+    E
Sbjct: 299  QKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAE 358

Query: 5859 RRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAA 5680
            +    ++    Q F    +  + W+++ EA LA+ D G  L SV +L+KKH+  E  ++A
Sbjct: 359  KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADISA 418

Query: 5679 QEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTF 5500
             E+++  L+  A  L+    +    V E                  R   L ES++   F
Sbjct: 419  HEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQF 478

Query: 5499 DRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQ 5323
             RD D+  SWI E KL  + +D   D T ++   +KH   E EL A+E  +  +  TG++
Sbjct: 479  FRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKK 538

Query: 5322 IIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSEL 5143
            + D      + I  RL Q    W EL      +G +L E+   QQF  N+E+ EAW++E
Sbjct: 539  LSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEK 598

Query: 5142 EGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVR 4963
               VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++ + +   I
Sbjct: 599  MTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISS 658

Query: 4962 KQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLI 4783
            K + L  + + L     +RK KL E+    Q     +   +WI EKE    + + GRDL
Sbjct: 659  KMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLS 718

Query: 4782 GVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILK 4606
             VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A L   W  L
Sbjct: 719  SVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLL 778

Query: 4605 SKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTDYGKDEDSAEA 4453
            + +  R+  L ++ Q+H       +L+ A +A A   W    E  +         +  +A
Sbjct: 779  ANSATRKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKA 837

Query: 4452 LLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
            L + H A  S L + +     L +   Q K
Sbjct: 838  LREAHDAFRSSLSSAQADFNQLAELDRQIK 867



 Score =  266 bits (680), Expect = 6e-69
 Identities = 240/1043 (23%), Positives = 462/1043 (44%), Gaps = 69/1043 (6%)
 Frame = -1

Query: 4707 VSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEA 4528
            +   A  +IQ     A ++++K  +L   W  L  +A +R+  L DS    ++LSD  +
Sbjct: 1    LGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDL 60

Query: 4527 DAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC------ 4366
             +W++    +V S +  KD   AEALL++H+   ++++A  GT +   +   Q
Sbjct: 61   MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHY 120

Query: 4365 --------------------KYQEQPMGQLGRDCVLALYDYQ-EKSPREVSMKKGDVLTL 4249
                                K   Q    L     L L+    E++   ++ ++  + T
Sbjct: 121  ASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTE 180

Query: 4248 LNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQV-------NSIGGKQSEIED 4090
                + D  +  +   + F  A  V+  +    Q  A Q +         I  +++E+ D
Sbjct: 181  DKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNEVLD 240

Query: 4089 KYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQK 3910
            +++RL      ++ KL E+    Q  R+ +++  WI S +   A  E   D   ++   +
Sbjct: 241  RWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWI-SEKLQTASDESYKDPTNIQSKHQ 299

Query: 3909 KFDDFKGDLKANEVRLQEMNQIATALTSVGQ---TETAVRIRQQIEDLNARWRALXXXXX 3739
            K   F+ +L AN  R++ +  +  +L   G    +E AV+ R  +  L  +W+ L
Sbjct: 300  KHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKAR--LAALADQWQFLVQKSA 357

Query: 3738 XXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLA 3559
                +L  A++ Q F+  + +   W+ E +  L SED+G+DL SV  L +KH+ +E D++
Sbjct: 358  EKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQALEADIS 417

Query: 3558 ALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQR 3379
            A  D++K L+ +A+ L  S      Q+ + +  +N ++ ++ S A +R+ KL +S+   +
Sbjct: 418  AHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQ 477

Query: 3378 FLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGN 3199
            F  D  D   WI     LVSS++   D+TG + L ++H+    E+ +     Q     G
Sbjct: 478  FFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGK 537

Query: 3198 QLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSA 3019
            +L + +     +I+ RL    E  K L+    AR   L++ LE Q F  + E+ + W++
Sbjct: 538  KLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINE 597

Query: 3018 REAFLAQEDPSGDN---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAV 2848
            +   +A ED  GD    ++ L+KKHE F+      ++++  +    + LIK N++    +
Sbjct: 598  KMTLVASED-YGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENI 656

Query: 2847 TRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RD 2671
            + K   +  + + L++A  Q++ KL E+    QF+  AD +E+W+ EK    + ++Y RD
Sbjct: 657  SSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRD 716

Query: 2670 PTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWD 2491
             +++Q    KQ+ F+A L A      A I A  + +  AK    + A+ AR  +L  +W
Sbjct: 717  LSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSK-AIEARHASLMKRWT 775

Query: 2490 LLVKTTTEKSYRLKEANKQ--------KSFMAAVKDLEFWLGEVEILLQSEDYGKDLASV 2335
             L+  +  +  +L EA            +F         W    E  L        L  +
Sbjct: 776  QLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI 835

Query: 2334 ENLLKKHSLLEADIVAHQ---DRVGEMNEQADSL--------------LENDQFQGQQIA 2206
            + L + H    + + + Q   +++ E++ Q  S               LE      Q+I
Sbjct: 836  KALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKII 895

Query: 2205 ERRKLIADRYDGVKKMATDRRDKLSK--ALNVHQFFRDIDDEESWIKEKKLLVSSDDYGR 2032
            + R+L   +    ++   +  DKL +  A + + F + I +  +++ +   +V  ++ G
Sbjct: 896  KERELELQK----EQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMV--EESGT 949

Query: 2031 DLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRME-DLEQ 1855
                ++  +RKH+    E+ +   Q+     K E+L  +  EA + +++  +     L Q
Sbjct: 950  LESQLEATKRKHQ----EIRAMRSQLK----KIEDLGAAMEEALILDNKYTEHSTVGLAQ 1001

Query: 1854 SWGQIRDLTGNRHQRLDESEAFQ 1786
             W Q+  L       L+ ++  Q
Sbjct: 1002 QWDQLDQLGMRMQHNLEHADPGQ 1024



 Score =  263 bits (671), Expect = 6e-68
 Identities = 214/907 (23%), Positives = 403/907 (43%), Gaps = 37/907 (4%)
 Frame = -1

Query: 4152 AQQHAQQQVNSIGGKQSEIEDKY-QRLMMLGETRKRKLEEACKGYQLL-REANDLAEWIK 3979
            A    +++++ +  +++++E  + QR MML         + C   QL  R+      W+
Sbjct: 121  ASPEIKEKLDILDQERTDLEKAWVQRRMML---------DHCLELQLFHRDCEQAENWMA 171

Query: 3978 SREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVR 3799
            +REA    ++ G  L+ VE L KK +DF   +   E ++  +   A  L +V
Sbjct: 172  AREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDI 231

Query: 3798 IRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGR 3619
              ++ E L+ RWR L         +LG +  +Q+F RDVDE   WI EK      E + +
Sbjct: 232  ANRRNEVLD-RWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESY-K 289

Query: 3618 DLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRL--RQSHPEAAEQIYDLQRELNEQW 3445
            D  ++Q+  +KH+  E +L A  D+I+ + +  N L  R +   + + +      L +QW
Sbjct: 290  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 349

Query: 3444 NRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERH 3265
              L  K+  + +KL ++   Q F +  +D   W++ +  L++S++   D+     LL++H
Sbjct: 350  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKH 409

Query: 3264 QEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNIL 3085
            Q    +I +     +  +   + L+ S  +    ++ +   +N   + ++    +RR  L
Sbjct: 410  QALEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 469

Query: 3084 DQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKI 2911
             +   L  F+RD +  ++W+  ++  ++ ED   D   V++L KKH+  +  +   E  I
Sbjct: 470  SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 529

Query: 2910 KGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDAD 2731
            +G+    + L  +N      + ++  Q ++ W  LK+    +  +L ES   QQF  + +
Sbjct: 530  QGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVE 589

Query: 2730 EIENWMTEKFQIAQEENYRDP-TNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENA 2554
            E E W+ EK  +   E+Y D    IQ   +K +AFE +   + DR+  +   G +LI+
Sbjct: 590  EEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIK-- 647

Query: 2553 KCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEIL 2374
            K    E  +S+++K LN +   L K   ++  +L E +    F      +E W+GE E
Sbjct: 648  KNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENS 707

Query: 2373 LQSEDYGKDLASVENLLKKHSLLEADIVA-HQDRVGEMNEQADSLLENDQFQGQQIAERR 2197
            L+++DYG+DL+SV+ LL K    +A + A  Q+ +  +    D LL     Q + I  R
Sbjct: 708  LKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARH 767

Query: 2196 KLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDD-----------EESWIKEKKLLVS 2050
              +  R+  +   +  R+ KL   L     FR ++D             SW +  +  ++
Sbjct: 768  ASLMKRWTQLLANSATRKKKL---LEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLT 824

Query: 2049 SDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIK-KR 1873
                   L  ++ LR  H    + L+S +   + +     EL R      V  +
Sbjct: 825  DPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL----AELDRQIKSFRVASNPYTWFT 880

Query: 1872 MEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEA--------WMNEKQQIL--G 1723
            ME LE++W  ++ +   R   L + +  Q     + +E A        W+ E +  L  G
Sbjct: 881  MEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDG 940

Query: 1722 S---DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPH----I 1564
            S   +  G   + ++   +KH   +  +    +++ DL    +  +   N +  H    +
Sbjct: 941  SCMVEESGTLESQLEATKRKHQEIRA-MRSQLKKIEDLGAAMEEALILDNKYTEHSTVGL 999

Query: 1563 KQRCDQL 1543
             Q+ DQL
Sbjct: 1000 AQQWDQL 1006



 Score =  140 bits (354), Expect = 4e-31
 Identities = 119/603 (19%), Positives = 252/603 (41%), Gaps = 9/603 (1%)
 Frame = -1

Query: 2265 MNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDE 2086
            + E A  L+++     + + E+   +   +  + K A  R+ KL  + ++ +F  D  D
Sbjct: 1    LGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRAYQRKAKLGDSHDLQRFLSDFRDL 60

Query: 2085 ESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAE 1906
             SWI   + LVSSD+  +D+ G + L  +H+   TE+ +        +  G++LL   A
Sbjct: 61   MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLL---AH 117

Query: 1905 AGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQIL 1726
                  +IK++++ L+Q    +      R   LD     Q F  D E+ E WM  ++  L
Sbjct: 118  GHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFL 177

Query: 1725 GSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQ 1546
             +++ G+++  V+ L+KKH+ F   + + ++++A L    D LI   ++    I  R ++
Sbjct: 178  NTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAVDHYAKGDIANRRNE 237

Query: 1545 LRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
            +  R   +++    + +KL ++    QF    D +E+WI+EK Q    E + +D +++Q
Sbjct: 238  VLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESY-KDPTNIQS 296

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEH--QQSPAIEKRHTNVIQRWQNLLAH 1192
               K +AF+A L+A   + I+ + ++ + L+          A++ R   +  +WQ L+
Sbjct: 297  KHQKHQAFEAELHA-NADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQK 355

Query: 1191 SEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRD 1012
            S  +                    F      F+ W    E  L        L  +  L
Sbjct: 356  SAEKSQKLKEANKQQN--------FNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLK 407

Query: 1011 AHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQ 832
             H   +  +S+ E+  + L      + + +           D +   ++ ++ +   R
Sbjct: 408  KHQALEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRA 467

Query: 831  ELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAK---- 664
            +L+  H+  +        F +  +   +W+    ++++ +       L  V+   K
Sbjct: 468  KLSESHRLHQ--------FFRDMDDEESWIKE--KKLLVSSEDYGRDLTGVQNLRKKHKR 517

Query: 663  ---EIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQ 493
               E+ A++  ++ + + G  L  +  +     +       + W +L QLA      LE+
Sbjct: 518  LEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEE 577

Query: 492  QIQ 484
             ++
Sbjct: 578  SLE 580


>gi|17862818|gb|AAL39886.1| LP06350p [Drosophila melanogaster]
          Length = 856

 Score = 1115 bits (2884), Expect = 0.0
 Identities = 545/858 (63%), Positives = 677/858 (78%)
 Frame = -1

Query: 2577 GNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEF 2398
            G NLI+  +C G E AV  RL  + DQW+ L   TTEKS +LKEANKQ++++AAVKDL+F
Sbjct: 2    GGNLIDKKQCSGSEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDF 61

Query: 2397 WLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQG 2218
            WLGEVE LL +ED GKDLASV+NL+KKH L+EADIVAH+DR+ +MN QADSL+E+ QF
Sbjct: 62   WLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDT 121

Query: 2217 QQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDY 2038
              I E+R+ I +RY+ +  +A  R+ +L++AL +HQFFRDI DEESWIKEKKLLV SDDY
Sbjct: 122  AGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDY 181

Query: 2037 GRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLE 1858
            GRDL GVQNL++KH+R++ EL SHEP +  V+  GE+L+  +    +G  +I++R++ L
Sbjct: 182  GRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVS---NLGVPEIEQRLKALN 238

Query: 1857 QSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLL 1678
            Q+W ++++L   R Q+LDES  +Q FL  VEEEEAW+ EKQQ+L  +++G++MA VQGLL
Sbjct: 239  QAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLL 298

Query: 1677 KKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRL 1498
            KKHD F+ D   HK R + + ++G  L+   NHH   I QRC QLR +L  + ++A  R
Sbjct: 299  KKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRK 358

Query: 1497 AKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFE 1318
              L DNSAYLQFMWK DVVESWI +KE  VRS++FGRDLS+VQ LLTKQE FDAGLNAFE
Sbjct: 359  GALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFE 418

Query: 1317 HEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQI 1138
             EGI  IT LKDQL+++ H QSPAI KRH +VI RWQ L   S  R+           QI
Sbjct: 419  QEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQI 478

Query: 1137 EELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQ 958
            EELYL FAKKAS FNSWFENAEEDLTDPVRCNS+EEIRALRDAH +FQ SLSSAE DF+
Sbjct: 479  EELYLTFAKKASAFNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKA 538

Query: 957  LQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRRE 778
            L  LD++IKSFNVGPNPYTWFTM+ALE+TWRNLQ+II+ER+ ELA+E +RQEENDKLR+E
Sbjct: 539  LAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKE 598

Query: 777  FAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERN 598
            FAK AN FH WLT TR  MME  G+LE+QL+A+  KA E++A +  L++IEE GA+LE +
Sbjct: 599  FAKHANLFHQWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEH 658

Query: 597  LILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHF 418
            LILDNRYTEHSTVG+AQ WDQLDQL+MRMQHNLEQQIQARN SGVSE++L+EFSMMFKHF
Sbjct: 659  LILDNRYTEHSTVGLAQQWDQLDQLSMRMQHNLEQQIQARNHSGVSEDSLKEFSMMFKHF 718

Query: 417  DKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFM 238
            DK+K+G+L+HQ+FKSCLRALGYDLPMV+EGQP+PEF+ ILD+VDPNRDGYV+LQEY+AFM
Sbjct: 719  DKDKSGKLNHQEFKSCLRALGYDLPMVEEGQPDPEFEAILDVVDPNRDGYVSLQEYIAFM 778

Query: 237  ISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGR 58
            ISKETEN+QS EEIE AFRA++   RPYVT EELY NLT + A++C++RMKP+ +  SG+
Sbjct: 779  ISKETENVQSYEEIENAFRAITAADRPYVTKEELYCNLTKDMADYCVQRMKPFSEPRSGQ 838

Query: 57   SIQGGLDYEQFVHALFQS 4
             I+  LDY  F   LFQ+
Sbjct: 839  PIKDALDYIDFTRTLFQN 856



 Score =  214 bits (545), Expect = 3e-53
 Identities = 113/309 (36%), Positives = 174/309 (55%)
 Frame = -1

Query: 5295 DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDY 5116
            D +  RL Q+ + W  L   T +K  KL+EA  ++ +   ++D++ WL E+E  + +ED
Sbjct: 16   DAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDS 75

Query: 5115 GKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRY 4936
            GKDL SVQNL KK  L+E+D  AH DR+  +   A    E   F+   I  K++++ +RY
Sbjct: 76   GKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERY 135

Query: 4935 NALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQ 4756
              + +    R+ +L E+   +Q FRDI DE +WI+EK+ + GS + GRDL GVQNL KK
Sbjct: 136  ERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKH 195

Query: 4755 QALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDL 4576
            + L AE+ +H+  I++V  A   ++   +   PEI  +L  L   W  LK+ A  R   L
Sbjct: 196  KRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQKL 255

Query: 4575 DDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTI 4396
            D+SL   Q+L+   E +AW++EK+ ++   DYG    + + LLKKH A  +D  A K
Sbjct: 256  DESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRC 315

Query: 4395 EDLRKQASQ 4369
              +  Q S+
Sbjct: 316  SLICDQGSE 324



 Score =  192 bits (488), Expect = 1e-46
 Identities = 161/694 (23%), Positives = 298/694 (42%), Gaps = 41/694 (5%)
 Frame = -1

Query: 6888 ASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAE 6709
            + + ++KRL ++   W         K +KL++A K   +I    ++ +W+ E E+ +T E
Sbjct: 14   SEDAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTE 73

Query: 6708 DMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVND 6529
            D G DL  V+ L +K      ++  H+ RI ++N  AD LVE G  +   I +KR  +N+
Sbjct: 74   DSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINE 133

Query: 6528 AWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQR 6349
             + R+  LAA R+  L  A  + +F RD  +  +WI EK L + SDDYGRDL  VQ L++
Sbjct: 134  RYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKK 193

Query: 6348 KHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKD 6169
            KH+  E +L + E  +  +++   KL +        I Q+      AW  LK  A  R
Sbjct: 194  KHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQ 253

Query: 6168 GLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARAD 5989
             L+ S    +FLA   +  +WI + + ++  ++    +A  + LL+ H   + +  A  D
Sbjct: 254  KLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKD 313

Query: 5988 SFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERR-ILYEQCMDLQLFYR 5812
              +     G +LVE        + ++ ++L  +  +L  L   R+  L +    LQ  ++
Sbjct: 314  RCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWK 373

Query: 5811 DTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSL-AAQEEKINALDEFATKL 5635
              +  E+W++ +E ++ + + G  L +V+ L+ K E F+  L A ++E I+ +     +L
Sbjct: 374  -ADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQL 432

Query: 5634 IQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGN---ALKESYKR-----QTFDRDCDEM 5479
            I   H  +  + +                  R +   A++E +++      TF +
Sbjct: 433  INASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYLTFAKKASAF 492

Query: 5478 VSWITEKLSTARDDSYLDPT------NIRGKLQKHINFEQELKANENRLDDIRSTGEQII 5317
             SW         ++   DP        IR     H  F+  L + E     + +  ++I
Sbjct: 493  NSWFEN-----AEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKIK 547

Query: 5316 DSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEA------- 5158
                    +    +  +   W  L     ++  +L +    Q+ N  +    A
Sbjct: 548  SFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAKEAKRQEENDKLRKEFAKHANLFH 607

Query: 5157 -WLSE-----LEGQVASEDYGKDL-----------VSVQNLQKKIGLIESDFNAHNDRVD 5029
             WL+E     +EG  + E   + L           V ++ +++   L+E      N   +
Sbjct: 608  QWLTETRTSMMEGSGSLEQQLEALRVKATEVRARRVDLKKIEELGALLEEHLILDNRYTE 667

Query: 5028 -GIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNA 4930
                 LAQQ+ + +  +    +R Q NL+Q+  A
Sbjct: 668  HSTVGLAQQWDQLDQLS----MRMQHNLEQQIQA 697



 Score =  181 bits (459), Expect = 2e-43
 Identities = 105/399 (26%), Positives = 202/399 (50%), Gaps = 5/399 (1%)
 Frame = -1

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLST-ARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
            LKE+ K++T+     ++  W+ E  S    +DS  D  +++  ++KH   E ++ A+E+R
Sbjct: 43   LKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDR 102

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            + D+ +  + +++SG F    I ++ + +N  +  + +    + A+L EA    QF R+I
Sbjct: 103  IKDMNNQADSLVESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDI 162

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
             D E+W+ E +  V S+DYG+DL  VQNL+KK   +E++  +H   +  +++  ++  +
Sbjct: 163  ADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDV 222

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
             +   P I ++ + L Q +  L++    R +KL ES    Q    +E+E AWI EK+Q+
Sbjct: 223  SNLGVPEIEQRLKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLL 282

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQ 4633
               + G  +  VQ L+KK  A   +   H  +   +    +++++  +     I  +  Q
Sbjct: 283  SVEDYGDSMAAVQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQ 342

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEA 4453
            LR     L + A +R+  L D+    Q++  A+  ++W+ +KE  V S ++G+D  + +
Sbjct: 343  LRLKLDNLSALAARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQT 402

Query: 4452 LLKKHRALLSDLEAFK----GTIEDLRKQASQCKYQEQP 4348
            LL K     + L AF+      I  L+ Q     + + P
Sbjct: 403  LLTKQETFDAGLNAFEQEGIHNITALKDQLINASHAQSP 441



 Score =  176 bits (447), Expect = 6e-42
 Identities = 126/535 (23%), Positives = 247/535 (45%), Gaps = 14/535 (2%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWI--LEKLQTAQEE 7024
            D + +R  ++   +      +  K  +L+EA + + +     +L+ W+  +E L T  E+
Sbjct: 16   DAVQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTT-ED 74

Query: 7023 NFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHAL 6844
            + +D +++Q  ++KH+  EA++ AH   I +++   +++++   F +  I+++ + ++
Sbjct: 75   SGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINER 134

Query: 6843 WXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRK 6664
            +         +  +L +AL L  F R   +   WI+EK+  V ++D G DL  V+ L++K
Sbjct: 135  YERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKK 194

Query: 6663 FDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
                  ELG+H+  I  + +A +KL++  +    +I ++   +N AW  L  LAATR +
Sbjct: 195  HKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQK 254

Query: 6483 LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGK 6304
            L  +   Q+F    +E  AWI EK   LS +DYG  +  VQ L +KH+  E D  A + +
Sbjct: 255  LDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTAHKDR 314

Query: 6303 MLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
               +  +  +L E      E+I Q+    +   + L   A  RK  L  +    +F+
Sbjct: 315  CSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKA 374

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDA-RADSFNQTASAGQKLVE 5947
              + SWI D +  + +DE  +D++  + LL   +     ++A   +  +   +   +L+
Sbjct: 375  DVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLIN 434

Query: 5946 MGIPESPEV-----------QEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQ 5800
                +SP +           Q+  +  +  K  LL + E+ R + E  +    F +
Sbjct: 435  ASHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQFRQIEELYL---TFAKKASA 491

Query: 5799 AETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL 5635
              +W    E  L +    +S++ +  L   H  F+ SL++ E    AL     K+
Sbjct: 492  FNSWFENAEEDLTDPVRCNSIEEIRALRDAHAQFQASLSSAEADFKALAALDQKI 546



 Score =  172 bits (437), Expect = 8e-41
 Identities = 115/462 (24%), Positives = 224/462 (47%), Gaps = 7/462 (1%)
 Frame = -1

Query: 3798 IRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGR 3619
            +++++  +  +W  L         +L  A++ + +   V +   W+ E +  L +ED G+
Sbjct: 18   VQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGK 77

Query: 3618 DLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNR 3439
            DL SVQ L +KH+ VE D+ A  D+IK ++ +A+ L +S       I + ++ +NE++ R
Sbjct: 78   DLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDTAGIQEKRQSINERYER 137

Query: 3438 LTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQE 3259
            + + A +R+ +L ++    +F  D  D   WI     LV S +   D+TG + L ++H+
Sbjct: 138  ICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKR 197

Query: 3258 YRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQ 3079
               E+ S     QA  + G +L++  +    +IE RL+ +N+A   L++    R   LD+
Sbjct: 198  LEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKALNQAWAELKNLAATRGQKLDE 257

Query: 3078 CLELQLFYRDCEQADTWMSAREAFLAQEDPSGDN---VESLIKKHEDFDKAINTQEEKIK 2908
             L  Q F    E+ + W++ ++  L+ ED  GD+   V+ L+KKH+ F+      +++
Sbjct: 258  SLTYQQFLAQVEEEEAWITEKQQLLSVED-YGDSMAAVQGLLKKHDAFETDFTAHKDRCS 316

Query: 2907 GLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADE 2728
             +      L++  ++   ++ ++  Q+  + + L     +++  L ++    QF   AD
Sbjct: 317  LICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSALAARRKGALLDNSAYLQFMWKADV 376

Query: 2727 IENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAK 2551
            +E+W+ +K    + + + RD + +Q    KQ+ F+A L+A        I A  + + NA
Sbjct: 377  VESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNAFEQEGIHNITALKDQLINA- 435

Query: 2550 CGGGEAAVSARLKALND---QWDLLVKTTTEKSYRLKEANKQ 2434
                 A   A LK   D   +W  L   +  +  RL    +Q
Sbjct: 436  ---SHAQSPAILKRHGDVIARWQKLRDASNTRKDRLLAMQEQ 474



 Score =  157 bits (398), Expect = 3e-36
 Identities = 138/608 (22%), Positives = 255/608 (41%), Gaps = 28/608 (4%)
 Frame = -1

Query: 4146 QHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREA 3967
            +  Q     I  K+  I ++Y+R+  L   R+ +L EA   +Q  R+  D   WIK ++
Sbjct: 115  ESGQFDTAGIQEKRQSINERYERICNLAAHRQARLNEALTLHQFFRDIADEESWIKEKKL 174

Query: 3966 VAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ 3787
            +    + G DL  V+ L+KK    + +L ++E  +Q + +    L  V        I Q+
Sbjct: 175  LVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVP-EIEQR 233

Query: 3786 IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRS 3607
            ++ LN  W  L         +L  +   Q+F   V+E   WI EK   L  ED+G  + +
Sbjct: 234  LKALNQAWAELKNLAATRGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAA 293

Query: 3606 VQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSK 3427
            VQ L +KH+  E D  A  D+   + ++ + L ++     E I    ++L  + + L++
Sbjct: 294  VQGLLKKHDAFETDFTAHKDRCSLICDQGSELVEAKNHHGESIAQRCQQLRLKLDNLSAL 353

Query: 3426 ANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTE 3247
            A  RK  LLD+  Y +F+     +  WI      V S E   D++  + LL + + +
Sbjct: 354  AARRKGALLDNSAYLQFMWKADVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETF--- 410

Query: 3246 IDSRAATFQAFDQFG--------NQLLNSHHYAA-------GDIENRLQGVNEARKGLED 3112
                 A   AF+Q G        +QL+N+ H  +       GD+  R Q + +A    +D
Sbjct: 411  ----DAGLNAFEQEGIHNITALKDQLINASHAQSPAILKRHGDVIARWQKLRDASNTRKD 466

Query: 3111 AWVARRNILDQCLELQL-FYRDCEQADTWMSAREAFLAQEDP----SGDNVESLIKKHED 2947
              +A +    Q  EL L F +     ++W    E  L   DP    S + + +L   H
Sbjct: 467  RLLAMQEQFRQIEELYLTFAKKASAFNSWFENAEEDLT--DPVRCNSIEEIRALRDAHAQ 524

Query: 2946 FDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGE 2767
            F  ++++ E   K L    + +   N   +P      + + + W  L++ + ++  +L +
Sbjct: 525  FQASLSSAEADFKALAALDQKIKSFNVGPNPYTWFTMEALEETWRNLQKIIEERDGELAK 584

Query: 2766 SQTLQ--------QFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHA 2611
                Q        +F++ A+    W+TE      E +     +++Q+ +  +    E+ A
Sbjct: 585  EAKRQEENDKLRKEFAKHANLFHQWLTETRTSMMEGS----GSLEQQLEALRVKATEVRA 640

Query: 2610 NSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQK 2431
                +  I + G  L E+          S     L  QWD L + +    + L++  + +
Sbjct: 641  RRVDLKKIEELGALLEEHLILDNRYTEHST--VGLAQQWDQLDQLSMRMQHNLEQQIQAR 698

Query: 2430 SFMAAVKD 2407
            +     +D
Sbjct: 699  NHSGVSED 706


>gi|178426|gb|AAA51702.1| alpha-fodrin
 gi|537331|gb|AAA52468.1| alpha-fodrin
          Length = 920

 Score = 1031 bits (2665), Expect = 0.0
 Identities = 523/919 (56%), Positives = 661/919 (71%), Gaps = 60/919 (6%)
 Frame = -1

Query: 5208 EAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVD 5029
            EA  +QQFNRN+ED+E WL E+EG +AS+DYGKDL +VQNLQKK  L+E+D  AH DR+D
Sbjct: 1    EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 5028 GIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIED 4849
            G+   A+QFQ+  HF+A  I +KQE L  RY AL++P+  RK+KL +S +  QLFRD+ED
Sbjct: 61   GVTIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 120

Query: 4848 ELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGH 4669
            E  WIREKE +A STNRG+DLIGVQNL+KK QAL AEIA H+ +I++V+   N M+++GH
Sbjct: 121  EETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGH 180

Query: 4668 FLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGS 4489
            F A +++ KL +L   W  LK+KA +RR DL+DSLQA QY +DANEA++WM EKEPIVGS
Sbjct: 181  FAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGS 240

Query: 4488 TDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLAL 4312
            TDYGKDEDSAEALLKKH AL+SDL A+  +I+ LR+QA  C+ Q  P   + G++ VLAL
Sbjct: 241  TDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLAL 300

Query: 4311 YDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA------ 4150
            YDYQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++P  +
Sbjct: 301  YDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENL 360

Query: 4149 ----------------QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQ 4018
                            Q    ++  S+  +  ++E+ Y  L+ LGE RK  LE++CK +
Sbjct: 361  LEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFM 420

Query: 4017 LLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIAT 3838
            L REAN+L +WI  +EA    +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A
Sbjct: 421  LFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAE 480

Query: 3837 ALTSVGQTETAVRIRQQ-----------------------------------IEDLNARW 3763
             L S G     V+  QQ                                   I++LN RW
Sbjct: 481  DLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERW 540

Query: 3762 RALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKH 3583
            R+L          LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQRKH
Sbjct: 541  RSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKH 600

Query: 3582 EGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKL 3403
            EG ERDLAALGDK+ SL E A RL QSHPE+AE + +   ELN+ W+ L  +A+ RK KL
Sbjct: 601  EGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKL 660

Query: 3402 LDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATF 3223
             DS+D QRFLSD+RDLM WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TF
Sbjct: 661  GDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTF 720

Query: 3222 QAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCE 3043
            QAF+QFG QLL   HYA+ +I+ +L  +++ R  LE AWV RR +LDQCLELQLF+RDCE
Sbjct: 721  QAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCE 780

Query: 3042 QADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNN 2869
            QA+ WM+AREAFL  ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI
Sbjct: 781  QAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAG 840

Query: 2868 HYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQ 2689
            HY    ++ +R+++LDRW  LK  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A
Sbjct: 841  HYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTAS 900

Query: 2688 EENYRDPTNIQQKHQKQQA 2632
            +E+Y+DPTNIQ KHQK QA
Sbjct: 901  DESYKDPTNIQSKHQKHQA 919



 Score =  429 bits (1103), Expect = e-118
 Identities = 232/531 (43%), Positives = 326/531 (60%), Gaps = 36/531 (6%)
 Frame = -1

Query: 6876 IKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGM 6697
            +  R++++  L+         +   L+++ K     R+ +E+  WI EKE  +T+E++G
Sbjct: 387  VSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGA 446

Query: 6696 DLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEG-HSEHDQIYKKRD------- 6541
            DLE VE+LQ+KFDDF K+L  ++ R+ +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 447  DLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPR 506

Query: 6540 ----------------------------DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
                                        ++N+ W  L  LA  R + L  AH+VQRF+RD
Sbjct: 507  DETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRD 566

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
            ADET  WI EK+ AL++D+YG DL +VQALQRKHEG ERDLAAL  K+  L + A +L +
Sbjct: 567  ADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQ 626

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
            +HP+ AE + +K  +   AW++L ++A  RK  L  S  L RFL+D+RDL+SWI  ++ +
Sbjct: 627  SHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGL 686

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            + +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G   SPE+++KL+
Sbjct: 687  VSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLD 746

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             LD E++ L   W +RR++ +QC++LQLF+RD EQAE WM  +EAFL   D GDSLDSVE
Sbjct: 747  ILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVE 806

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXX 5545
             LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D++
Sbjct: 807  ALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMI 866

Query: 5544 XRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKH 5392
             + + L ES   Q F RD DE+ +WI+EKL TA D+SY DPTNI+ K QKH
Sbjct: 867  EKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKH 917



 Score =  326 bits (836), Expect = 5e-87
 Identities = 235/936 (25%), Positives = 436/936 (46%), Gaps = 43/936 (4%)
 Frame = -1

Query: 7110 EARQFQYFKRDADELNVWILE-KLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIA 6934
            EA Q Q F R+ +++ +W+ E +   A ++  +D +N+Q   +KH   EA+V AH   I
Sbjct: 1    EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 6933 NLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDE 6754
             +           HF +E+IKK+ E L A +         +  KL  +L+L    R  ++
Sbjct: 61   GVTIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 120

Query: 6753 ILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGH 6574
               WIREKE    + + G DL  V+ L +K      E+  H+ RI  + Q  + +VEEGH
Sbjct: 121  EETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGH 180

Query: 6573 SEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSS 6394
               + +  K  ++N  W  L   A+ R++ L  + Q Q++  DA+E  +W+ EK+  + S
Sbjct: 181  FAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGS 240

Query: 6393 DDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTK 6214
             DYG+D ++ +AL +KHE    DL+A    +  L ++A    +     A    +   +
Sbjct: 241  TDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQ---QVAPTDDETGKELV 297

Query: 6213 AAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISW---IGDMKAVIGADELAKDVAGAE 6043
             A    +EK+  R+  +++   L    +  +D   W   + D +  + A  + K
Sbjct: 298  LALYDYQEKSP-REVTMKKGDILTLLNSTNKDW--WKVEVNDRQGFVPAAYVKKLDPAQS 354

Query: 6042 ALLESHQEHKGEIDARADSF-NQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLW 5866
            A  E+  E +G I  R +   NQT             E+  V  ++++++    SLL L
Sbjct: 355  ASRENLLEEQGSIALRQEQIDNQTRIT---------KEAGSVSLRMKQVEELYHSLLELG 405

Query: 5865 EERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSL 5686
            E+R+ + E+     + +R+  + + W+N++EA L + ++G  L+ VE L KK +DF+K L
Sbjct: 406  EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 465

Query: 5685 AAQEEKINALDEFATKLIQGQHYAADDV----------------AEXXXXXXXXXXXXXX 5554
             A E ++  +++ A  L + +   A++V                 +
Sbjct: 466  KANESRLKDINKVAEDL-ESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMV 524

Query: 5553 XXXXRGNALKESYKR---------------------QTFDRDCDEMVSWITEKLSTARDD 5437
                  N++KE  +R                     Q F RD DE   WI EK      D
Sbjct: 525  HTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTD 584

Query: 5436 SY-LDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
            +Y  D  +++   +KH  FE++L A  ++++ +  T E++  S   +A+ + ++  ++N
Sbjct: 585  NYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQ 644

Query: 5259 LWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQK 5080
             W+ L    +++ AKL ++ + Q+F  +  D+ +W++ + G V+S++  KD+   + L +
Sbjct: 645  AWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLE 704

Query: 5079 KIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKR 4900
            +     ++ +A        +Q  QQ     H+ +P I +K + L Q    L     +R+
Sbjct: 705  RHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRM 764

Query: 4899 KLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDS 4720
             L +  +     RD E    W+  +E    + ++G  L  V+ LIKK +     I   +
Sbjct: 765  MLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEE 824

Query: 4719 QIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSD 4540
            +I ++ + A+ +I  GH+   +I  +  ++ D WR LK++  ++R+ L +S    Q+  D
Sbjct: 825  KIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRD 884

Query: 4539 ANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRA 4432
             +E +AW+SEK        Y KD  + ++  +KH+A
Sbjct: 885  VDEIEAWISEKLQTASDESY-KDPTNIQSKHQKHQA 919



 Score =  299 bits (766), Expect = 6e-79
 Identities = 231/938 (24%), Positives = 432/938 (45%), Gaps = 40/938 (4%)
 Frame = -1

Query: 4038 EACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQ 3859
            EA +  Q  R   D+  W+   E   A  + G DL  V+ LQKK    + D+ A++ R+
Sbjct: 1    EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 3858 EMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVD 3679
             +   A      G  + A  I+++ E L AR+ AL         +L  +  +Q+  RDV+
Sbjct: 61   GVTIQARQFQDAGHFD-AENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVE 119

Query: 3678 ETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSH 3499
            +   WI+EK+    S + G+DL  VQ L +KH+ ++ ++A    +IK++ +K N + +
Sbjct: 120  DEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEG 179

Query: 3498 PEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVS 3319
              AAE +     ELN++W  L +KA+ R++ L DS   Q++ +D  +   W+     +V
Sbjct: 180  HFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVG 239

Query: 3318 SQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGV 3139
            S +   D   AEALL++H+   +++ +  ++ QA  +           A  D E   + V
Sbjct: 240  STDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSC--RQQVAPTDDETGKELV 297

Query: 3138 ----NEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD-NV 2974
                +   K   +  + + +IL         +   E  D       A++ + DP+   +
Sbjct: 298  LALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASR 357

Query: 2973 ESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEAL 2794
            E+L+++      +I  ++E+I       +        ++ +V+ +  Q+ + ++ L E
Sbjct: 358  ENLLEEQG----SIALRQEQIDNQTRITK--------EAGSVSLRMKQVEELYHSLLELG 405

Query: 2793 IQKRFKLGESQTLQQFSRDADEIENWMTEK-FQIAQEENYRDPTNIQQKHQKQQAFEAEL 2617
             +++  L +S       R+A+E++ W+ EK   +  EE   D   ++   +K   F+ +L
Sbjct: 406  EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 465

Query: 2616 HANSDRIAAIIQAGNNLIENAKCGGGEAAV-----------------------SARL--- 2515
             AN  R+  I +   +L           AV                       SARL
Sbjct: 466  KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH 525

Query: 2514 --------KALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
                    K LN++W  L +   E+S  L  A++ + F     + + W+ E    L +++
Sbjct: 526  TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN 585

Query: 2358 YGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR 2179
            YG DLASV+ L +KH   E D+ A  D+V  + E A+ L ++     + + E+   +
Sbjct: 586  YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQA 645

Query: 2178 YDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRK 1999
            +  + K A  R+ KL  + ++ +F  D  D  SWI   + LVSSD+  +D+ G + L  +
Sbjct: 646  WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER 705

Query: 1998 HRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNR 1819
            H+   TE+ +        +  G++LL   A       +IK++++ L+Q    +      R
Sbjct: 706  HQEHRTEIDARAGTFQAFEQFGQQLL---AHGHYASPEIKQKLDILDQERADLEKAWVQR 762

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
               LD+    Q F  D E+ E WM  ++  L +++ G+++  V+ L+KKH+ F   + +
Sbjct: 763  RMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQ 822

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
            ++++A L    D LI  G++    I  R +++  R   +++    + +KL ++    QF
Sbjct: 823  EEKIAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFS 882

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1345
               D +E+WI+EK Q    E + +D +++Q    K +A
Sbjct: 883  RDVDEIEAWISEKLQTASDESY-KDPTNIQSKHQKHQA 919



 Score =  254 bits (648), Expect = 3e-65
 Identities = 199/859 (23%), Positives = 376/859 (43%), Gaps = 42/859 (4%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            A++I ++++ ++  Y   K+    ++ +L ++ + Q   RD ++   WI EK   A   N
Sbjct: 77   AENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWIREKEPIAASTN 136

Query: 7020 F-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHAL 6844
              +D   +Q  ++KH+A +AE+  H   I  + + GNAM++  HFA+E +K +L EL+
Sbjct: 137  RGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQK 196

Query: 6843 WXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRK 6664
            W         +   L+ +L+   +    +E   W+REKE  V + D G D +  E L +K
Sbjct: 197  WEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKK 256

Query: 6663 FDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
             +  + +L  +   I  + + A    ++     D+  K+       +   +    T K+G
Sbjct: 257  HEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKG 316

Query: 6483 ----LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
                L  +     +  + ++   ++           Y + L+  Q+  R++   E+   A
Sbjct: 317  DILTLLNSTNKDWWKVEVNDRQGFVPAA--------YVKKLDPAQSASRENLLEEQGSIA 368

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            L  + +  +    K        A ++  +    +  +++L E  + RK  LE+S +
Sbjct: 369  LRQEQIDNQTRITK-------EAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFML 421

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEI---DARADSFNQTA-- 5971
              +  +L  WI + +A + ++E+  D+   E L +   + + ++   ++R    N+ A
Sbjct: 422  FREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAED 481

Query: 5970 --SAGQKLVEMGIPESPEVQ-----------------------------EKLEKLDHEKS 5884
              S G    E+   +  EV                                +++L+
Sbjct: 482  LESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWR 541

Query: 5883 SLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHE 5704
            SL  L EER  L     ++Q F+RD ++ + W+ ++   L   + G  L SV+ L +KHE
Sbjct: 542  SLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHE 601

Query: 5703 DFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALK 5524
             FE+ LAA  +K+N+L E A +L Q    +A+D+ E                  R   L
Sbjct: 602  GFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLG 661

Query: 5523 ESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLD 5347
            +S+  Q F  D  +++SWI   +   + D+   D T     L++H     E+ A
Sbjct: 662  DSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQ 721

Query: 5346 DIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIED 5167
                 G+Q++  GH+A+  I  +L  ++    +L  A  ++   L +    Q F+R+ E
Sbjct: 722  AFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQ 781

Query: 5166 VEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEH 4987
             E W++  E  + +ED G  L SV+ L KK    +   N   +++  ++  A Q     H
Sbjct: 782  AENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGH 841

Query: 4986 FNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGS 4807
            +    I  ++  +  R+  L+  + +++ KLGES    Q  RD+++  AWI EK Q A S
Sbjct: 842  YAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTA-S 900

Query: 4806 TNRGRDLIGVQNLIKKQQA 4750
                +D   +Q+  +K QA
Sbjct: 901  DESYKDPTNIQSKHQKHQA 919



 Score =  236 bits (602), Expect = 6e-60
 Identities = 176/691 (25%), Positives = 318/691 (45%), Gaps = 48/691 (6%)
 Frame = -1

Query: 2448 EANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVG 2269
            EAN+Q+ F   V+D+E WL EVE  L S+DYGKDL +V+NL KKH+LLEAD+ AHQDR+
Sbjct: 1    EANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRID 60

Query: 2268 EMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDD 2089
             +  QA    +   F  + I ++++ +  RY+ +K+    R+ KL+ +L + Q FRD++D
Sbjct: 61   GVTIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVED 120

Query: 2088 EESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAA 1909
            EE+WI+EK+ + +S + G+DL GVQNL +KH+ +  E+A HEP++  V  KG  ++
Sbjct: 121  EETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVE--- 177

Query: 1908 EAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQI 1729
            E     + +K ++ +L Q W  ++     R Q L++S   Q +  D  E E+WM EK+ I
Sbjct: 178  EGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPI 237

Query: 1728 LGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCD 1549
            +GS ++G++    + LLKKH+    DL  +   +  L  +  +        AP   +
Sbjct: 238  VGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSC---RQQVAPTDDETGK 294

Query: 1548 QLRARLIEIE-------SMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFG 1390
            +L   L + +       +M +G +  L +++   +  WK +V +         V+  D
Sbjct: 295  ELVLALYDYQEKSPREVTMKKGDILTLLNSTN--KDWWKVEVNDRQGFVPAAYVKKLDPA 352

Query: 1389 RDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRW 1210
            +  S   +L   +E     L   + +   RIT           +++ ++  R   V + +
Sbjct: 353  QSASRENLL---EEQGSIALRQEQIDNQTRIT-----------KEAGSVSLRMKQVEELY 398

Query: 1209 QNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEE 1030
             +LL   E R+              + ++ F ++A+    W    E  LT       LE+
Sbjct: 399  HSLLELGEKRKGMLEKSC-------KKFMLF-REANELQQWINEKEAALTSEEVGADLEQ 450

Query: 1029 IRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKS----------------FNVGP----- 913
            +  L+    +FQ+ L + E   + +  +   ++S                + + P
Sbjct: 451  VEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETD 510

Query: 912  ----NPY-----------TWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRRE 778
                +P+           T+ ++  L + WR+LQ++ +ER Q L   H+ Q
Sbjct: 511  SKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQ--------R 562

Query: 777  FAKLANAFHAWLTNTRQEM-MEAGGTLEEQLDAVERK----AKEIKANKGQLRQIEEKGA 613
            F + A+    W+    Q +  +  G     + A++RK     +++ A   ++  + E
Sbjct: 563  FHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAE 622

Query: 612  MLERNLILDNRYTEHSTVGIAQAWDQLDQLA 520
             L ++        +     + QAW  L + A
Sbjct: 623  RLTQSHPESAEDLQEKCTELNQAWSSLGKRA 653



 Score =  235 bits (600), Expect = 1e-59
 Identities = 203/923 (21%), Positives = 385/923 (40%), Gaps = 37/923 (4%)
 Frame = -1

Query: 3384 QRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQF 3205
            Q+F  +  D+  W+  +   ++S +   D+T  + L ++H     ++ +
Sbjct: 6    QQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGVTIQ 65

Query: 3204 GNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWM 3025
              Q  ++ H+ A +I+ + + +    + L++  VAR+  L   L LQ  +RD E  +TW+
Sbjct: 66   ARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWI 125

Query: 3024 SAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPA 2851
              +E   A  +   D   V++L+KKH+     I   E +IK +     ++++  H+ +
Sbjct: 126  REKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAED 185

Query: 2850 VTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-R 2674
            V  K  ++  +W  LK    Q+R  L +S   QQ+  DA+E E+WM EK  I    +Y +
Sbjct: 186  VKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGK 245

Query: 2673 DPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQW 2494
            D  + +   +K +A  ++L A    I A+ +   +  +       E      L   + Q
Sbjct: 246  DEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQE 305

Query: 2493 DLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKH 2314
                + T +K   L   N            ++W  EV             A V+ L
Sbjct: 306  KSPREVTMKKGDILTLLNSTNK--------DWWKVEVN----DRQGFVPAAYVKKLDPAQ 353

Query: 2313 SLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKL 2134
            S    +++  Q  +    EQ D+     +  G  ++ R K + + Y  + ++   R+  L
Sbjct: 354  SASRENLLEEQGSIALRQEQIDNQTRITKEAGS-VSLRMKQVEELYHSLLELGEKRKGML 412

Query: 2133 SKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQV 1954
             K+      FR+ ++ + WI EK+  ++S++ G DL  V+ L++K      +L ++E ++
Sbjct: 413  EKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRL 472

Query: 1953 SLVKLKGEEL----LRSAAEAGVGEDQIKKRM---------------------------- 1870
              +    E+L    L +     V + ++   M
Sbjct: 473  KDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNS 532

Query: 1869 -EDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAG 1693
             ++L + W  ++ L   R Q L  +   Q F  D +E + W+ EK Q L +DN+G ++A
Sbjct: 533  IKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLAS 592

Query: 1692 VQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESM 1513
            VQ L +KH+ F+ DL     +V  L    + L  +    A  ++++C +L      +
Sbjct: 593  VQALQRKHEGFERDLAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQAWSSLGKR 652

Query: 1512 AEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAG 1333
            A+ R AKL D+    +F+     + SWI      V S++  +D++  + LL + +
Sbjct: 653  ADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTE 712

Query: 1332 LNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXX 1153
            ++A      Q   +   QL++  H  SP I+++   + Q   +L      RR
Sbjct: 713  IDA-RAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCL- 770

Query: 1152 XXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAE 973
                  EL L F +      +W    E  L    + +SL+ + AL   H +F ++++  E
Sbjct: 771  ------ELQL-FHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQE 823

Query: 972  EDFRQLQDL-DRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEEN 796
            E    LQ   D+ I + +      +    + L D WR L+  + E+  +L      Q
Sbjct: 824  EKIAALQAFADQLIAAGHYAKGDISSRRNEVL-DRWRRLKAQMIEKRSKLGESQTLQ--- 879

Query: 795  DKLRREFAKLANAFHAWLTNTRQ 727
                 +F++  +   AW++   Q
Sbjct: 880  -----QFSRDVDEIEAWISEKLQ 897



 Score =  228 bits (582), Expect = 1e-57
 Identities = 214/933 (22%), Positives = 393/933 (41%), Gaps = 56/933 (6%)
 Frame = -1

Query: 3066 QLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLF 2893
            Q F R+ E  + W+   E  LA +D   D  NV++L KKH   +  +   +++I G+ +
Sbjct: 6    QQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGVTIQ 65

Query: 2892 AESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWM 2713
            A       H+D+  + +K++ ++ R+  LKE ++ ++ KL +S  LQQ  RD ++ E W+
Sbjct: 66   ARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKLADSLRLQQLFRDVEDEETWI 125

Query: 2712 TEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGE 2536
             EK  IA   N  +D   +Q   +K QA +AE+  +  RI A+ Q GN ++E       +
Sbjct: 126  REKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAED 185

Query: 2535 AAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDY 2356
              V A+L  LN +W+ L    +++   L+++ + + + A   + E W+ E E ++ S DY
Sbjct: 186  --VKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDY 243

Query: 2355 GKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRY 2176
            GKD  S E LLKKH  L +D+ A+   +  + EQA S  +  Q         ++L+   Y
Sbjct: 244  GKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQ--QVAPTDDETGKELVLALY 301

Query: 2175 DGVKKMATDRRDK------LSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQ 2014
            D  +K   +   K      L  + N   +  +++D + ++           Y + L   Q
Sbjct: 302  DYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAA--------YVKKLDPAQ 353

Query: 2013 NLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRD 1834
            +  R++      L   +  ++L + + +   R   EAG     +  RM+ +E+ +  + +
Sbjct: 354  SASREN------LLEEQGSIALRQEQIDNQTRITKEAG----SVSLRMKQVEELYHSLLE 403

Query: 1833 LTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQV 1654
            L   R   L++S        +  E + W+NEK+  L S+  G ++  V+ L KK D FQ
Sbjct: 404  LGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQK 463

Query: 1653 DLELHKQRVADLINKGDTLIHNG------------------------------------N 1582
            DL+ ++ R+ D+    + L   G
Sbjct: 464  DLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLM 523

Query: 1581 HHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRS 1402
             H         +L  R   ++ +AE R   L       +F    D  + WI EK Q + +
Sbjct: 524  VHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNT 583

Query: 1401 EDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNV 1222
            +++G DL+SVQ L  K E F+  L A   + +  + E  ++L  S  + +  ++++ T +
Sbjct: 584  DNYGHDLASVQALQRKHEGFERDLAAL-GDKVNSLGETAERLTQSHPESAEDLQEKCTEL 642

Query: 1221 IQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCN 1042
             Q W +L   ++ R+            + +             SW       ++
Sbjct: 643  NQAWSSLGKRADQRKAKLGDSHDLQRFLSDF--------RDLMSWINGIRGLVSSDELAK 694

Query: 1041 SLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRN 862
             +    AL + H E +  + +    F+  +   +++ +     +P     +D L+    +
Sbjct: 695  DVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERAD 754

Query: 861  LQRIIKER--------EQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGG 706
            L++   +R        E +L      Q EN    RE      AF     NT  +
Sbjct: 755  LEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAARE------AF----LNTEDK------ 798

Query: 705  TLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLER---NLILDNRYTEHSTVGIAQAWDQ 535
               + LD+VE   K+ +     +   EEK A L+     LI    Y +           +
Sbjct: 799  --GDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAK------GDISSR 850

Query: 534  LDQLAMRMQHNLEQQIQARNQSGVSEEALREFS 436
             +++  R +    Q I+ R++ G S + L++FS
Sbjct: 851  RNEVLDRWRRLKAQMIEKRSKLGES-QTLQQFS 882



 Score =  136 bits (343), Expect = 7e-30
 Identities = 90/373 (24%), Positives = 172/373 (45%), Gaps = 1/373 (0%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 547  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 606

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   + Q +  ++E ++++  EL+  W         +  KL  +  L
Sbjct: 607  LAALGDKVNSLGETAERLTQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDL 666

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +  +   E+           Q
Sbjct: 667  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQF 726

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 727  GQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWM 786

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEA 6241
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L
Sbjct: 787  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGD 846

Query: 6240 IHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAK 6061
            I  + ++    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE  K
Sbjct: 847  ISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYK 905

Query: 6060 DVAGAEALLESHQ 6022
            D    ++  + HQ
Sbjct: 906  DPTNIQSKHQKHQ 918


>gi|47211129|emb|CAF90367.1| unnamed protein product [Tetraodon
            nigroviridis]
          Length = 1589

 Score =  921 bits (2380), Expect = 0.0
 Identities = 500/998 (50%), Positives = 636/998 (63%), Gaps = 111/998 (11%)
 Frame = -1

Query: 5922 VQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGD 5743
            V+ +L  L  EK +LL LWE RR  YEQCMDLQLFYRDTEQ + WM+KQEAFL N DLGD
Sbjct: 520  VRVQLGILSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGD 579

Query: 5742 SLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXX 5563
            SLDSVE L+KKHEDFEKSL+AQEEKI ALDEFATKLIQ  HYA +DVA
Sbjct: 580  SLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNA 639

Query: 5562 XXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINF 5383
                   R  AL++S+  Q F RD DE+ SWI EK+ TA D++Y DP+N++GK+QKH  F
Sbjct: 640  LHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAF 699

Query: 5382 EQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREA 5203
            E EL AN++R+D ++ +G+ +++  H+A+  +  R+                      EA
Sbjct: 700  EAELSANQSRIDALQKSGQDLLERKHYASSEVARRME---------------------EA 738

Query: 5202 GNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHN------ 5041
              +QQFNRN+ED+E WL E+EG +AS+DYGKDL SVQNLQKK  L+E+D  AH
Sbjct: 739  NQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHT 798

Query: 5040 ----------------------------------DRVDGIKQLAQQFQEEEHFNAPVIVR 4963
                                              DR+DGI   A+QFQE  HF+A  I R
Sbjct: 799  HSVQTSPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRR 858

Query: 4962 KQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLI 4783
            KQE L  RY  +R P+  RK+KL +S +  QLFRD+EDE  WIREKE +A STNRG+DLI
Sbjct: 859  KQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLI 918

Query: 4782 GVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKS 4603
            GVQNL+KK QAL AEI  H+ +I++V+     M+++GHF   +++ KL +L   W  LK
Sbjct: 919  GVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRWDTLKL 978

Query: 4602 KAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLS 4423
            KA +R+ DL+DSLQA QY +DANEA++WM EKEPIVGSTDYGKDEDSAEALLKKH AL+S
Sbjct: 979  KASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMS 1038

Query: 4422 DL--------------------EAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLALYD 4306
            DL                    + F  T    R+     + Q  P   + G++ VLALYD
Sbjct: 1039 DLSLRQQHPGPEGAGAVLQGRTQPFTLTGTPARRDPLLEQQQVAPTDDETGKELVLALYD 1098

Query: 4305 YQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA-------Q 4147
            YQEKSPREV+MKKGD+LTLLN++N+DWWKVEVNDR GFVPAAYVK+++P  +       +
Sbjct: 1099 YQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLLE 1158

Query: 4146 QHA-----QQQVN---------SIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLR 4009
            +H      Q Q+          S+  +  ++E+ Y  L+ LGE RK  LE++CK + L R
Sbjct: 1159 EHGSIALRQDQIENQLVTKEACSVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFR 1218

Query: 4008 EANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALT 3829
            EAN+L +WI  +E     +E+G+DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L
Sbjct: 1219 EANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELE 1278

Query: 3828 SVG--QTETAVRIRQQIEDL---------------------------NARWRALXXXXXX 3736
            S G    ET +   QQ ++L                            A +  +
Sbjct: 1279 SEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRLAVQTTANFNTIKQLAED 1338

Query: 3735 XXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAA 3556
                LGSAHEVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAA
Sbjct: 1339 RSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAA 1398

Query: 3555 LGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRF 3376
            LGDK+ SL E A RL QSHPEA E I +   ELN  W+ L  +A+ RK+KL +S+D QRF
Sbjct: 1399 LGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRF 1458

Query: 3375 LSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQ 3262
            LSD+RDLM WI  +  LVSS+ELA DVTGAEALLERHQ
Sbjct: 1459 LSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLERHQ 1496



 Score =  432 bits (1112), Expect = e-119
 Identities = 216/402 (53%), Positives = 283/402 (69%)
 Frame = -1

Query: 7218 IRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQ 7039
            +++LETA+DI  RRQ+VL  Y  FK+ S  +R +LE++ +FQ F+RDA+EL  WI EKLQ
Sbjct: 6    VKVLETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQ 65

Query: 7038 TAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
             A +EN++DPSNLQ K+QKH+AFEAEVQA+A TI  LD+TGN MI   HFASE I+ RLE
Sbjct: 66   IASDENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLE 125

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVE 6679
            ELH LW         KG++L QA KL+ ++R+C++ L WI +KE   T+E++G DLEHVE
Sbjct: 126  ELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVE 185

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            +LQ+KF++F  +L  H+ R+NE+NQ A KL++E H E + I +K+D+VN AW RL  LA
Sbjct: 186  LLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQ 245

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             R+  LFGA +VQRFNRD DET++WI E+   + SDD+GRD  +VQAL RKHEG ERDLA
Sbjct: 246  QRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLA 305

Query: 6318 ALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHR 6139
            ALE K+  L  +A +L ETHP  A  I  K D+  A W  ++  A              R
Sbjct: 306  ALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGEPR 365

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHK 6013
            F AD+RDL SW+ +M+A+I ADELA DVAGAEALL+ HQEHK
Sbjct: 366  FTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQEHK 407



 Score =  398 bits (1023), Expect = e-109
 Identities = 261/805 (32%), Positives = 405/805 (49%), Gaps = 67/805 (8%)
 Frame = -1

Query: 3141 VNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVES 2968
            ++E ++ L + W  RR   +QC++LQLFYRD EQ D WMS +EAFL  ED   S D+VE+
Sbjct: 527  LSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEA 586

Query: 2967 LIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQ 2788
            L+KKHEDF+K+++ QEEKI  L  FA  LI+NNHY    V  +RD +L R N L E
Sbjct: 587  LLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQS 646

Query: 2787 KRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHAN 2608
            +R  L +S  LQQF RD+DE+++W+ EK + A +E Y+DP+N+Q K QK QAFEAEL AN
Sbjct: 647  RRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSAN 706

Query: 2607 SDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKS 2428
              RI A+ ++G +L+E       E A                        R++EAN+Q+
Sbjct: 707  QSRIDALQKSGQDLLERKHYASSEVA-----------------------RRMEEANQQQQ 743

Query: 2427 FMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAH------------ 2284
            F   V+D+E WL EVE  L S+DYGKDL SV+NL KKH+LLEAD+ AH
Sbjct: 744  FNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQT 803

Query: 2283 ----------------------------QDRVGEMNEQADSLLENDQFQGQQIAERRKLI 2188
                                        QDR+  ++ QA    E   F    I  +++ +
Sbjct: 804  SPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRRKQEAL 863

Query: 2187 ADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNL 2008
              RY+GV++    R+ KLS +L + Q FRD++DEE+WI+EK+ + +S + G+DL GVQNL
Sbjct: 864  GVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNL 923

Query: 2007 RRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLT 1828
             +KH+ +  E+  HEP++  V  KGE ++     AG   + +K ++ +L   W  ++
Sbjct: 924  LKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAG---EDVKVKLTELHGRWDTLKLKA 980

Query: 1827 GNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDL 1648
              R Q L++S   Q +  D  E E+WM EK+ I+GS ++G++    + LLKKH+    DL
Sbjct: 981  SQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDL 1040

Query: 1647 ELHKQRV----ADLINKGDTL-------------IHNGNHHAPHIKQRCDQLRARLIEIE 1519
             L +Q      A  + +G T              +      AP   +   +L   L + +
Sbjct: 1041 SLRQQHPGPEGAGAVLQGRTQPFTLTGTPARRDPLLEQQQVAPTDDETGKELVLALYDYQ 1100

Query: 1518 -------SMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL 1360
                   +M +G +  L +++   +  WK +V +         V+  D  +  S   +L
Sbjct: 1101 EKSPREVTMKKGDILTLLNSTN--KDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLL- 1157

Query: 1359 TKQEAFDAGLNAFEHEGIQ-RITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEA 1183
                         EH  I  R  ++++QLV+ E   + ++  R   V + + NLL   E
Sbjct: 1158 ------------EEHGSIALRQDQIENQLVTKE---ACSVSVRMKQVEELYANLLELGEK 1202

Query: 1182 RRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHG 1003
            R+              + ++ F ++A+    W    E  LT+    + LE++  L+
Sbjct: 1203 RKDMLEKSC-------KKFMLF-REANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFD 1254

Query: 1002 EFQRSLSSAEEDFRQLQDLDRRIKS 928
            +FQ+ L + E   R +  +   ++S
Sbjct: 1255 DFQKDLKANESRLRDINKVAAELES 1279



 Score =  282 bits (722), Expect = 8e-74
 Identities = 234/966 (24%), Positives = 421/966 (43%), Gaps = 86/966 (8%)
 Frame = -1

Query: 3816 TETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALD 3637
            +   V +R Q+  L+    AL         Q     ++Q F+RD ++  +W+ +++  L
Sbjct: 514  SRVCVCVRVQLGILSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLL 573

Query: 3636 SEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQREL 3457
            +ED G  L SV+AL +KHE  E+ L+A  +KI +LDE A +L Q++  A E +   +  L
Sbjct: 574  NEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDAL 633

Query: 3456 NEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEAL 3277
              + N L  +A +R+  L DS+  Q+F  D  +L  WI +     ++ E   D +  +
Sbjct: 634  LSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWI-NEKMKTATDEAYKDPSNLQGK 692

Query: 3276 LERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVAR 3097
            +++HQ +  E+ +  +   A  + G  LL   HYA+ ++  R++  N+
Sbjct: 693  VQKHQAFEAELSANQSRIDALQKSGQDLLERKHYASSEVARRMEEANQQ----------- 741

Query: 3096 RNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHE--DFDKA-- 2935
                      Q F R+ E  + W+   E  LA +D   D  +V++L KKH   + D A
Sbjct: 742  ----------QQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAH 791

Query: 2934 -INTQ-----------------------------------EEKIKGLKLFAESLIKNNHY 2863
             ++TQ                                   +++I G+ + A    +  H+
Sbjct: 792  QVHTQHTHSVQTSPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHF 851

Query: 2862 DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEE 2683
            D+  + RK++ +  R+ G+++ +  ++ KL +S  LQQ  RD ++ E W+ EK  IA
Sbjct: 852  DADNIRRKQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAAST 911

Query: 2682 NY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKAL 2506
            N  +D   +Q   +K QA +AE+  +  RI A+ Q G  ++E     G +  V  +L  L
Sbjct: 912  NRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGED--VKVKLTEL 969

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
            + +WD L    +++   L+++ + + + A   + E W+ E E ++ S DYGKD  S E L
Sbjct: 970  HGRWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEAL 1029

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDR 2146
            LKKH  L +D+   Q   G     A        F       RR  + +     ++
Sbjct: 1030 LKKHEALMSDLSLRQQHPGPEGAGAVLQGRTQPFTLTGTPARRDPLLE-----QQQVAPT 1084

Query: 2145 RDKLSKALNVHQF-FRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELAS 1969
             D+  K L +  + +++    E  +K+  +L   +   +D   V+   R        +
Sbjct: 1085 DDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRLGFVPAAYVKK 1144

Query: 1968 HEPQVSLVKLKGEELLRSAAEAGVGEDQIKK------------RMEDLEQSWGQIRDLTG 1825
             +P  S  +   E LL       + +DQI+             RM+ +E+ +  + +L
Sbjct: 1145 LDPNQSSSR---ENLLEEHGSIALRQDQIENQLVTKEACSVSVRMKQVEELYANLLELGE 1201

Query: 1824 NRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLE 1645
             R   L++S        +  E + W++EK+  L ++  G ++  V+ L KK D FQ DL+
Sbjct: 1202 KRKDMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLK 1261

Query: 1644 LHKQRVADLINKGDTLIHNG--NHHAPHI--------------KQRCD------------ 1549
             ++ R+ D+      L   G      P +              K   D
Sbjct: 1262 ANESRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRL 1321

Query: 1548 --QLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSS 1375
              Q  A    I+ +AE R   L       +F    D  + WI EK Q + ++++G DL+S
Sbjct: 1322 AVQTTANFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLAS 1381

Query: 1374 VQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLA 1195
            VQ L  K E F+  L A   + +  + E  ++L+ S  +    I+++ + +   W +L+
Sbjct: 1382 VQALQRKHEGFERDLAAL-GDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVG 1440

Query: 1194 HSEARR 1177
             ++ R+
Sbjct: 1441 RADQRK 1446



 Score =  275 bits (703), Expect = 1e-71
 Identities = 227/914 (24%), Positives = 401/914 (43%), Gaps = 99/914 (10%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            +D+  RR  +L   +   + +Q++R  LE++   Q F RD+DEL  WI EK++TA +E +
Sbjct: 624  EDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAY 683

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            +DPSNLQ K+QKH+AFEAE+ A+   I  L K+G  +++  H+AS  + +R+EE
Sbjct: 684  KDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQDLLERKHYASSEVARRMEE------ 737

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                           A +   F R  ++I  W+ E E ++ ++D G DL  V+ LQ+K
Sbjct: 738  ---------------ANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHA 782

Query: 6657 DFLKELGNHQY----------------------------------------RINEINQAA 6598
                ++  HQ                                         RI+ I+  A
Sbjct: 783  LLEADVAAHQVHTQHTHSVQTSPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQA 842

Query: 6597 DKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIG 6418
             +  E GH + D I +K++ +   +  +    ATRK+ L  + ++Q+  RD ++   WI
Sbjct: 843  RQFQEAGHFDADNIRRKQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIR 902

Query: 6417 EKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAI 6238
            EK+   +S + G+DL  VQ L +KH+  + ++   E ++  + ++   + E      E +
Sbjct: 903  EKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDV 962

Query: 6237 HQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKD 6058
              K  +    W+ LK KA  RK  LE S Q  ++ AD  +  SW+ + + ++G+ +  KD
Sbjct: 963  KVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKD 1022

Query: 6057 VAGAEALLESH----------QEHKGEIDARADSFNQTASAGQKLVEMGIPESPE---VQ 5917
               AEALL+ H          Q+H G   A A    +T    Q     G P   +    Q
Sbjct: 1023 EDSAEALLKKHEALMSDLSLRQQHPGPEGAGAVLQGRT----QPFTLTGTPARRDPLLEQ 1078

Query: 5916 EKLEKLDHE--KSSLLGLWE-----ERRILYEQCMDLQLFYRDTEQAETWMNK------- 5779
            +++   D E  K  +L L++      R +  ++   L L   ++   + W  +
Sbjct: 1079 QQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLL--NSTNKDWWKVEVNDRLGF 1136

Query: 5778 -QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDV 5602
               A++   D   S  S E+L+++H     S+A ++++I   ++  TK        A  V
Sbjct: 1137 VPAAYVKKLDPNQS-SSRENLLEEH----GSIALRQDQIE--NQLVTK-------EACSV 1182

Query: 5601 AEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LD 5425
            +                   R + L++S K+    R+ +E+  WI EK  T  ++    D
Sbjct: 1183 SVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSD 1242

Query: 5424 PTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNL---- 5257
               +    +K  +F+++LKANE+RL DI     ++   G  A +    + +Q   L
Sbjct: 1243 LEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAA 1302

Query: 5256 --------------------------WNELVDATNKKGAKLREAGNEQQFNRNIEDVEAW 5155
                                      +N +      +   L  A   Q+F+R+ ++ + W
Sbjct: 1303 PGKDEADSKTASPWKNVRLAVQTTANFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEW 1362

Query: 5154 LSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAP 4975
            + E    + +++YG DL SVQ LQ+K    E D  A  D+V+ + + A++  +
Sbjct: 1363 IEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVE 1422

Query: 4974 VIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRG 4795
             I  K   L   +++L    ++RK KL  SH   +   D  D ++WI     +  S
Sbjct: 1423 DIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELA 1482

Query: 4794 RDLIGVQNLIKKQQ 4753
            +D+ G + L+++ Q
Sbjct: 1483 KDVTGAEALLERHQ 1496



 Score =  268 bits (686), Expect = 1e-69
 Identities = 241/1022 (23%), Positives = 428/1022 (41%), Gaps = 60/1022 (5%)
 Frame = -1

Query: 6465 VQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEK 6286
            +Q F RD ++   W+ +++  L ++D G  L++V+AL +KHE  E+ L+A E K+  L++
Sbjct: 551  LQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDE 610

Query: 6285 EAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISW 6106
             A KL + +    E +  + D   +  NAL E+AQ R+  LE SF L +F  D  +L SW
Sbjct: 611  FATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFFRDSDELKSW 670

Query: 6105 IGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESP 5926
            I + K     DE  KD +  +  ++ HQ  + E+ A     +    +GQ L+E     S
Sbjct: 671  INE-KMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQDLLERKHYASS 729

Query: 5925 EVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLG 5746
            EV  ++E+ + +                     Q F R+ E  E W+ + E  LA+ D G
Sbjct: 730  EVARRMEEANQQ---------------------QQFNRNVEDIELWLYEVEGHLASDDYG 768

Query: 5745 DSLDSVEHLIKKHEDFEKSLAA-------------------------------------- 5680
              L SV++L KKH   E  +AA
Sbjct: 769  KDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQTSPALRPQLREGGRGVCVGLLRVDSL 828

Query: 5679 --QEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQ 5506
               +++I+ +   A +  +  H+ AD++                    R   L +S + Q
Sbjct: 829  ISSQDRIDGISIQARQFQEAGHFDADNIRRKQEALGVRYEGVRQPMATRKQKLSDSLRLQ 888

Query: 5505 TFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENRLDDIRSTG 5329
               RD ++  +WI EK   A   +   D   ++  L+KH   + E+  +E R+  +   G
Sbjct: 889  QLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKG 948

Query: 5328 EQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLS 5149
            E +++ GHFA + +  +L +++  W+ L    +++   L ++   QQ+  +  + E+W+
Sbjct: 949  ETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMR 1008

Query: 5148 ELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVI 4969
            E E  V S DYGKD  S + L KK   + SD +           L QQ    E   A +
Sbjct: 1009 EKEPIVGSTDYGKDEDSAEALLKKHEALMSDLS-----------LRQQHPGPEGAGAVLQ 1057

Query: 4968 VRKQENLQQRYNALRDP-LEKRKRKLGESHQGNQLFRDIED-ELAWIREKEQVAG----- 4810
             R Q        A RDP LE+++    +   G +L   + D +    RE     G
Sbjct: 1058 GRTQPFTLTGTPARRDPLLEQQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTL 1117

Query: 4809 --STNRG------RDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFL--- 4663
              STN+        D +G       ++    + ++ ++ +E   S A    Q  + L
Sbjct: 1118 LNSTNKDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLLEEHGSIALRQDQIENQLVTK 1177

Query: 4662 -APEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGST 4486
             A  +  ++ Q+ + +  L    EKR+  L+ S +      +ANE   W+ EKE  + +
Sbjct: 1178 EACSVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFREANELQQWIHEKEGTLTNE 1237

Query: 4485 DYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLALYD 4306
            + G D +  E L KK      DL+A +  + D+ K A+          +L  + ++A
Sbjct: 1238 EVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAA----------ELESEGLMA--- 1284

Query: 4305 YQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQV 4126
              E++P   + ++ ++L                   G  P       +  +  ++ +  V
Sbjct: 1285 --EETPMVQAQQQQELL-------------------GAAPGKDEADSKTASPWKNVRLAV 1323

Query: 4125 NSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEI 3946
             +           +  +  L E R   L  A +  +  R+A++  EWI+ +
Sbjct: 1324 QTTA--------NFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNY 1375

Query: 3945 GTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNAR 3766
            G DL  V+ LQ+K + F+ DL A   ++  + + A  L      E    I+++  +LN
Sbjct: 1376 GHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQ-SHPEAVEDIKEKCSELNTA 1434

Query: 3765 WRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRK 3586
            W +L         +L ++H++QRF  D  +   WI      + SE+  +D+   +AL  +
Sbjct: 1435 WSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLER 1494

Query: 3585 HE 3580
            H+
Sbjct: 1495 HQ 1496



 Score =  256 bits (655), Expect = 4e-66
 Identities = 232/991 (23%), Positives = 428/991 (42%), Gaps = 69/991 (6%)
 Frame = -1

Query: 4098 IEDKYQRLMMLGETRKRKLEEACKGYQLL-REANDLAEWIKSREAVAAQQEIGTDLEQVE 3922
            + ++ + L+ L E R+++ E+ C   QL  R+   +  W+  +EA    +++G  L+ VE
Sbjct: 527  LSEEKEALLNLWEVRRQQYEQ-CMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVE 585

Query: 3921 VLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQ-TETAVRIRQQIEDLNARWRALXXX 3745
             L KK +DF+  L A E ++  +++ AT L       +  V  R+  + L +R  AL
Sbjct: 586  ALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRR--DALLSRRNALHER 643

Query: 3744 XXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERD 3565
                   L  +  +Q+F RD DE + WI EK      E + +D  ++Q   +KH+  E +
Sbjct: 644  AQSRRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAY-KDPSNLQGKVQKHQAFEAE 702

Query: 3564 LAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQ--WNRLTSKAN---NRKEKLL 3400
            L+A   +I +L +    L +    A+ ++     E N+Q  +NR            E  L
Sbjct: 703  LSANQSRIDALQKSGQDLLERKHYASSEVARRMEEANQQQQFNRNVEDIELWLYEVEGHL 762

Query: 3399 DSYDYQRFLSDYRDLMQWIASMNQLVSSQEL----ANDVTGAEALLERHQEYRT------ 3250
             S DY + L+  ++L +  A +   V++ ++     + V  + AL  + +E
Sbjct: 763  ASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQTSPALRPQLREGGRGVCVGL 822

Query: 3249 -EIDSRAATFQAFDQFG---NQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILD 3082
              +DS  ++    D       Q   + H+ A +I  + + +    +G+      R+  L
Sbjct: 823  LRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRRKQEALGVRYEGVRQPMATRKQKLS 882

Query: 3081 QCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIK 2908
              L LQ  +RD E  +TW+  +E   A  +   D   V++L+KKH+     I   E +IK
Sbjct: 883  DSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEPRIK 942

Query: 2907 GLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADE 2728
             +    E++++  H+    V  K  ++  RW+ LK    Q++  L +S   QQ+  DA+E
Sbjct: 943  AVTQKGETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQYFADANE 1002

Query: 2727 IENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAEL-----HANSDRIAAIIQAGNNL 2566
             E+WM EK  I    +Y +D  + +   +K +A  ++L     H   +   A++Q
Sbjct: 1003 AESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSLRQQHPGPEGAGAVLQGRTQP 1062

Query: 2565 IENAKCGGGEAAVSARLKALNDQWDLL-VKTTTEKSYRLKEANKQKSFMAAVKDLEFWLG 2389
                          AR   L +Q  +      T K   L   + Q+    + +++    G
Sbjct: 1063 FTLT-------GTPARRDPLLEQQQVAPTDDETGKELVLALYDYQEK---SPREVTMKKG 1112

Query: 2388 EVEILLQSEDYGKDLASVE-----NLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQF 2224
            ++  LL S +  KD   VE       +    + + D      R   + E     L  DQ
Sbjct: 1113 DILTLLNSTN--KDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLLEEHGSIALRQDQI 1170

Query: 2223 QGQQIAE-------RRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK 2065
            + Q + +       R K + + Y  + ++   R+D L K+      FR+ ++ + WI EK
Sbjct: 1171 ENQLVTKEACSVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFREANELQQWIHEK 1230

Query: 2064 KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLV-----KLKGEELLRSAAE-- 1906
            +  +++++ G DL  V+ L++K      +L ++E ++  +     +L+ E L+
Sbjct: 1231 EGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELESEGLMAEETPMV 1290

Query: 1905 ----------AGVGEDQIKKRMED----------LEQSWGQIRDLTGNRHQRLDESEAFQ 1786
                      A  G+D+   +                ++  I+ L  +R   L  +   Q
Sbjct: 1291 QAQQQQELLGAAPGKDEADSKTASPWKNVRLAVQTTANFNTIKQLAEDRSHMLGSAHEVQ 1350

Query: 1785 AFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKG 1606
             F  D +E + W+ EK Q L +DN+G ++A VQ L +KH+ F+ DL     +V  L
Sbjct: 1351 RFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETA 1410

Query: 1605 DTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIA 1426
            + LI +       IK++C +L      +   A+ R  KL ++    +F+     + SWI
Sbjct: 1411 ERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWIN 1470

Query: 1425 EKEQQVRSEDFGRDLSSVQILLTKQEAFDAG 1333
                 V SE+  +D++  + LL + +    G
Sbjct: 1471 GIRGLVSSEELAKDVTGAEALLERHQVGGCG 1501



 Score =  248 bits (633), Expect = 2e-63
 Identities = 137/396 (34%), Positives = 218/396 (54%)
 Frame = -1

Query: 2841 KRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTN 2662
            +R Q+LDR+   KE  + +R KL +S   Q F RDA+E+E W+ EK QIA +ENY+DP+N
Sbjct: 18   RRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQIASDENYKDPSN 77

Query: 2661 IQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLV 2482
            +Q K QK QAFEAE+ AN+  I  + + GN +I           + +RL+ L+  WDLL+
Sbjct: 78   LQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFAS--ETIRSRLEELHRLWDLLL 135

Query: 2481 KTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLE 2302
            + T EK  RL +A K   ++   +D   W+ + E +  SE+ G+DL  VE L KK    +
Sbjct: 136  QKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKKFEEFQ 195

Query: 2301 ADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKAL 2122
             D+ AH++RV E+N+ A  L++    + + I  ++  +   +  +K +A  R+ +L  A
Sbjct: 196  TDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQQRQGRLFGAA 255

Query: 2121 NVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVK 1942
             V +F RD+D+  SWIKE+  L+ SDD+GRD   VQ L RKH  ++ +LA+ E +V+ +
Sbjct: 256  EVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALEDKVNTL- 314

Query: 1941 LKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEE 1762
              G +  R          QI  + ++L  +W QIR L  +             F  D  +
Sbjct: 315  --GGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGEPRFTADFRD 372

Query: 1761 EEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQV 1654
              +W+ E Q ++ +D    ++AG + LL +H   +V
Sbjct: 373  LTSWVTEMQALIKADELANDVAGAEALLDRHQEHKV 408



 Score =  234 bits (597), Expect = 2e-59
 Identities = 125/290 (43%), Positives = 180/290 (61%)
 Frame = -1

Query: 4122 SIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIG 3943
            +I  +  E+   +  L+   + +  +L +A K  Q LRE  D  +WI  +EA+A  +E+G
Sbjct: 119  TIRSRLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELG 178

Query: 3942 TDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARW 3763
             DLE VE+LQKKF++F+ DL A+E R+ E+NQ+A  L      E  + +R+Q +++NA W
Sbjct: 179  QDLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQ-DEVNAAW 237

Query: 3762 RALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKH 3583
            + L         +L  A EVQRF+RDVDET  WI+E+   + S+DFGRD  SVQAL RKH
Sbjct: 238  QRLKGLAQQRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKH 297

Query: 3582 EGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKL 3403
            EG+ERDLAAL DK+ +L   A RL+++HP+ A QI   + EL   W ++ + A +
Sbjct: 298  EGLERDLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAW 357

Query: 3402 LDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYR 3253
                   RF +D+RDL  W+  M  L+ + ELANDV GAEALL+RHQE++
Sbjct: 358  TTPTGEPRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQEHK 407



 Score =  233 bits (595), Expect = 4e-59
 Identities = 204/969 (21%), Positives = 407/969 (41%), Gaps = 84/969 (8%)
 Frame = -1

Query: 3459 LNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEA 3280
            L+E+   L +    R+++     D Q F  D   +  W++     + +++L + +   EA
Sbjct: 527  LSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEA 586

Query: 3279 LLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVA 3100
            LL++H+++   + ++     A D+F  +L+ ++HYA  D+  R   +   R  L +   +
Sbjct: 587  LLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQS 646

Query: 3099 RRNILDQCLELQLFYRDCEQADTWMSAREAFLAQE---DPSGDNVESLIKKHEDFDKAIN 2929
            RR  L+    LQ F+RD ++  +W++ +      E   DPS  N++  ++KH+ F+  ++
Sbjct: 647  RRAALEDSFHLQQFFRDSDELKSWINEKMKTATDEAYKDPS--NLQGKVQKHQAFEAELS 704

Query: 2928 TQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQ 2749
              + +I  L+   + L++  HY S  V R+ +                     E+   QQ
Sbjct: 705  ANQSRIDALQKSGQDLLERKHYASSEVARRME---------------------EANQQQQ 743

Query: 2748 FSRDADEIENWMTE-KFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS--DRIAAIIQA 2578
            F+R+ ++IE W+ E +  +A ++  +D T++Q   +K    EA++ A+    +    +Q
Sbjct: 744  FNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQT 803

Query: 2577 GNNLIENAKCGGGEAAVSA------------------------------------RLKAL 2506
               L    + GG    V                                      + +AL
Sbjct: 804  SPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRRKQEAL 863

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
              +++ + +    +  +L ++ + +     V+D E W+ E E +  S + GKDL  V+NL
Sbjct: 864  GVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNL 923

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDR 2146
            LKKH  L+A+IV H+ R+  + ++ ++++E   F G+ +  +   +  R+D +K  A+ R
Sbjct: 924  LKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQR 983

Query: 2145 RDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASH 1966
            +  L  +L   Q+F D ++ ESW++EK+ +V S DYG+D    + L +KH  + ++L+
Sbjct: 984  KQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSLR 1043

Query: 1965 E----PQVSLVKLKGEELLRSAAEAGVGEDQI--KKRMEDLEQSWGQIRDLTGNRHQRLD 1804
            +    P+ +   L+G     +        D +  ++++   +   G+   L    +Q
Sbjct: 1044 QQHPGPEGAGAVLQGRTQPFTLTGTPARRDPLLEQQQVAPTDDETGKELVLALYDYQEKS 1103

Query: 1803 ESEAFQAFLGDV------EEEEAWMNEKQQILG------SDNFGENMAGV-QGLLKKHDT 1663
              E      GD+        ++ W  E    LG            N +   + LL++H +
Sbjct: 1104 PREVTMK-KGDILTLLNSTNKDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLLEEHGS 1162

Query: 1662 FQVDLELHKQRVAD-LINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLR 1486
                + L + ++ + L+ K           A  +  R  Q+      +  + E R   L
Sbjct: 1163 ----IALRQDQIENQLVTK----------EACSVSVRMKQVEELYANLLELGEKRKDMLE 1208

Query: 1485 DNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEH--E 1312
             +        + + ++ WI EKE  + +E+ G DL  V++L  K + F   L A E
Sbjct: 1209 KSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLR 1268

Query: 1311 GIQRI-TELKDQ--------LVSSEHQQ-----SPAIEKRHTNVIQRWQNL------LAH 1192
             I ++  EL+ +        +V ++ QQ     +P  ++  +     W+N+       A+
Sbjct: 1269 DINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRLAVQTTAN 1328

Query: 1191 SEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRD 1012
                +              E+   F + A     W E   + L      + L  ++AL+
Sbjct: 1329 FNTIKQLAEDRSHMLGSAHEVQ-RFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQR 1387

Query: 1011 AHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQ 832
             H  F+R L++  +    L +   R+   +             L   W +L     +R+
Sbjct: 1388 KHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKD 1447

Query: 831  ELAREHQRQ 805
            +LA  H  Q
Sbjct: 1448 KLANSHDLQ 1456



 Score =  229 bits (584), Expect = 8e-58
 Identities = 183/771 (23%), Positives = 341/771 (43%), Gaps = 90/771 (11%)
 Frame = -1

Query: 7119 RLEEARQFQYFKRDADELNVWILE-KLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHA- 6946
            R+EEA Q Q F R+ +++ +W+ E +   A ++  +D +++Q   +KH   EA+V AH
Sbjct: 734  RMEEANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQV 793

Query: 6945 ---------------------------------KTIANLDKTGNAMIQHN------HFAS 6883
                                               I++ D+     IQ        HF +
Sbjct: 794  HTQHTHSVQTSPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDA 853

Query: 6882 EHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDM 6703
            ++I+++ E L   +         +  KL  +L+L    R  ++   WIREKE    + +
Sbjct: 854  DNIRRKQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNR 913

Query: 6702 GMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAW 6523
            G DL  V+ L +K      E+  H+ RI  + Q  + +VEEGH   + +  K  +++  W
Sbjct: 914  GKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRW 973

Query: 6522 HRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKH 6343
              L   A+ RK+ L  + Q Q++  DA+E  +W+ EK+  + S DYG+D ++ +AL +KH
Sbjct: 974  DTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKH 1033

Query: 6342 EGTERDLAALE--------GKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEK 6187
            E    DL+  +        G +LQ   +   L  T P R + + ++           KE
Sbjct: 1034 EALMSDLSLRQQHPGPEGAGAVLQGRTQPFTLTGT-PARRDPLLEQQQVAPTDDETGKEL 1092

Query: 6186 AQHRKDGLERS-FQLHRFLADYRDLIS-----W----IGDMKAVIGADELAKDVAGAEAL 6037
                 D  E+S  ++     D   L++     W    + D    + A  + K      +
Sbjct: 1093 VLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRLGFVPAAYVKKLDPNQSSS 1152

Query: 6036 LESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEER 5857
             E+  E  G I  R D             ++   E+  V  ++++++   ++LL L E+R
Sbjct: 1153 RENLLEEHGSIALRQDQIEN---------QLVTKEACSVSVRMKQVEELYANLLELGEKR 1203

Query: 5856 RILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQ 5677
            + + E+     + +R+  + + W++++E  L N ++G  L+ VE L KK +DF+K L A
Sbjct: 1204 KDMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKAN 1263

Query: 5676 EEKINALDEFA------------TKLIQGQHY-------AADDVAEXXXXXXXXXXXXXX 5554
            E ++  +++ A            T ++Q Q            D A+
Sbjct: 1264 ESRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRLAV 1323

Query: 5553 XXXXRGNALKE-----------SYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIR 5410
                  N +K+           +++ Q F RD DE   WI EK      D+Y  D  +++
Sbjct: 1324 QTTANFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQ 1383

Query: 5409 GKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATN 5230
               +KH  FE++L A  ++++ +  T E++I S   A + I ++  ++N  W+ LV   +
Sbjct: 1384 ALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVGRAD 1443

Query: 5229 KKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKK 5077
            ++  KL  + + Q+F  +  D+ +W++ + G V+SE+  KD+   + L ++
Sbjct: 1444 QRKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLER 1494



 Score =  225 bits (573), Expect = 1e-56
 Identities = 134/362 (37%), Positives = 202/362 (55%), Gaps = 32/362 (8%)
 Frame = -1

Query: 7011 PSNLQAKIQKHEAFEAE--VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            P+    K+  +++   E  ++ H       D+  N ++     +     K++EEL+A
Sbjct: 1138 PAAYVKKLDPNQSSSRENLLEEHGSIALRQDQIENQLVTKEACSVSVRMKQVEELYANLL 1197

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                        L+++ K     R+ +E+  WI EKE  +T E++G DLE VE+LQ+KFD
Sbjct: 1198 ELGEKRKDM---LEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFD 1254

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHD----QIYKKRDDVNDA------------ 6526
            DF K+L  ++ R+ +IN+ A +L  EG    +    Q  ++++ +  A
Sbjct: 1255 DFQKDLKANESRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTAS 1314

Query: 6525 --------------WHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDD 6388
                          ++ +  LA  R   L  AH+VQRF+RDADET  WI EK+ AL++D+
Sbjct: 1315 PWKNVRLAVQTTANFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDN 1374

Query: 6387 YGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAA 6208
            YG DL +VQALQRKHEG ERDLAAL  K+  L + A +L ++HP+  E I +K  +   A
Sbjct: 1375 YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTA 1434

Query: 6207 WNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLES 6028
            W++L  +A  RKD L  S  L RFL+D+RDL+SWI  ++ ++ ++ELAKDV GAEALLE
Sbjct: 1435 WSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLER 1494

Query: 6027 HQ 6022
            HQ
Sbjct: 1495 HQ 1496



 Score =  222 bits (565), Expect = 1e-55
 Identities = 117/365 (32%), Positives = 207/365 (56%)
 Frame = -1

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRL 5350
            L++SY+ Q F RD +E+  WI EKL  A D++Y DP+N++GKLQKH  FE E++AN   +
Sbjct: 40   LEDSYRFQCFRRDAEELEKWIQEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAGTI 99

Query: 5349 DDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIE 5170
              +  TG  +I  GHFA++ I  RL +++ LW+ L+  T +KG +L +A    Q+ R  E
Sbjct: 100  IKLDETGNLMISEGHFASETIRSRLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECE 159

Query: 5169 DVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEE 4990
            D   W+S+ E    SE+ G+DL  V+ LQKK    ++D  AH +RV+ + QLA +  +E
Sbjct: 160  DALDWISDKEAMATSEELGQDLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQES 219

Query: 4989 HFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAG 4810
            H    +IVRKQ+ +   +  L+   ++R+ +L  + +  +  RD+++ ++WI+E+  + G
Sbjct: 220  HPEVELIVRKQDEVNAAWQRLKGLAQQRQGRLFGAAEVQRFNRDVDETISWIKERGALIG 279

Query: 4809 STNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQL 4630
            S + GRD   VQ L++K + L  ++A  + ++ ++   A  + +     A +I  K  +L
Sbjct: 280  SDDFGRDPGSVQALLRKHEGLERDLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDEL 339

Query: 4629 RDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEAL 4450
              NW  +++ A              ++ +D  +  +W++E + ++ + +   D   AEAL
Sbjct: 340  VANWEQIRTLAADATPAWTTPTGEPRFTADFRDLTSWVTEMQALIKADELANDVAGAEAL 399

Query: 4449 LKKHR 4435
            L +H+
Sbjct: 400  LDRHQ 404



 Score =  218 bits (554), Expect = 2e-54
 Identities = 225/992 (22%), Positives = 411/992 (40%), Gaps = 105/992 (10%)
 Frame = -1

Query: 4653 IRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGK 4474
            +R +L  L +    L +  E RR   +  +    +  D  + D WMS++E  + + D G
Sbjct: 520  VRVQLGILSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGD 579

Query: 4473 DEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC----KYQEQPMGQLGRDCVLALYD 4306
              DS EALLKKH      L A +  I  L + A++      Y ++ +    RD +L+  +
Sbjct: 580  SLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATR-RDALLSRRN 638

Query: 4305 --YQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIE--PGTAQQH- 4141
              ++    R  +++    L      + D  K  +N++         K      G  Q+H
Sbjct: 639  ALHERAQSRRAALEDSFHLQQFFRDS-DELKSWINEKMKTATDEAYKDPSNLQGKVQKHQ 697

Query: 4140 ---AQQQVNS--IGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKS 3976
               A+   N   I   Q   +D  +R         R++EEA +  Q  R   D+  W+
Sbjct: 698  AFEAELSANQSRIDALQKSGQDLLERKHYASSEVARRMEEANQQQQFNRNVEDIELWLYE 757

Query: 3975 REAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVR- 3799
             E   A  + G DL  V+ LQKK    + D+ A++V  Q  + + T+     Q     R
Sbjct: 758  VEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQTSPALRPQLREGGRG 817

Query: 3798 --------------------------------------IRQQIEDLNARWRALXXXXXXX 3733
                                                  IR++ E L  R+  +
Sbjct: 818  VCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRRKQEALGVRYEGVRQPMATR 877

Query: 3732 XXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAAL 3553
              +L  +  +Q+  RDV++   WI+EK+    S + G+DL  VQ L +KH+ ++ ++
Sbjct: 878  KQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGH 937

Query: 3552 GDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFL 3373
              +IK++ +K   + +    A E +     EL+ +W+ L  KA+ RK+ L DS   Q++
Sbjct: 938  EPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQYF 997

Query: 3372 SDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRA------------- 3232
            +D  +   W+     +V S +   D   AEALL++H+   +++  R
Sbjct: 998  ADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSLRQQHPGPEGAGAVLQ 1057

Query: 3231 ATFQAFDQFG-----NQLLNSHHYAAGDIENRLQGV----NEARKGLEDAWVARRNILDQ 3079
               Q F   G     + LL     A  D E   + V    +   K   +  + + +IL
Sbjct: 1058 GRTQPFTLTGTPARRDPLLEQQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTL 1117

Query: 3078 CLELQLFYRDCEQADTWMSAREAFLAQEDPS-GDNVESLIKKHEDFDKAINTQEEKIKGL 2902
                   +   E  D       A++ + DP+   + E+L+++H     +I  ++++I+
Sbjct: 1118 LNSTNKDWWKVEVNDRLGFVPAAYVKKLDPNQSSSRENLLEEHG----SIALRQDQIENQ 1173

Query: 2901 KLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIE 2722
             +  E+          +V+ +  Q+ + +  L E   +++  L +S       R+A+E++
Sbjct: 1174 LVTKEAC---------SVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLFREANELQ 1224

Query: 2721 NWMTEKF-QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCG 2545
             W+ EK   +  EE   D   ++   +K   F+ +L AN  R+  I +    L
Sbjct: 1225 QWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELESEGLMA 1284

Query: 2544 GGEAAVSARLKAL-------NDQWD-----------LLVKTTT----------EKSYRLK 2449
                 V A+ +          D+ D           L V+TT           ++S+ L
Sbjct: 1285 EETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRLAVQTTANFNTIKQLAEDRSHMLG 1344

Query: 2448 EANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVG 2269
             A++ + F     + + W+ E    L +++YG DLASV+ L +KH   E D+ A  D+V
Sbjct: 1345 SAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVN 1404

Query: 2268 EMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDD 2089
             + E A+ L+++     + I E+   +   +  +   A  R+DKL+ + ++ +F  D  D
Sbjct: 1405 SLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRFLSDFRD 1464

Query: 2088 EESWIKEKKLLVSSDDYGRDLPGVQNLRRKHR 1993
              SWI   + LVSS++  +D+ G + L  +H+
Sbjct: 1465 LMSWINGIRGLVSSEELAKDVTGAEALLERHQ 1496



 Score =  185 bits (470), Expect = 1e-44
 Identities = 128/529 (24%), Positives = 233/529 (43%), Gaps = 41/529 (7%)
 Frame = -1

Query: 7134 QTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDP-SNLQAKIQKHEAFEAEV 6958
            + +R + E+    Q F RD ++++ W+ ++      E+  D   +++A ++KHE FE  +
Sbjct: 539  EVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSL 598

Query: 6957 QAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLL 6778
             A  + I  LD+    +IQ+NH+A E +  R + L +           +   L+ +  L
Sbjct: 599  SAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQ 658

Query: 6777 HFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAA 6598
             F R  DE+  WI EK    T ++   D  +++   +K   F  EL  +Q RI+ + ++
Sbjct: 659  QFFRDSDELKSWINEKMKTAT-DEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSG 717

Query: 6597 DKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIG 6418
              L+E  H    ++ ++ ++ N                     Q Q+FNR+ ++   W+
Sbjct: 718  QDLLERKHYASSEVARRMEEAN---------------------QQQQFNRNVEDIELWLY 756

Query: 6417 EKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA-------------------------- 6316
            E +  L+SDDYG+DL +VQ LQ+KH   E D+AA
Sbjct: 757  EVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVHTQHTHSVQTSPALRPQLREGGR 816

Query: 6315 --------------LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQH 6178
                           + ++  +  +A +  E     A+ I +K +     +  +++
Sbjct: 817  GVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDADNIRRKQEALGVRYEGVRQPMAT 876

Query: 6177 RKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDA 5998
            RK  L  S +L +   D  D  +WI + + +  +    KD+ G + LL+ HQ  + EI
Sbjct: 877  RKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVG 936

Query: 5997 RADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLF 5818
                       G+ +VE G     +V+ KL +L     +L     +R+   E  +  Q +
Sbjct: 937  HEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRWDTLKLKASQRKQDLEDSLQAQQY 996

Query: 5817 YRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEE 5671
            + D  +AE+WM ++E  + +TD G   DS E L+KKHE     L+ +++
Sbjct: 997  FADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSLRQQ 1045



 Score =  169 bits (427), Expect = 1e-39
 Identities = 105/397 (26%), Positives = 198/397 (49%), Gaps = 3/397 (0%)
 Frame = -1

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
            E AE I D ++++ +++ R    +  R++KL DSY +Q F  D  +L +WI    Q ++S
Sbjct: 10   ETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQ-IAS 68

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
             E   D +  +  L++HQ +  E+ + A T    D+ GN +++  H+A+  I +RL+ ++
Sbjct: 69   DENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLEELH 128

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
                 L      +   L Q  +L  + R+CE A  W+S +EA    E+   D  +VE L
Sbjct: 129  RLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQ 188

Query: 2961 KKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKR 2782
            KK E+F   +   EE++  +   A  LI+ +H +   + RK+D++   W  LK    Q++
Sbjct: 189  KKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQQRQ 248

Query: 2781 FKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANS 2605
             +L  +  +Q+F+RD DE  +W+ E+  +   +++ RDP ++Q   +K +  E +L A
Sbjct: 249  GRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALE 308

Query: 2604 DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF 2425
            D++  +      L E       +  +  +   L   W+ +     + +        +  F
Sbjct: 309  DKVNTLGGDAGRLQETHPQNASQ--ILLKKDELVANWEQIRTLAADATPAWTTPTGEPRF 366

Query: 2424 MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKH 2314
             A  +DL  W+ E++ L+++++   D+A  E LL +H
Sbjct: 367  TADFRDLTSWVTEMQALIKADELANDVAGAEALLDRH 403



 Score =  168 bits (426), Expect = 2e-39
 Identities = 185/837 (22%), Positives = 348/837 (41%), Gaps = 49/837 (5%)
 Frame = -1

Query: 2529 VSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGK 2350
            V  +L  L+++ + L+     +  + ++    + F    + ++ W+ + E  L +ED G
Sbjct: 520  VRVQLGILSEEKEALLNLWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGD 579

Query: 2349 DLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDG 2170
             L SVE LLKKH   E  + A ++++  ++E A  L++N+ +  + +A RR  +  R +
Sbjct: 580  SLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDALLSRRNA 639

Query: 2169 VKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRR 1990
            + + A  RR  L  + ++ QFFRD D+ +SWI E K+  ++D+  +D   +Q   +KH+
Sbjct: 640  LHERAQSRRAALEDSFHLQQFFRDSDELKSWINE-KMKTATDEAYKDPSNLQGKVQKHQA 698

Query: 1989 IDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQR 1810
             + EL++++ ++  ++  G++LL     A     ++ +RME+  Q
Sbjct: 699  FEAELSANQSRIDALQKSGQDLLERKHYA---SSEVARRMEEANQQ-------------- 741

Query: 1809 LDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHK-- 1636
                   Q F  +VE+ E W+ E +  L SD++G+++  VQ L KKH   + D+  H+
Sbjct: 742  -------QQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAHQVH 794

Query: 1635 ----------------------------QRVADLINKGDTL----------IHNGNHHAP 1570
                                         RV  LI+  D +             G+  A
Sbjct: 795  TQHTHSVQTSPALRPQLREGGRGVCVGLLRVDSLISSQDRIDGISIQARQFQEAGHFDAD 854

Query: 1569 HIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFG 1390
            +I+++ + L  R   +      R  KL D+    Q     +  E+WI EKE    S + G
Sbjct: 855  NIRRKQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRG 914

Query: 1389 RDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRW 1210
            +DL  VQ LL K +A  A +   E   I+ +T+  + +V   H     ++ + T +  RW
Sbjct: 915  KDLIGVQNLLKKHQALQAEIVGHEPR-IKAVTQKGETMVEEGHFAGEDVKVKLTELHGRW 973

Query: 1209 QNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEE 1030
              L   +  R+              + Y A A +A    SW    E  +         +
Sbjct: 974  DTLKLKASQRKQDLEDSLQA-----QQYFADANEA---ESWMREKEPIVGSTDYGKDEDS 1025

Query: 1029 IRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVG-PNPYTWFTMDALEDTWRNLQR 853
              AL   H      LS      RQ         +   G   P+T     A  D     Q+
Sbjct: 1026 AEALLKKHEALMSDLS-----LRQQHPGPEGAGAVLQGRTQPFTLTGTPARRDPLLEQQQ 1080

Query: 852  IIKEREQELARE--HQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAV 679
             +   + E  +E      +  +K  RE           L +T ++  +    + ++L  V
Sbjct: 1081 -VAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKV--EVNDRLGFV 1137

Query: 678  ERK-AKEIKANKGQLRQ--IEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQ 508
                 K++  N+   R+  +EE G++  R   ++N+        ++    Q+++L   +
Sbjct: 1138 PAAYVKKLDPNQSSSRENLLEEHGSIALRQDQIENQLVTKEACSVSVRMKQVEELYANLL 1197

Query: 507  HNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEG 328
               E++     +S       RE + + + +  EK G L +++       +G DL  V+
Sbjct: 1198 ELGEKRKDMLEKSCKKFMLFREANEL-QQWIHEKEGTLTNEE-------VGSDLEQVEVL 1249

Query: 327  QPE-PEFQRILDIVDPN-RD-GYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKE 166
            Q +  +FQ+ L   +   RD   V  +     ++++ET  +Q+ ++ E+   A  K+
Sbjct: 1250 QKKFDDFQKDLKANESRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKD 1306



 Score =  165 bits (418), Expect = 1e-38
 Identities = 150/651 (23%), Positives = 269/651 (41%), Gaps = 48/651 (7%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLG-HYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEE 7024
            AD+I +R+QE LG  Y   +    T++ +L ++ + Q   RD ++   WI EK   A
Sbjct: 853  ADNI-RRKQEALGVRYEGVRQPMATRKQKLSDSLRLQQLFRDVEDEETWIREKEPIAAST 911

Query: 7023 NF-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHA 6847
            N  +D   +Q  ++KH+A +AE+  H   I  + + G  M++  HFA E +K +L ELH
Sbjct: 912  NRGKDLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHG 971

Query: 6846 LWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQR 6667
             W         +   L+ +L+   +    +E   W+REKE  V + D G D +  E L +
Sbjct: 972  RWDTLKLKASQRKQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLK 1031

Query: 6666 KFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIY---KKRDDVNDAWHRLNTLAAT 6496
            K +  + +L   Q         A   V +G ++   +     +RD + +      T   T
Sbjct: 1032 KHEALMSDLSLRQQHPGPEGAGA---VLQGRTQPFTLTGTPARRDPLLEQQQVAPTDDET 1088

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSS---DDYGRDLNN---------VQALQ 6352
             KE +   +  Q   +   E     G+    L+S   D +  ++N+         V+ L
Sbjct: 1089 GKELVLALYDYQ--EKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRLGFVPAAYVKKLD 1146

Query: 6351 RKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRK 6172
                 +  +L    G +   + +      T    + ++  K    +  +  L E  + RK
Sbjct: 1147 PNQSSSRENLLEEHGSIALRQDQIENQLVTKEACSVSVRMK--QVEELYANLLELGEKRK 1204

Query: 6171 DGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARA 5992
            D LE+S +      +  +L  WI + +  +  +E+  D+   E L +   + + ++ A
Sbjct: 1205 DMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDLKANE 1264

Query: 5991 DSFNQTASAGQKLVEMGI--PESPEVQEKLEK--------LDHEKSSLLGLW-------- 5866
                       +L   G+   E+P VQ + ++         D   S     W
Sbjct: 1265 SRLRDINKVAAELESEGLMAEETPMVQAQQQQELLGAAPGKDEADSKTASPWKNVRLAVQ 1324

Query: 5865 ------------EERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEH 5722
                        E+R  +     ++Q F+RD ++ + W+ ++   L   + G  L SV+
Sbjct: 1325 TTANFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQA 1384

Query: 5721 LIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXX 5542
            L +KHE FE+ LAA  +K+N+L E A +LIQ    A +D+ E
Sbjct: 1385 LQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSELNTAWSSLVGRADQ 1444

Query: 5541 RGNALKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKH 5392
            R + L  S+  Q F  D  +++SWI   +   + ++   D T     L++H
Sbjct: 1445 RKDKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLERH 1495



 Score =  152 bits (383), Expect = 2e-34
 Identities = 96/392 (24%), Positives = 186/392 (46%), Gaps = 1/392 (0%)
 Frame = -1

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            + I  +R  V D + R   L+  R++ L  +++ Q F RDA+E   WI EK L ++SD+
Sbjct: 13   EDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEK-LQIASDEN 71

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
             +D +N+Q   +KH+  E ++ A  G +++L++  + +       +E I  + ++    W
Sbjct: 72   YKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLEELHRLW 131

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
            + L +K + +   L ++ +L ++L +  D + WI D +A+  ++EL +D+   E L +
Sbjct: 132  DLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKKF 191

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
            +E + ++ A  +  N+      KL++   PE   +  K ++++     L GL ++R+
Sbjct: 192  EEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQQRQGRL 251

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
                ++Q F RD ++  +W+ ++ A + + D G    SV+ L++KHE  E+ LAA E+K+
Sbjct: 252  FGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALEDKV 311

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
            N L   A +L +     A  +                       A         F  D
Sbjct: 312  NTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGEPRFTADFR 371

Query: 5484 EMVSWITEKLSTARDDSYL-DPTNIRGKLQKH 5392
            ++ SW+TE  +  + D    D       L +H
Sbjct: 372  DLTSWVTEMQALIKADELANDVAGAEALLDRH 403



 Score =  150 bits (380), Expect = 3e-34
 Identities = 90/394 (22%), Positives = 201/394 (50%)
 Frame = -1

Query: 2529 VSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGK 2350
            +  R + + D++    + +  +  +L+++ + + F    ++LE W+ E   +   E+Y K
Sbjct: 15   IQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQIASDENY-K 73

Query: 2349 DLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDG 2170
            D ++++  L+KH   EA++ A+   + +++E  + ++    F  + I  R + +   +D
Sbjct: 74   DPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLEELHRLWDL 133

Query: 2169 VKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRR 1990
            + +   ++  +L +A  + Q+ R+ +D   WI +K+ + +S++ G+DL  V+ L++K
Sbjct: 134  LLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKKFEE 193

Query: 1989 IDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQR 1810
              T+LA+HE +V+ V     +L++   E+    + I ++ +++  +W +++ L   R  R
Sbjct: 194  FQTDLAAHEERVNEVNQLAAKLIQ---ESHPEVELIVRKQDEVNAAWQRLKGLAQQRQGR 250

Query: 1809 LDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQR 1630
            L  +   Q F  DV+E  +W+ E+  ++GSD+FG +   VQ LL+KH+  + DL   + +
Sbjct: 251  LFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALEDK 310

Query: 1629 VADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKC 1450
            V  L      L      +A  I  + D+L A   +I ++A          +   +F
Sbjct: 311  VNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGEPRFTADF 370

Query: 1449 DVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQE 1348
              + SW+ E +  +++++   D++  + LL + +
Sbjct: 371  RDLTSWVTEMQALIKADELANDVAGAEALLDRHQ 404



 Score =  149 bits (375), Expect = 1e-33
 Identities = 105/420 (25%), Positives = 207/420 (49%), Gaps = 10/420 (2%)
 Frame = -1

Query: 6930 LDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEI 6751
            +D TG  +++     +E I+ R +++   +         +  KL+ + +   F R  +E+
Sbjct: 1    MDTTGVKVLE----TAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEEL 56

Query: 6750 LYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHS 6571
              WI+EK   + +++   D  +++   +K   F  E+  +   I ++++  + ++ EGH
Sbjct: 57   EKWIQEK-LQIASDENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHF 115

Query: 6570 EHDQIYKKRDDVNDAWHRLNTLAATRKEGL--FGAHQVQRFNRDADETLAWIGEKDLALS 6397
              + I  + ++++  W  L  L  T+++GL    A ++ ++ R+ ++ L WI +K+   +
Sbjct: 116  ASETIRSRLEELHRLWDLL--LQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMAT 173

Query: 6396 SDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLA-ETHPDRAEAIHQKNDD 6220
            S++ G+DL +V+ LQ+K E  + DLAA E ++ ++ + A KL  E+HP+  E I +K D+
Sbjct: 174  SEELGQDLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPE-VELIVRKQDE 232

Query: 6219 TKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEA 6040
              AAW  LK  AQ R+  L  + ++ RF  D  + ISWI +  A+IG+D+  +D    +A
Sbjct: 233  VNAAWQRLKGLAQQRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQA 292

Query: 6039 LLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEE 5860
            LL  H+  + ++ A  D  N       +L E     + ++  K       K  L+  WE+
Sbjct: 293  LLRKHEGLERDLAALEDKVNTLGGDAGRLQETHPQNASQILLK-------KDELVANWEQ 345

Query: 5859 RRILYEQCMDL-------QLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHED 5701
             R L                F  D     +W+ + +A +   +L + +   E L+ +H++
Sbjct: 346  IRTLAADATPAWTTPTGEPRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQE 405



 Score =  141 bits (356), Expect = 2e-31
 Identities = 88/339 (25%), Positives = 170/339 (49%)
 Frame = -1

Query: 2217 QQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDY 2038
            + I +RR+ + DRY   K+++  RR KL  +     F RD ++ E WI+EK L ++SD+
Sbjct: 13   EDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEK-LQIASDEN 71

Query: 2037 GRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLE 1858
             +D   +Q   +KH+  + E+ ++   +  +   G  ++   +E     + I+ R+E+L
Sbjct: 72   YKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMI---SEGHFASETIRSRLEELH 128

Query: 1857 QSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLL 1678
            + W  +   T  +  RL +++    +L + E+   W+++K+ +  S+  G+++  V+ L
Sbjct: 129  RLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQ 188

Query: 1677 KKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRL 1498
            KK + FQ DL  H++RV ++      LI   +     I ++ D++ A    ++ +A+ R
Sbjct: 189  KKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLAQQRQ 248

Query: 1497 AKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFE 1318
             +L   +   +F    D   SWI E+   + S+DFGRD  SVQ LL K E  +  L A E
Sbjct: 249  GRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALE 308

Query: 1317 HEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
             + +  +     +L  +  Q +  I  +   ++  W+ +
Sbjct: 309  -DKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQI 346



 Score =  140 bits (354), Expect = 4e-31
 Identities = 88/323 (27%), Positives = 169/323 (52%)
 Frame = -1

Query: 5337 STGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEA 5158
            +TG +++++    A+ I DR +QV + +    + +  +  KL ++   Q F R+ E++E
Sbjct: 3    TTGVKVLET----AEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEK 58

Query: 5157 WLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNA 4978
            W+ E + Q+AS++  KD  ++Q   +K    E++  A+   +  + +       E HF +
Sbjct: 59   WIQE-KLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFAS 117

Query: 4977 PVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNR 4798
              I  + E L + ++ L    +++  +L ++ +  Q  R+ ED L WI +KE +A S
Sbjct: 118  ETIRSRLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEEL 177

Query: 4797 GRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNW 4618
            G+DL  V+ L KK +    ++A H+ ++  V+  A  +IQ+ H     I  K  ++   W
Sbjct: 178  GQDLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAW 237

Query: 4617 RILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKH 4438
            + LK  A++R+  L  + +  ++  D +E  +W+ E+  ++GS D+G+D  S +ALL+KH
Sbjct: 238  QRLKGLAQQRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKH 297

Query: 4437 RALLSDLEAFKGTIEDLRKQASQ 4369
              L  DL A +  +  L   A +
Sbjct: 298  EGLERDLAALEDKVNTLGGDAGR 320



 Score =  140 bits (354), Expect = 4e-31
 Identities = 95/403 (23%), Positives = 191/403 (46%), Gaps = 7/403 (1%)
 Frame = -1

Query: 4134 QQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQ 3955
            +    I  ++ ++ D+Y+R   L   R++KLE++ +     R+A +L +WI+ +  +A+
Sbjct: 10   ETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQIASD 69

Query: 3954 QEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDL 3775
            +    D   ++   +K   F+ +++AN   + ++++    + S G   +   IR ++E+L
Sbjct: 70   ENY-KDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASET-IRSRLEEL 127

Query: 3774 NARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQAL 3595
            +  W  L         +L  A ++ ++ R+ ++  DWI +K+    SE+ G+DL  V+ L
Sbjct: 128  HRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELL 187

Query: 3594 QRKHEGVERDLAALGDKIKSLDEKANRL-RQSHPEAAEQIYDLQRELNEQWNRLTSKANN 3418
            Q+K E  + DLAA  +++  +++ A +L ++SHPE  E I   Q E+N  W RL   A
Sbjct: 188  QKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEV-ELIVRKQDEVNAAWQRLKGLAQQ 246

Query: 3417 RKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDS 3238
            R+ +L  + + QRF  D  + + WI     L+ S +   D    +ALL +H+    ++ +
Sbjct: 247  RQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAA 306

Query: 3237 RAATFQAFDQFGNQLLNSHHYAAGDI----ENRLQGVNEARKGLEDAWVARRNILDQCLE 3070
                         +L  +H   A  I    +  +    + R    DA  A      +
Sbjct: 307  LEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGE--- 363

Query: 3069 LQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHED 2947
               F  D     +W++  +A +  ++ + D    E+L+ +H++
Sbjct: 364  -PRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQE 405



 Score =  138 bits (348), Expect = 2e-30
 Identities = 91/377 (24%), Positives = 174/377 (46%), Gaps = 2/377 (0%)
 Frame = -1

Query: 3831 TSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEK 3652
            T V   ETA  I+ + + +  R+R           +L  ++  Q F RD +E   WIQEK
Sbjct: 4    TGVKVLETAEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEK 63

Query: 3651 DDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYD 3472
                  E++ +D  ++Q   +KH+  E ++ A    I  LDE  N +      A+E I
Sbjct: 64   LQIASDENY-KDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRS 122

Query: 3471 LQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVT 3292
               EL+  W+ L  K   +  +LL +    ++L +  D + WI+    + +S+EL  D+
Sbjct: 123  RLEELHRLWDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLE 182

Query: 3291 GAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLED 3112
              E L ++ +E++T++ +        +Q   +L+   H     I  +   VN A + L+
Sbjct: 183  HVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKG 242

Query: 3111 AWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDK 2938
                R+  L    E+Q F RD ++  +W+  R A +  +D   D  +V++L++KHE  ++
Sbjct: 243  LAQQRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLER 302

Query: 2937 AINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQT 2758
             +   E+K+  L   A  L + +  ++  +  K+D+++  W  ++
Sbjct: 303  DLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTG 362

Query: 2757 LQQFSRDADEIENWMTE 2707
              +F+ D  ++ +W+TE
Sbjct: 363  EPRFTADFRDLTSWVTE 379



 Score =  101 bits (251), Expect = 3e-19
 Identities = 90/401 (22%), Positives = 164/401 (40%), Gaps = 40/401 (9%)
 Frame = -1

Query: 4662 APEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTD 4483
            A +I+D+  Q+ D +R  K  +  RR  L+DS +   +  DA E + W+ EK  I    +
Sbjct: 12   AEDIQDRRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQIASDEN 71

Query: 4482 YGKDEDSAEALLKKHRALLSDLEAFKGTI------------------EDLRKQASQCK-- 4363
            Y KD  + +  L+KH+A  ++++A  GTI                  E +R +  +
Sbjct: 72   Y-KDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLEELHRL 130

Query: 4362 ---------------YQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRD 4228
                            Q Q + Q  R+C  AL    +K     S + G  L  +    +
Sbjct: 131  WDLLLQKTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKK 190

Query: 4227 WWKVEVNDRQGFVPAAYVKRIEP-----GTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLG 4063
            + + + +       AA+ +R+           Q +  +V  I  KQ E+   +QRL  L
Sbjct: 191  FEEFQTD------LAAHEERVNEVNQLAAKLIQESHPEVELIVRKQDEVNAAWQRLKGLA 244

Query: 4062 ETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDL 3883
            + R+ +L  A +  +  R+ ++   WIK R A+    + G D   V+ L +K +  + DL
Sbjct: 245  QQRQGRLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDL 304

Query: 3882 KANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEV 3703
             A E ++  +   A  L      + A +I  + ++L A W  +            +
Sbjct: 305  AALEDKVNTLGGDAGRLQET-HPQNASQILLKKDELVANWEQIRTLAADATPAWTTPTGE 363

Query: 3702 QRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHE 3580
             RF  D  +   W+ E    + +++   D+   +AL  +H+
Sbjct: 364  PRFTADFRDLTSWVTEMQALIKADELANDVAGAEALLDRHQ 404



 Score =  100 bits (248), Expect = 7e-19
 Identities = 59/209 (28%), Positives = 108/209 (51%)
 Frame = -1

Query: 4962 KQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLI 4783
            +++ +  RY   ++    R++KL +S++     RD E+   WI+EK Q+A   N  +D
Sbjct: 18   RRQQVLDRYRRFKELSVMRRQKLEDSYRFQCFRRDAEELEKWIQEKLQIASDENY-KDPS 76

Query: 4782 GVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKS 4603
             +Q  ++K QA  AE+  +   I  +    N MI +GHF +  IR +L +L   W +L
Sbjct: 77   NLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETIRSRLEELHRLWDLLLQ 136

Query: 4602 KAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLS 4423
            K +++   L  + +  QYL +  +A  W+S+KE +  S + G+D +  E L KK     +
Sbjct: 137  KTKEKGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKKFEEFQT 196

Query: 4422 DLEAFKGTIEDLRKQASQCKYQEQPMGQL 4336
            DL A +  + ++ + A++   +  P  +L
Sbjct: 197  DLAAHEERVNEVNQLAAKLIQESHPEVEL 225



 Score = 98.2 bits (243), Expect = 3e-18
 Identities = 77/323 (23%), Positives = 145/323 (44%), Gaps = 32/323 (9%)
 Frame = -1

Query: 7212 ILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA-RQFQYFKRDADELNVWILEKLQT 7036
            + + A  +  R ++V   Y+   +  + ++D LE++ ++F  F R+A+EL  WI EK  T
Sbjct: 1175 VTKEACSVSVRMKQVEELYANLLELGEKRKDMLEKSCKKFMLF-REANELQQWIHEKEGT 1233

Query: 7035 -AQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLE 6859
               EE   D   ++   +K + F+ +++A+   + +++K    +      A E    + +
Sbjct: 1234 LTNEEVGSDLEQVEVLQKKFDDFQKDLKANESRLRDINKVAAELESEGLMAEETPMVQAQ 1293

Query: 6858 ELHAL-----------------WXXXXXXXXXKG----IK---------LQQALKLLHFI 6769
            +   L                 W               IK         L  A ++  F
Sbjct: 1294 QQQELLGAAPGKDEADSKTASPWKNVRLAVQTTANFNTIKQLAEDRSHMLGSAHEVQRFH 1353

Query: 6768 RQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKL 6589
            R  DE   WI EK   +  ++ G DL  V+ LQRK + F ++L     ++N + + A++L
Sbjct: 1354 RDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERL 1413

Query: 6588 VEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKD 6409
            ++      + I +K  ++N AW  L   A  RK+ L  +H +QRF  D  + ++WI
Sbjct: 1414 IQSHPEAVEDIKEKCSELNTAWSSLVGRADQRKDKLANSHDLQRFLSDFRDLMSWINGIR 1473

Query: 6408 LALSSDDYGRDLNNVQALQRKHE 6340
              +SS++  +D+   +AL  +H+
Sbjct: 1474 GLVSSEELAKDVTGAEALLERHQ 1496


>gi|7441355|pir||S61217 spectrin alpha II chain - rat (fragment)
          Length = 819

 Score =  883 bits (2282), Expect = 0.0
 Identities = 452/820 (55%), Positives = 577/820 (70%), Gaps = 37/820 (4%)
 Frame = -1

Query: 4134 QQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQ 3955
            ++  S+  +  ++E+ YQ L+ LGE RK  LE++CK + L REAN+L +WI  +EA
Sbjct: 3    KEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTS 62

Query: 3954 QEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ---- 3787
            +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G     V+  QQ
Sbjct: 63   EEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVY 122

Query: 3786 -------------------------------IEDLNARWRALXXXXXXXXXQLGSAHEVQ 3700
                                           I++LN RWR+L          LGSAHEVQ
Sbjct: 123  GMMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQ 182

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
            RFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAALGDK+ SL E A
Sbjct: 183  RFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETA 242

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA 3340
             RL QSHPE+AE + +   ELN+ W  L  +A+ RK KL DS+D QRFLSD+RDLM WI
Sbjct: 243  QRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWIN 302

Query: 3339 SMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDI 3160
             +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL   HYA+ +I
Sbjct: 303  GIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEI 362

Query: 3159 ENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP--S 2986
            + +L  +++ R  LE AWV RR +LD CLELQLF+RDCEQA+ WM+AREAFL  ED   S
Sbjct: 363  KEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDS 422

Query: 2985 GDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGL 2806
             D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI  +HY    +  +R+++LDRW  L
Sbjct: 423  LDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRL 482

Query: 2805 KEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFE 2626
            K  +I+KR KLGESQTLQQFSRD DEIE W++EK Q A +E+Y+DPTNIQ KHQK QAFE
Sbjct: 483  KAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFE 542

Query: 2625 AELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKE 2446
            AELHAN+DRI  +I  GN+LIE   C G E AV ARL AL DQW  LV+ + EKS +LKE
Sbjct: 543  AELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKE 602

Query: 2445 ANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGE 2266
            ANKQ++F   +KD +FWL EVE LL SEDYGKD ASV    +K  LLE DI AH+DR+ +
Sbjct: 603  ANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRLKD 662

Query: 2265 MNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDE 2086
            +N QAD L+ +  F   Q+ E+R  I  R+  +K MAT RR KLS++  +HQFFRD+DDE
Sbjct: 663  LNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDE 722

Query: 2085 ESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAE 1906
            ESWIKEKKLLVSS+DYGRDL GVQNLR+KH+R++ ELA+HEP +  V   G++L   + +
Sbjct: 723  ESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKL---SDD 779

Query: 1905 AGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQ 1786
              +G+++I++R+    + W +++ L   R QRL+ES  +Q
Sbjct: 780  NTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQ 819



 Score =  609 bits (1571), Expect = e-172
 Identities = 335/810 (41%), Positives = 478/810 (58%), Gaps = 38/810 (4%)
 Frame = -1

Query: 6876 IKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGM 6697
            +  R++++  L+         +   L+++ K     R+ +E+  WI EKE  +T+E++G
Sbjct: 8    VSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGA 67

Query: 6696 DLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEG-HSEHDQIYKKRD------- 6541
            DLE VE+LQ+KFDDF K+L  ++ R+ +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 68   DLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPR 127

Query: 6540 ----------------------------DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
                                        ++N+ W  L  LA  R + L  AH+VQRF+RD
Sbjct: 128  DEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRD 187

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
            ADET  WI EK+ AL++D+YG DL +VQALQRKHEG ERDLAAL  K+  L + A +L +
Sbjct: 188  ADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQ 247

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
            +HP+ AE + +K  +   AW +L ++A  RK  L  S  L RFL+D+RDL+SWI  ++ +
Sbjct: 248  SHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGL 307

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            + +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G   SPE++EKL+
Sbjct: 308  VSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLD 367

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             LD E++ L   W +RR++ + C++LQLF+RD EQAE WM  +EAFL   D GDSLDSVE
Sbjct: 368  ILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVE 427

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXX 5545
             LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D+A
Sbjct: 428  ALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRLKAQMI 487

Query: 5544 XRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKA 5365
             + + L ES   Q F RD DE+ +WI+EKL TA D+SY DPTNI+ K QKH  FE EL A
Sbjct: 488  EKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHA 547

Query: 5364 NENRLDDIRSTGEQIIDSGHFAA--DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
            N +R+  +   G  +I+ G  A   D +  RL  + + W  LV  + +K  KL+EA  +Q
Sbjct: 548  NADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQ 607

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
             FN  I+D + WLSE+E  +ASEDYGKD  SV    +K  L+E D +AH DR+  +   A
Sbjct: 608  NFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRLKDLNSQA 667

Query: 5010 QQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIR 4831
                    F+   +  K++ +  R+  ++     R+ KL ESH+ +Q FRD++DE +WI+
Sbjct: 668  DDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIK 727

Query: 4830 EKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEI 4651
            EK+ +  S + GRDL GVQNL KK + L AE+A H+  I+ V      +         EI
Sbjct: 728  EKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEI 787

Query: 4650 RDKLAQLRDNWRILKSKAEKRRTDLDDSLQ 4561
            + +LAQ  ++W+ LK  A  R   L++SL+
Sbjct: 788  QQRLAQFVEHWKELKQLAAARGQRLEESLE 817



 Score =  307 bits (787), Expect = 2e-81
 Identities = 189/782 (24%), Positives = 381/782 (48%), Gaps = 42/782 (5%)
 Frame = -1

Query: 3690 RDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRL 3511
            R+ +E + WI EK+ AL SE+ G DL  V+ LQ+K +  ++DL A   ++K +++ A  L
Sbjct: 44   REANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDL 103

Query: 3510 RQSHPEAAEQIYDLQ-------------------------------------RELNEQWN 3442
             +S    AE++  +Q                                     +ELNE+W
Sbjct: 104  -ESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWR 162

Query: 3441 RLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQ 3262
             L   A  R + L  +++ QRF  D  +  +WI   NQ +++    +D+   +AL  +H+
Sbjct: 163  SLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHE 222

Query: 3261 EYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILD 3082
             +  ++ +      +  +   +L+ SH  +A D++ +   +N+A   L      R+  L
Sbjct: 223  GFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLG 282

Query: 3081 QCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIK 2908
               +LQ F  D     +W++     ++ ++ + D    E+L+++H++    I+ +    +
Sbjct: 283  DSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQ 342

Query: 2907 GLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADE 2728
              + F + L+ + HY SP +  K D +      L++A +Q+R  L     LQ F RD ++
Sbjct: 343  AFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQ 402

Query: 2727 IENWMTEKFQIAQEENYRDPTN-IQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAK 2551
             ENWM  +      E+  D  + ++   +K + F+  ++   ++IAA+    + LI
Sbjct: 403  AENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDH 462

Query: 2550 CGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILL 2371
               G+  ++ R   + D+W  L     EK  +L E+   + F   V ++E W+ E
Sbjct: 463  YAKGD--IANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTA 520

Query: 2370 QSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKL 2191
              E Y KD  ++++  +KH   EA++ A+ DR+  + +  +SL+E     G + A + +L
Sbjct: 521  SDESY-KDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 579

Query: 2190 --IADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGV 2017
              +AD++  + + + ++  KL +A     F   I D + W+ E + L++S+DYG+D   V
Sbjct: 580  AALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASV 639

Query: 2016 QNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIR 1837
                +K + ++ ++++HE ++  +  + ++L+ S+A       Q+K++ + +   + +I+
Sbjct: 640  NQPAQKAQLLEDDISAHEDRLKDLNSQADDLMTSSA---FDTSQVKEKRDTINGRFQKIK 696

Query: 1836 DLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQ 1657
             +  +R  +L ES     F  D+++EE+W+ EK+ ++ S+++G ++ GVQ L KKH   +
Sbjct: 697  SMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLE 756

Query: 1656 VDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNS 1477
             +L  H+  +  +++ G  L  +       I+QR  Q      E++ +A  R  +L ++
Sbjct: 757  AELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESL 816

Query: 1476 AY 1471
             Y
Sbjct: 817  EY 818



 Score =  293 bits (751), Expect = 3e-77
 Identities = 219/823 (26%), Positives = 398/823 (47%), Gaps = 9/823 (1%)
 Frame = -1

Query: 3621 RDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWN 3442
            ++  SV    ++ E + + L  LG+K K + EK+ +      EA E    LQ+ +NE+
Sbjct: 3    KEAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANE----LQQWINEKEA 58

Query: 3441 RLTSK---ANNRKEKLLDSY--DYQRFLSDYRDLMQWIASMNQLVSSQEL-ANDVTGAEA 3280
             LTS+   A+  + ++L     D+Q+ L      ++ I  + + + S+ L A +V   +
Sbjct: 59   ALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQ 118

Query: 3279 LLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVA 3100
                    R E DS+ A+      + +  L  H  A     N ++ +NE  + L+
Sbjct: 119  QEVYGMMPRDEADSKTAS-----PWKSARLMVHTVATF---NSIKELNERWRSLQQLAEE 170

Query: 3099 RRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINT 2926
            R  +L    E+Q F+RD ++   W+  +   L  ++   D  +V++L +KHE F++ +
Sbjct: 171  RSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAA 230

Query: 2925 QEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQF 2746
              +K+  L   A+ LI+++   +  +  K  ++   W  L +   Q++ KLG+S  LQ+F
Sbjct: 231  LGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRF 290

Query: 2745 SRDADEIENWMTE-KFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNN 2569
              D  ++ +W+   +  ++ +E  +D T  +   ++ Q    E+ A +    A  Q G
Sbjct: 291  LSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQ 350

Query: 2568 LIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLG 2389
            L+ +      E  +  +L  L+ +   L K   ++   L    + + F    +  E W+
Sbjct: 351  LLAHGHYASPE--IKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMA 408

Query: 2388 EVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQI 2209
              E  L +ED G  L SVE L+KKH   +  I   ++++  +   AD L+  D +    I
Sbjct: 409  AREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDI 468

Query: 2208 AERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRD 2029
            A RR  + DR+  +K    ++R KL ++  + QF RD+D+ E+WI EK L  +SD+  +D
Sbjct: 469  ANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEK-LQTASDESYKD 527

Query: 2028 LPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSW 1849
               +Q+  +KH+  + EL ++  ++  V   G  L+   A AG  ED +K R+  L   W
Sbjct: 528  PTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAG-SEDAVKARLAALADQW 586

Query: 1848 GQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKH 1669
              +   +  + Q+L E+   Q F   +++ + W++E + +L S+++G++ A V    +K
Sbjct: 587  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKA 646

Query: 1668 DTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKL 1489
               + D+  H+ R+ DL ++ D L+ +       +K++ D +  R  +I+SMA  R AKL
Sbjct: 647  QLLEDDISAHEDRLKDLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 706

Query: 1488 RDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEG 1309
             ++    QF    D  ESWI EK+  V SED+GRDL+ VQ L  K +  +A L A E
Sbjct: 707  SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHE-PA 765

Query: 1308 IQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR 1180
            IQ + +   +L          I++R    ++ W+ L   + AR
Sbjct: 766  IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAAR 808



 Score =  282 bits (722), Expect = 8e-74
 Identities = 184/767 (23%), Positives = 362/767 (46%), Gaps = 41/767 (5%)
 Frame = -1

Query: 6570 EHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSD 6391
            E   +  +   V + +  L  L   RK  L  + +     R+A+E   WI EK+ AL+S+
Sbjct: 4    EAGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSE 63

Query: 6390 DYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETH--PDRAEAIHQKN--- 6226
            + G DL  V+ LQ+K +  ++DL A E ++  + K A  L       +  +A+ Q+
Sbjct: 64   EVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYG 123

Query: 6225 ------DDTKAA-------------------------WNALKEKAQHRKDGLERSFQLHR 6139
                   D+K A                         W +L++ A+ R   L  + ++ R
Sbjct: 124  MMPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQR 183

Query: 6138 FLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
            F  D  +   WI +    +  D    D+A  +AL   H+  + ++ A  D  N      Q
Sbjct: 184  FHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQ 243

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
            +L++     + +++EK  +L+   +SL    ++R+       DLQ F  D     +W+N
Sbjct: 244  RLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWING 303

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
                +++ +L   +   E L+++H++    + A+     A ++F  +L+   HYA+ ++
Sbjct: 304  IRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIK 363

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK---LSTARDDSYL 5428
            E                  R   L    + Q F RDC++  +W+  +   L+T      L
Sbjct: 364  EKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSL 423

Query: 5427 DPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNE 5248
            D  ++   ++KH +F++ +   E ++  +++  +Q+I   H+A   I +R  +V + W
Sbjct: 424  D--SVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRR 481

Query: 5247 LVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGL 5068
            L     +K +KL E+   QQF+R+++++EAW+SE + Q AS++  KD  ++Q+  +K
Sbjct: 482  LKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQA 540

Query: 5067 IESDFNAHNDRVDGIKQLAQQFQEEEHF--NAPVIVRKQENLQQRYNALRDPLEKRKRKL 4894
             E++ +A+ DR+ G+  +     E      +   +  +   L  ++  L     ++ +KL
Sbjct: 541  FEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKL 600

Query: 4893 GESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQI 4714
             E+++       I+D   W+ E E +  S + G+D   V    +K Q L  +I+ H+ ++
Sbjct: 601  KEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRL 660

Query: 4713 ESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDAN 4534
            + ++S A+D++    F   ++++K   +   ++ +KS A  RR  L +S + HQ+  D +
Sbjct: 661  KDLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMD 720

Query: 4533 EADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIE 4393
            + ++W+ EK+ +V S DYG+D    + L KKH+ L ++L A +  I+
Sbjct: 721  DEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQ 767



 Score =  253 bits (646), Expect = 5e-65
 Identities = 195/818 (23%), Positives = 363/818 (43%), Gaps = 73/818 (8%)
 Frame = -1

Query: 5298 ADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASED 5119
            A  +  R++QV  L+  L++   K+   L ++  +    R   +++ W++E E  + SE+
Sbjct: 5    AGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEE 64

Query: 5118 YGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPV-IVRKQE---- 4954
             G DL  V+ LQKK    + D  A+  R+  I ++A+  + E      V  V++QE
Sbjct: 65   VGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGM 124

Query: 4953 -------------------------------NLQQRYNALRDPLEKRKRKLGESHQGNQL 4867
                                            L +R+ +L+   E+R + LG +H+  +
Sbjct: 125  MPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRF 184

Query: 4866 FRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAND 4687
             RD ++   WI EK Q   + N G DL  VQ L +K +    ++A    ++ S+   A
Sbjct: 185  HRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQR 244

Query: 4686 MIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEK 4507
            +IQ     A ++++K  +L   W  L  +A++R+  L DS    ++LSD  +  +W++
Sbjct: 245  LIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGI 304

Query: 4506 EPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC------------- 4366
              +V S +  KD   AEALL++H+   ++++A  GT +   +   Q
Sbjct: 305  RGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKE 364

Query: 4365 -------------KYQEQPMGQLGRDCVLALYDYQ-EKSPREVSMKKGDVLTLLNASNRD 4228
                         K   Q    L     L L+    E++   ++ ++  + T     + D
Sbjct: 365  KLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLD 424

Query: 4227 WWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQV-------NSIGGKQSEIEDKYQRLMM 4069
              +  +   + F  A  V+  +    Q  A Q +         I  +++E+ D+++RL
Sbjct: 425  SVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRLKA 484

Query: 4068 LGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKG 3889
                ++ KL E+    Q  R+ +++  WI S +   A  E   D   ++   +K   F+
Sbjct: 485  QMIEKRSKLGESQTLQQFSRDVDEIEAWI-SEKLQTASDESYKDPTNIQSKHQKHQAFEA 543

Query: 3888 DLKANEVRLQEMNQIATALTSVGQ---TETAVRIRQQIEDLNARWRALXXXXXXXXXQLG 3718
            +L AN  R++ +  +  +L   G    +E AV+ R  +  L  +W+ L         +L
Sbjct: 544  ELHANADRIRGVIDMGNSLIERGACAGSEDAVKAR--LAALADQWQFLVQKSAEKSQKLK 601

Query: 3717 SAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIK 3538
             A++ Q F+  + +   W+ E +  L SED+G+D  SV    +K + +E D++A  D++K
Sbjct: 602  EANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRLK 661

Query: 3537 SLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRD 3358
             L+ +A+ L  S      Q+ + +  +N ++ ++ S A +R+ KL +S+   +F  D  D
Sbjct: 662  DLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDD 721

Query: 3357 LMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHH 3178
               WI     LVSS++   D+TG + L ++H+    E+ +     Q     G +L + +
Sbjct: 722  EESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNT 781

Query: 3177 YAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQ 3064
                +I+ RL    E  K L+    AR   L++ LE Q
Sbjct: 782  IGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQ 819



 Score =  232 bits (592), Expect = 9e-59
 Identities = 166/664 (25%), Positives = 299/664 (45%), Gaps = 39/664 (5%)
 Frame = -1

Query: 6249 AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADE 6070
            A ++  +    +  + +L E  + RK  LE+S +      +  +L  WI + +A + ++E
Sbjct: 5    AGSVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEE 64

Query: 6069 LAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGI--PESPEVQEK----- 5911
            +  D+   E L +   + + ++ A            + L   G+   E   VQ++
Sbjct: 65   VGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGM 124

Query: 5910 -----------------------------LEKLDHEKSSLLGLWEERRILYEQCMDLQLF 5818
                                         +++L+    SL  L EER  L     ++Q F
Sbjct: 125  MPRDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRF 184

Query: 5817 YRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATK 5638
            +RD ++ + W+ ++   L   + G  L SV+ L +KHE FE+ LAA  +K+N+L E A +
Sbjct: 185  HRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQR 244

Query: 5637 LIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITE- 5461
            LIQ    +A+D+ E                  R   L +S+  Q F  D  +++SWI
Sbjct: 245  LIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGI 304

Query: 5460 KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGD 5281
            +   + D+   D T     L++H     E+ A           G+Q++  GH+A+  I +
Sbjct: 305  RGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKE 364

Query: 5280 RLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLV 5101
            +L  ++    +L  A  ++   L      Q F+R+ E  E W++  E  + +ED G  L
Sbjct: 365  KLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLD 424

Query: 5100 SVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRD 4921
            SV+ L KK    +   N   +++  ++  A Q    +H+    I  ++  +  R+  L+
Sbjct: 425  SVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRLKA 484

Query: 4920 PLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIA 4741
             + +++ KLGES    Q  RD+++  AWI EK Q A S    +D   +Q+  +K QA  A
Sbjct: 485  QMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTA-SDESYKDPTNIQSKHQKHQAFEA 543

Query: 4740 EIANHDSQIESVSSAANDMIQQGHFLAPE--IRDKLAQLRDNWRILKSKAEKRRTDLDDS 4567
            E+  +  +I  V    N +I++G     E  ++ +LA L D W+ L  K+ ++   L ++
Sbjct: 544  ELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEA 603

Query: 4566 LQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDL 4387
             +   + +   + D W+SE E ++ S DYGKD  S     +K + L  D+ A +  ++DL
Sbjct: 604  NKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRLKDL 663

Query: 4386 RKQA 4375
              QA
Sbjct: 664  NSQA 667



 Score =  229 bits (584), Expect = 8e-58
 Identities = 165/650 (25%), Positives = 293/650 (44%), Gaps = 5/650 (0%)
 Frame = -1

Query: 7137 SQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAE 6961
            ++ +   L  A + Q F RDADE   WI EK Q    +N+  D +++QA  +KHE FE +
Sbjct: 168  AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD 227

Query: 6960 VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKL 6781
            + A    + +L +T   +IQ +  ++E +K++  EL+  W         +  KL  +  L
Sbjct: 228  LAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDL 287

Query: 6780 LHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQA 6601
              F+    +++ WI      V+++++  D+   E L  +  +   E+           Q
Sbjct: 288  QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQF 347

Query: 6600 ADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWI 6421
              +L+  GH    +I +K D ++     L      R+  L    ++Q F+RD ++   W+
Sbjct: 348  GQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMMLDHCLELQLFHRDCEQAENWM 407

Query: 6420 GEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAE 6244
              ++  L+++D G  L++V+AL +KHE  ++ +   E K+  L+  A +L A  H  + +
Sbjct: 408  AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIALDHYAKGD 467

Query: 6243 AIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELA 6064
              +++N +    W  LK +   ++  L  S  L +F  D  ++ +WI + K    +DE
Sbjct: 468  IANRRN-EVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESY 525

Query: 6063 KDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPE--VQEKLEKLDHE 5890
            KD    ++  + HQ  + E+ A AD        G  L+E G     E  V+ +L  L  +
Sbjct: 526  KDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQ 585

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L+    E+    ++    Q F    +  + W+++ EA LA+ D G    SV    +K
Sbjct: 586  WQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQK 645

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
             +  E  ++A E+++  L+  A  L+    +    V E                  R
Sbjct: 646  AQLLEDDISAHEDRLKDLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAK 705

Query: 5529 LKESYKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
            L ES++   F RD D+  SWI E KL  + +D   D T ++   +KH   E EL A+E
Sbjct: 706  LSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPA 765

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREA 5203
            +  +  TG+++ D      + I  RL Q    W EL      +G +L E+
Sbjct: 766  IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEES 815



 Score =  211 bits (537), Expect = 2e-52
 Identities = 122/351 (34%), Positives = 189/351 (53%), Gaps = 2/351 (0%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            DI  RR EVL  +   K     KR +L E++  Q F RD DE+  WI EKLQTA +E+++
Sbjct: 467  DIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYK 526

Query: 7014 DPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEH--IKKRLEELHALW 6841
            DP+N+Q+K QKH+AFEAE+ A+A  I  +   GN++I+    A     +K RL  L   W
Sbjct: 527  DPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQW 586

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KL++A K  +F     +  +W+ E E  + +ED G D   V    +K
Sbjct: 587  QFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDHASVNQPAQKA 646

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 ++  H+ R+ ++N  AD L+     +  Q+ +KRD +N  + ++ ++A +R+  L
Sbjct: 647  QLLEDDISAHEDRLKDLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMATSRRAKL 706

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +H++ +F RD D+  +WI EK L +SS+DYGRDL  VQ L++KH+  E +LAA E  +
Sbjct: 707  SESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAI 766

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQ 6148
              +     KL++ +    E I Q+       W  LK+ A  R   LE S +
Sbjct: 767  QGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLE 817



 Score =  210 bits (534), Expect = 5e-52
 Identities = 188/828 (22%), Positives = 358/828 (42%), Gaps = 65/828 (7%)
 Frame = -1

Query: 2532 AVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYG 2353
            +VS R+K + + +  L++   ++   L+++ K+        +L+ W+ E E  L SE+ G
Sbjct: 7    SVSLRMKQVEELYQSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVG 66

Query: 2352 KDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL----LENDQFQGQQIAE------ 2203
             DL  VE L KK    + D+ A++ R+ ++N+ A+ L    L  ++ Q  Q  E
Sbjct: 67   ADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMP 126

Query: 2202 --------------------------RRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
                                        K + +R+  ++++A +R   L  A  V +F R
Sbjct: 127  RDEADSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHR 186

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D D+ + WI+EK   +++D+YG DL  VQ L+RKH   + +LA+   +V+ +    + L+
Sbjct: 187  DADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLI 246

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
            +S  E+    + +K++  +L Q+W  +      R  +L +S   Q FL D  +  +W+N
Sbjct: 247  QSHPESA---EDLKEKCTELNQAWTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWING 303

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
             + ++ SD   +++ G + LL++H   + +++            G  L+ +G++ +P IK
Sbjct: 304  IRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIK 363

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWK-CDVVESWIAEKEQQVRSEDFGRD 1384
            ++ D L     ++E     R   L D+   LQ   + C+  E+W+A +E  + +ED G
Sbjct: 364  EKLDILDQERTDLEKAWVQRRMML-DHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDS 422

Query: 1383 LSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQN 1204
            L SV+ L+ K E FD  +N  E E I  +    DQL++ +H     I  R   V+ RW+
Sbjct: 423  LDSVEALIKKHEDFDKAINVQE-EKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRR 481

Query: 1203 LLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFEN-----AEEDLTDPVRCNS 1039
            L A    +R              +    F++      +W        ++E   DP
Sbjct: 482  LKAQMIEKRSKLGE--------SQTLQQFSRDVDEIEAWISEKLQTASDESYKDPT---- 529

Query: 1038 LEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI--KSFNVGPNPYTWFTMDALEDTWR 865
               I++    H  F+  L +  +  R + D+   +  +    G        + AL D W+
Sbjct: 530  --NIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQ 587

Query: 864  NLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEM-MEAGGTLEEQL 688
             L +   E+ Q+L   +++Q  N  ++         F  WL+     +  E  G     +
Sbjct: 588  FLVQKSAEKSQKLKEANKQQNFNTGIK--------DFDFWLSEVEALLASEDYGKDHASV 639

Query: 687  DAVERKAK----EIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLA 520
            +   +KA+    +I A++ +L+ +  +   L  +   D    +     I   + ++  +A
Sbjct: 640  NQPAQKAQLLEDDISAHEDRLKDLNSQADDLMTSSAFDTSQVKEKRDTINGRFQKIKSMA 699

Query: 519  ------MRMQHNLEQQIQARN--QSGVSEEALREFSMMFKHFDKEKTG----RLDHQQFK 376
                  +   H L Q  +  +  +S + E+ L   S   + + ++ TG    R  H++ +
Sbjct: 700  TSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSS---EDYGRDLTGVQNLRKKHKRLE 756

Query: 375  SCLRALGYDLPMVDEGQPEPEFQRILD----IVDPNRDGYVTLQEYMA 244
            + L A             EP  Q +LD    + D N  G   +Q+ +A
Sbjct: 757  AELAA------------HEPAIQGVLDTGKKLSDDNTIGQEEIQQRLA 792



 Score =  153 bits (387), Expect = 5e-35
 Identities = 108/438 (24%), Positives = 194/438 (43%), Gaps = 3/438 (0%)
 Frame = -1

Query: 7128 KRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDP-SNLQAKIQKHEAFEAEVQA 6952
            +R  L+   + Q F RD ++   W+  +      E+  D   +++A I+KHE F+  +
Sbjct: 383  RRMMLDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINV 442

Query: 6951 HAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHF 6772
              + IA L    + +I  +H+A   I  R  E+   W         K  KL ++  L  F
Sbjct: 443  QEEKIAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQF 502

Query: 6771 IRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADK 6592
             R  DEI  WI EK     +++   D  +++   +K   F  EL  +  RI  +    +
Sbjct: 503  SRDVDEIEAWISEK-LQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNS 561

Query: 6591 LVEEGH--SEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIG 6418
            L+E G      D +  +   + D W  L   +A + + L  A++ Q FN    +   W+
Sbjct: 562  LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS 621

Query: 6417 EKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAI 6238
            E +  L+S+DYG+D  +V    +K +  E D++A E ++  L  +A  L  +       +
Sbjct: 622  EVEALLASEDYGKDHASVNQPAQKAQLLEDDISAHEDRLKDLNSQADDLMTSSAFDTSQV 681

Query: 6237 HQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKD 6058
             +K D     +  +K  A  R+  L  S +LH+F  D  D  SWI + K ++ +++  +D
Sbjct: 682  KEKRDTINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD 741

Query: 6057 VAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSL 5878
            + G + L + H+  + E+ A   +       G+KL +       E+Q++L +       L
Sbjct: 742  LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKEL 801

Query: 5877 LGLWEERRILYEQCMDLQ 5824
              L   R    E+ ++ Q
Sbjct: 802  KQLAAARGQRLEESLEYQ 819


>gi|12847774|dbj|BAB27703.1| unnamed protein product [Mus musculus]
          Length = 654

 Score =  802 bits (2072), Expect = 0.0
 Identities = 387/636 (60%), Positives = 494/636 (76%), Gaps = 6/636 (0%)
 Frame = -1

Query: 1899 VGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGS 1720
            +G+++I++R+    + W +++ L   R QRL+ES  +Q F+ +VEEEEAW+NEK  ++ S
Sbjct: 18   IGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVAS 77

Query: 1719 DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLR 1540
            +++G+ +A +QGLLKKH+ F+ D  +HK RV D+   G  LI   NHH  +I  +   L
Sbjct: 78   EDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLN 137

Query: 1539 ARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL 1360
             ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++++D+GRDLSSVQ LL
Sbjct: 138  GKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLL 197

Query: 1359 TKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR 1180
            TKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH ++++RW  LLA+S  R
Sbjct: 198  TKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATR 257

Query: 1179 RXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGE 1000
            +           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRCNSLEEI+ALR+AH
Sbjct: 258  KKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDA 317

Query: 999  FQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAR 820
            F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWRNLQ+IIKERE EL +
Sbjct: 318  FRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQK 377

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTNTRQE------MMEAGGTLEEQLDAVERKAKEI 658
            E +RQEENDKLR+EFA+ ANAFH W+  TR        M+E  GTLE QL+A +RK +EI
Sbjct: 378  EQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEI 437

Query: 657  KANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQAR 478
            +A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQHNLEQQIQAR
Sbjct: 438  RAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQAR 497

Query: 477  NQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRIL 298
            N +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+P+PEF+ IL
Sbjct: 498  NTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAIL 557

Query: 297  DIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTP 118
            D VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +PYVT EELY NLT
Sbjct: 558  DTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTR 617

Query: 117  EQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            EQA++C+  MKPY+D   GR +    DY +F  +LF
Sbjct: 618  EQADYCVSHMKPYVDG-KGRELPTAFDYVEFTRSLF 652



 Score =  132 bits (331), Expect = 2e-28
 Identities = 88/327 (26%), Positives = 151/327 (45%), Gaps = 10/327 (3%)
 Frame = -1

Query: 2598 IAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMA 2419
            I  ++  G  L ++   G  E  +  RL    + W  L +    +  RL+E+ + + F+A
Sbjct: 2    IQGVLDTGKKLSDDNTIGQEE--IQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVA 59

Query: 2418 AVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLL 2239
             V++ E W+ E   L+ SEDYG  LA+++ LLKKH   E D   H+DRV ++      L+
Sbjct: 60   NVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLI 119

Query: 2238 ENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKL 2059
            + +    + I+ + K +  +   ++K A  R+ KL +     QF    D  ESWI EK+
Sbjct: 120  KKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKEN 179

Query: 2058 LVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQ--VSLVKLKGEELLRSAAEAGVGEDQ 1885
             + +DDYGRDL  VQ L  K    D  L + + +   ++  LK + L    A   +
Sbjct: 180  SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLL----AAKHIQSKA 235

Query: 1884 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEA--------FQAFLGDVEEEEAWMNEKQQI 1729
            I+ R   L + W Q+   +  R ++L E+++        F  F        +W    ++
Sbjct: 236  IEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEED 295

Query: 1728 LGSDNFGENMAGVQGLLKKHDTFQVDL 1648
            L       ++  ++ L + HD F+  L
Sbjct: 296  LTDPVRCNSLEEIKALREAHDAFRSSL 322



 Score =  126 bits (316), Expect = 9e-27
 Identities = 94/340 (27%), Positives = 153/340 (44%), Gaps = 10/340 (2%)
 Frame = -1

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +  +  TG+++ D      + I  RL Q    W EL      +G +L E+   QQF  N+
Sbjct: 2    IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 61

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
            E+ EAW++E    VASEDYG  L ++Q L KK    E+DF  H DRV+ +    Q   ++
Sbjct: 62   EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 121

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
             + +   I  K + L  + + L     +RK KL E+    Q     +   +WI EKE
Sbjct: 122  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 181

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEI-ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLA 4636
             + + GRDL  VQ L+ KQ+   A + A     I ++++  + ++   H  +  I  + A
Sbjct: 182  KTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHA 241

Query: 4635 QLRDNWRILKSKAEKRRTDLDDSLQAH------QYLSDANEADA---WMSEKEPIVGSTD 4483
             L   W  L + +  R+  L ++ Q+H       +L+ A +A A   W    E  +
Sbjct: 242  SLMKRWTQLLANSATRKKKLLEA-QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPV 300

Query: 4482 YGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                 +  +AL + H A  S L + +     L +   Q K
Sbjct: 301  RCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIK 340



 Score =  124 bits (312), Expect = 3e-26
 Identities = 113/448 (25%), Positives = 196/448 (43%), Gaps = 32/448 (7%)
 Frame = -1

Query: 5538 GNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDP-TNIRGKLQKHINFEQELKAN 5362
            G  L+ES + Q F  + +E  +WI EK++    + Y D    I+G L+KH  FE +   +
Sbjct: 45   GQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVH 104

Query: 5361 ENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFN 5182
            ++R++D+ + G+ +I   +   ++I  +++ +N   ++L  A  ++ AKL E     QFN
Sbjct: 105  KDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFN 164

Query: 5181 RNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNA-HNDRVDGIKQLAQQ 5005
               + VE+W+ E E  + ++DYG+DL SVQ L  K    ++   A   + +  I  L  Q
Sbjct: 165  WKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQ 224

Query: 5004 FQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDEL------ 4843
                +H  +  I  +  +L +R+  L      RK+KL E+      FR +ED
Sbjct: 225  LLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSH---FRKVEDLFLTFAKK 281

Query: 4842 -----AWIREKEQVAGSTNRGRDLIGVQNL----------IKKQQALIAEIANHDSQIES 4708
                 +W    E+      R   L  ++ L          +   QA   ++A  D QI+S
Sbjct: 282  ASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKS 341

Query: 4707 VSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKS---------KAEKRRTDLDDSLQAH 4555
               A+N          P     +  L + WR L+          + E+RR + +D L+
Sbjct: 342  FRVASN----------PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLR-Q 390

Query: 4554 QYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA 4375
            ++   AN    W+ E      +  Y  D      ++++   L S LEA K   +++R
Sbjct: 391  EFAQHANAFHQWIQE------TRTYLLD---GSCMVEESGTLESQLEATKRKHQEIRAMR 441

Query: 4374 SQCKYQEQPMGQLGRDCVLALYDYQEKS 4291
            SQ K  E  +G    + ++    Y E S
Sbjct: 442  SQLKKIED-LGAAMEEALILDNKYTEHS 468



 Score =  124 bits (310), Expect = 4e-26
 Identities = 104/444 (23%), Positives = 186/444 (41%), Gaps = 22/444 (4%)
 Frame = -1

Query: 6921 TGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYW 6742
            TG  +   N    E I++RL +    W         +G +L+++L+   F+   +E   W
Sbjct: 8    TGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAW 67

Query: 6741 IREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHD 6562
            I EK T V +ED G  L  ++ L +K + F  +   H+ R+N++      L+++ +   +
Sbjct: 68   INEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEE 127

Query: 6561 QIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYG 6382
             I  K   +N     L   AA RK  L       +FN  AD   +WIGEK+ +L +DDYG
Sbjct: 128  NISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYG 187

Query: 6381 RDLNNVQALQRKHEGTERDLAALEGK-MLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
            RDL++VQ L  K E  +  L A + + +  +     +L      +++AI  ++      W
Sbjct: 188  RDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRW 247

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADY--------RDLISWIGDMKAVIGADELAKDVAG 6049
              L   +  RK  L  +    R + D             SW  + +  +        +
Sbjct: 248  TQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEE 307

Query: 6048 AEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHE------- 5890
             +AL E+H   +  + +    FNQ A   +++    +  +P     +E L+
Sbjct: 308  IKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKI 367

Query: 5889 -KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLAN-----TDLGDSLDSV 5728
             K   L L +E+R   E     Q F +       W+ +   +L +      + G     +
Sbjct: 368  IKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTLESQL 427

Query: 5727 EHLIKKHEDFEKSLAAQEEKINAL 5656
            E   +KH++  +++ +Q +KI  L
Sbjct: 428  EATKRKHQEI-RAMRSQLKKIEDL 450



 Score =  107 bits (268), Expect = 3e-21
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 10/312 (3%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF 7018
            ++I QR  + + H+   K  +  +  RLEE+ ++Q F  + +E   WI EK+     E++
Sbjct: 21   EEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDY 80

Query: 7017 RDP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
             D  + +Q  ++KHEAFE +   H   + ++   G  +I+ N+   E+I  +++ L+
Sbjct: 81   GDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKV 140

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  KL +    L F  + D +  WI EKE  +  +D G DL  V+ L  K
Sbjct: 141  SDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQ 200

Query: 6660 DDFLKELGNHQYR-INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            + F   L   Q   I  I    D+L+   H +   I  +   +   W +L   +ATRK+
Sbjct: 201  ETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKK 260

Query: 6483 LFGAHQVQR--------FNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTER 6328
            L  A    R        F + A    +W    +  L+       L  ++AL+  H+
Sbjct: 261  LLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRS 320

Query: 6327 DLAALEGKMLQL 6292
             L++ +    QL
Sbjct: 321  SLSSAQADFNQL 332



 Score =  102 bits (255), Expect = 1e-19
 Identities = 113/509 (22%), Positives = 213/509 (41%), Gaps = 48/509 (9%)
 Frame = -1

Query: 4125 NSIGGKQ-----SEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVA 3961
            N+IG ++     ++  + ++ L  L   R ++LEE+ +  Q +    +   WI  +  +
Sbjct: 16   NTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLV 75

Query: 3960 AQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIE 3781
            A ++ G  L  ++ L KK + F+ D   ++ R+ ++      L           I  +++
Sbjct: 76   ASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEE-NISSKMK 134

Query: 3780 DLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQ 3601
             LN +   L         +L       +F+   D    WI EK+++L ++D+GRDL SVQ
Sbjct: 135  GLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQ 194

Query: 3600 ALQRKHEGVERDLAALGDK-IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKA 3424
             L  K E  +  L A   + I ++    ++L  +    ++ I      L ++W +L + +
Sbjct: 195  TLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANS 254

Query: 3423 NNRKEKLLDSYDYQRFLSDY--------RDLMQWIASMNQLVSSQELANDVTGAEALLER 3268
              RK+KLL++  + R + D              W  +  + ++     N +   +AL E
Sbjct: 255  ATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREA 314

Query: 3267 HQEYRTEIDSRAATFQAFDQFGNQL----LNSHHYAAGDIENRLQGVNEARKGLEDAWVA 3100
            H  +R+ + S  A F    +   Q+    + S+ Y    +E            LE+ W
Sbjct: 315  HDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTME-----------ALEETWRN 363

Query: 3099 RRNIL-DQCLELQLFYRDCEQAD--------------TWMSAREAFL----AQEDPSG-- 2983
             + I+ ++ LELQ   R  E+ D               W+     +L       + SG
Sbjct: 364  LQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEESGTL 423

Query: 2982 -DNVESLIKKHEDFDKAINTQEEKIKGL-KLFAESLIKNNHYDSPAVT------RKRDQI 2827
               +E+  +KH++  +A+ +Q +KI+ L     E+LI +N Y   +         + DQ+
Sbjct: 424  ESQLEATKRKHQEI-RAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQL 482

Query: 2826 LDRWNGLKEALIQKRFKLG-ESQTLQQFS 2743
              R     E  IQ R   G   + L++FS
Sbjct: 483  GMRMQHNLEQQIQARNTTGVTEEALKEFS 511



 Score =  100 bits (248), Expect = 7e-19
 Identities = 94/448 (20%), Positives = 184/448 (40%), Gaps = 33/448 (7%)
 Frame = -1

Query: 3543 IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDY 3364
            I+ + +   +L   +    E+I     +  E W  L   A  R ++L +S +YQ+F+++
Sbjct: 2    IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 61

Query: 3363 RDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNS 3184
             +   WI     LV+S++  + +   + LL++H+ + T+              G  L+
Sbjct: 62   EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 121

Query: 3183 HHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFL 3004
            +++   +I ++++G+N     LE A   R+  LD+      F    +  ++W+  +E  L
Sbjct: 122  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 181

Query: 3003 AQEDPSGD--NVESLIKKHEDFDKAINT-QEEKIKGLKLFAESLIKNNHYDSPAVTRKRD 2833
              +D   D  +V++L+ K E FD  +   Q+E I  +    + L+   H  S A+  +
Sbjct: 182  KTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHA 241

Query: 2832 QILDRWNGLKEALIQKRFKLGESQT--------LQQFSRDADEIENWMTEKFQIAQEENY 2677
             ++ RW  L      ++ KL E+Q+           F++ A    +W         EE+
Sbjct: 242  SLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFEN-----AEEDL 296

Query: 2676 RDPT------NIQQKHQKQQAFEAEL---HANSDRIAAIIQAGNNLIENAKCGGGEAAVS 2524
             DP        I+   +   AF + L    A+ +++A +    +  I++ +
Sbjct: 297  TDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAEL----DRQIKSFRVASNPYTWF 352

Query: 2523 ARLKALNDQWDLLVKTTTEKSYRL-KEANKQ-------KSFMAAVKDLEFWLGEVEILL- 2371
              ++AL + W  L K   E+   L KE  +Q       + F         W+ E    L
Sbjct: 353  T-MEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLL 411

Query: 2370 ----QSEDYGKDLASVENLLKKHSLLEA 2299
                  E+ G   + +E   +KH  + A
Sbjct: 412  DGSCMVEESGTLESQLEATKRKHQEIRA 439



 Score = 98.2 bits (243), Expect = 3e-18
 Identities = 131/601 (21%), Positives = 240/601 (39%), Gaps = 42/601 (6%)
 Frame = -1

Query: 6621 INEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDA 6442
            I  +     KL ++     ++I ++     + W  L  LAA R + L  + + Q+F  +
Sbjct: 2    IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 61

Query: 6441 DETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAET 6262
            +E  AWI EK   ++S+DYG  L  +Q L +KHE  E D    + ++  +      L +
Sbjct: 62   EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 121

Query: 6261 HPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVI 6082
            +    E I  K        + L++ A  RK  L+ +    +F      + SWIG+ +  +
Sbjct: 122  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSL 181

Query: 6081 GADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEK 5902
              D+  +D++  + LL   +      DA   +F Q   A    ++  +  +  +Q K  +
Sbjct: 182  KTDDYGRDLSSVQTLLTKQE----TFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIE 237

Query: 5901 LDHEKSSLLGLW---------EERRIL-----YEQCMDLQL-FYRDTEQAETWMNKQEAF 5767
              H  +SL+  W          ++++L     + +  DL L F +      +W    E
Sbjct: 238  ARH--ASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEED 295

Query: 5766 LANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQ-------HYAAD 5608
            L +    +SL+ ++ L + H+ F  SL++ +   N L E   ++   +        +  +
Sbjct: 296  LTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTME 355

Query: 5607 DVAEXXXXXXXXXXXXXXXXXXRGNALKESYK-RQTFDRDCDEMVSWITEKLSTARDDSY 5431
             + E                       +E+ K RQ F +  +    WI E  +   D S
Sbjct: 356  ALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSC 415

Query: 5430 L--DPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQ-----IIDSGHFAADHIG---- 5284
            +  +   +  +L+      QE++A  ++L  I   G       I+D+ +     +G
Sbjct: 416  MVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQ 475

Query: 5283 -DRLRQV-----NNLWNELVDATNKKGAKLREAGNE--QQFNRNIEDVEAWLSELEGQVA 5128
             D+L Q+     +NL  + + A N  G    EA  E    F    +D    L+  E +
Sbjct: 476  WDQLDQLGMRMQHNL-EQQIQARNTTGV-TEEALKEFSMMFKHFDKDKSGRLNHQEFKSC 533

Query: 5127 SEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENL 4948
                G DL  V+      G  + +F A  D VD  +      QE   + A +I R+ EN+
Sbjct: 534  LRSLGYDLPMVEE-----GEPDPEFEAILDTVDPNRDGHVSLQE---YMAFMISRETENV 585

Query: 4947 Q 4945
            +
Sbjct: 586  K 586



 Score = 95.1 bits (235), Expect = 2e-17
 Identities = 109/506 (21%), Positives = 200/506 (38%), Gaps = 45/506 (8%)
 Frame = -1

Query: 3828 SVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKD 3649
            ++GQ E   R+ Q +E     W+ L         +L  + E Q+F  +V+E   WI EK
Sbjct: 17   TIGQEEIQQRLAQFVE----HWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKM 72

Query: 3648 DALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDL 3469
              + SED+G  L ++Q L +KHE  E D     D++  +      L + +    E I
Sbjct: 73   TLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSK 132

Query: 3468 QRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTG 3289
             + LN + + L   A  RK KL ++  + +F      +  WI      + + +   D++
Sbjct: 133  MKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSS 192

Query: 3288 AEALLERHQEYRTEIDSRAATFQAFDQFG--------NQLLNSHHYAAGDIENR------ 3151
             + LL + + +        A  QAF Q G        +QLL + H  +  IE R
Sbjct: 193  VQTLLTKQETF-------DAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMK 245

Query: 3150 -----LQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDP- 2989
                 L      +K L +A    R + D  L    F +     ++W    E  L   DP
Sbjct: 246  RWTQLLANSATRKKKLLEAQSHFRKVEDLFL---TFAKKASAFNSWFENAEEDLT--DPV 300

Query: 2988 ---SGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDR 2818
               S + +++L + H+ F  ++++ +     L      +       +P      + + +
Sbjct: 301  RCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEET 360

Query: 2817 WNGLKEALIQKRFKLGESQ--------TLQQFSRDADEIENWMTEKFQIAQE-------- 2686
            W  L++ + ++  +L + Q          Q+F++ A+    W+ E      +
Sbjct: 361  WRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMVEES 420

Query: 2685 ---ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQA---GNNLIENAKCGGGEAAVS 2524
               E+  + T  ++KHQ+ +A  ++L    D  AA+ +A    N   E++  G
Sbjct: 421  GTLESQLEAT--KRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVG------- 471

Query: 2523 ARLKALNDQWDLLVKTTTEKSYRLKE 2446
                 L  QWD L +      + L++
Sbjct: 472  -----LAQQWDQLDQLGMRMQHNLEQ 492



 Score = 94.7 bits (234), Expect = 3e-17
 Identities = 101/512 (19%), Positives = 206/512 (39%), Gaps = 25/512 (4%)
 Frame = -1

Query: 5988 SFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRD 5809
            S       G+KL +       E+Q++L +       L  L   R    E+ ++ Q F  +
Sbjct: 1    SIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVAN 60

Query: 5808 TEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQ 5629
             E+ E W+N++   +A+ D GD+L +++ L+KKHE FE      ++++N +      LI+
Sbjct: 61   VEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIK 120

Query: 5628 GQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLST 5449
              ++  ++++                   R   L E+     F+   D + SWI EK ++
Sbjct: 121  KNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENS 180

Query: 5448 ARDDSY-LDPTNIRGKLQKHINFEQELKA-NENRLDDIRSTGEQIIDSGHFAADHIGDRL 5275
             + D Y  D ++++  L K   F+  L+A  +  + +I +  +Q++ + H  +  I  R
Sbjct: 181  LKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARH 240

Query: 5274 RQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDV-----------EAWLSELEGQVA 5128
              +   W +L+  +  +  KL EA   Q   R +ED+            +W    E  +
Sbjct: 241  ASLMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLT 297

Query: 5127 SEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENL 4948
                   L  ++ L++      S  ++     + + +L +Q +     + P      E L
Sbjct: 298  DPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEAL 357

Query: 4947 QQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELA--------WIREKEQ--VAGS--T 4804
            ++ +  L+  +++R+ +L +  +  +    +  E A        WI+E     + GS
Sbjct: 358  EETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMV 417

Query: 4803 NRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRD 4624
                 L       K++   I  + +   +IE + +A  + +   +         LAQ
Sbjct: 418  EESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQ--- 474

Query: 4623 NWRILKSKAEKRRTDLDDSLQAHQYLSDANEA 4528
             W  L     + + +L+  +QA        EA
Sbjct: 475  QWDQLDQLGMRMQHNLEQQIQARNTTGVTEEA 506



 Score = 82.8 bits (203), Expect = 1e-13
 Identities = 81/418 (19%), Positives = 160/418 (37%), Gaps = 11/418 (2%)
 Frame = -1

Query: 1629 VADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKC 1450
            +  +++ G  L  +       I+QR  Q      E++ +A  R  +L ++  Y QF+
Sbjct: 2    IQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAAARGQRLEESLEYQQFVANV 61

Query: 1449 DVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVS 1270
            +  E+WI EK   V SED+G  L+++Q LL K EAF+      +       T  +D +
Sbjct: 62   EEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKK 121

Query: 1269 SEHQQSPAIEKRH--TNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTF 1096
            + H +     K       +   +   A  +A+                 +L F  KA
Sbjct: 122  NNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDE-----------NSAFLQFNWKADVV 170

Query: 1095 NSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSS-AEEDFRQLQDLDRRIKSFNV 919
             SW    E  L        L  ++ L      F   L +  +E    +  L  ++ +
Sbjct: 171  ESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKH 230

Query: 918  GPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLT 739
              +        +L   W  L      R+++L        + + L   FAK A+AF++W
Sbjct: 231  IQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFE 290

Query: 738  NTRQEM--------MEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDN 583
            N  +++        +E    L E  DA        +A+  QL +++ +   ++   +  N
Sbjct: 291  NAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQ---IKSFRVASN 347

Query: 582  RYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKE 409
             YT  +   + + W  L ++    +  L+++ + + ++    +   + +  F  + +E
Sbjct: 348  PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQE 405


>gi|836669|gb|AAB60364.1| alpha II spectrin [Homo sapiens]
          Length = 719

 Score =  774 bits (1999), Expect = 0.0
 Identities = 398/719 (55%), Positives = 506/719 (70%), Gaps = 60/719 (8%)
 Frame = -1

Query: 4803 NRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRD 4624
            NRG+DLIGVQNL+KK QAL AEIA H+ +I++V+   N M+++GHF A +++ KL +L
Sbjct: 1    NRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQ 60

Query: 4623 NWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLK 4444
             W  LK+KA +RR DL+DSLQA QY +DANEA++WM EKEPIVGSTDYGKDEDSAEALLK
Sbjct: 61   KWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLK 120

Query: 4443 KHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMG-QLGRDCVLALYDYQEKSPREVSMKK 4267
            KH AL+SDL A+  +I+ LR+QA  C+ Q  P   + G++ VLALYDYQEKSPREV+MKK
Sbjct: 121  KHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKK 180

Query: 4266 GDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTA--------------------- 4150
            GD+LTLLN++N+DWWKVEVNDRQGFVPAAYVK+++P  +
Sbjct: 181  GDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQEQID 240

Query: 4149 -QQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSR 3973
             Q    ++  S+  +  ++E+ Y  L+ LGE RK  LE++CK + L REAN+L +WI  +
Sbjct: 241  NQTRITKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEK 300

Query: 3972 EAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIR 3793
            EA    +E+G DLEQVEVLQKKFDDF+ DLKANE RL+++N++A  L S G     V+
Sbjct: 301  EAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAV 360

Query: 3792 QQ-----------------------------------IEDLNARWRALXXXXXXXXXQLG 3718
            QQ                                   I++LN RWR+L          LG
Sbjct: 361  QQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLG 420

Query: 3717 SAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIK 3538
            SAHEVQRFHRD DET++WI+EK+ AL+++++G DL SVQALQRKHEG ERDLAALGDK+
Sbjct: 421  SAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVN 480

Query: 3537 SLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRD 3358
            SL E A RL QSHPE+AE + +   ELN+ W+ L  +A+ RK KL DS+D QRFLSD+RD
Sbjct: 481  SLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRD 540

Query: 3357 LMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHH 3178
            LM WI  +  LVSS ELA DVTGAEALLERHQE+RTEID+RA TFQAF+QFG QLL   H
Sbjct: 541  LMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGH 600

Query: 3177 YAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQ 2998
            YA+ +I+ +L  +++ R  LE AWV RR +LDQCLELQLF+RDCEQA+ WM+AREAFL
Sbjct: 601  YASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNT 660

Query: 2997 ED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQI 2827
            ED   S D+VE+LIKKHEDFDKAIN QEEKI  L+ FA+ LI   HY    ++ +R+++
Sbjct: 661  EDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 719



 Score =  382 bits (981), Expect = e-104
 Identities = 204/462 (44%), Positives = 291/462 (62%), Gaps = 36/462 (7%)
 Frame = -1

Query: 6876 IKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGM 6697
            +  R++++  L+         +   L+++ K     R+ +E+  WI EKE  +T+E++G
Sbjct: 252  VSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGA 311

Query: 6696 DLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEG-HSEHDQIYKKRD------- 6541
            DLE VE+LQ+KFDDF K+L  ++ R+ +IN+ A+ L  EG  +E  Q  ++++
Sbjct: 312  DLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPR 371

Query: 6540 ----------------------------DVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
                                        ++N+ W  L  LA  R + L  AH+VQRF+RD
Sbjct: 372  DETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRD 431

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
            ADET  WI EK+ AL++D+YG DL +VQALQRKHEG ERDLAAL  K+  L + A +L +
Sbjct: 432  ADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQ 491

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
            +HP+ AE + +K  +   AW++L ++A  RK  L  S  L RFL+D+RDL+SWI  ++ +
Sbjct: 492  SHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGL 551

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            + +DELAKDV GAEALLE HQEH+ EIDARA +F      GQ+L+  G   SPE+++KL+
Sbjct: 552  VSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLD 611

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             LD E++ L   W +RR++ +QC++LQLF+RD EQAE WM  +EAFL   D GDSLDSVE
Sbjct: 612  ILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVE 671

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
             LIKKHEDF+K++  QEEKI AL  FA +LI   HYA  D++
Sbjct: 672  ALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDIS 713



 Score =  246 bits (629), Expect = 5e-63
 Identities = 180/731 (24%), Positives = 338/731 (45%), Gaps = 38/731 (5%)
 Frame = -1

Query: 3300 DVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKG 3121
            D+ G + LL++HQ  + EI       +A  Q GN ++   H+AA D++ +L  +N+  +
Sbjct: 5    DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 64

Query: 3120 LEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHED 2947
            L+     RR  L+  L+ Q ++ D  +A++WM  +E  +   D     D+ E+L+KKHE
Sbjct: 65   LKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEA 124

Query: 2946 FDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGE 2767
                ++     I+ L+  A+S  +     +   T K + +L  ++  +++  +   K G+
Sbjct: 125  LMSDLSAYGSSIQALREQAQSC-RQQVAPTDDETGK-ELVLALYDYQEKSPREVTMKKGD 182

Query: 2766 SQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAI 2587
              TL   +      ++W   K ++   + +     +++    Q A    L      IA
Sbjct: 183  ILTLLNSTN-----KDWW--KVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALR 235

Query: 2586 IQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKD 2407
             +  +N     K  G   +VS R+K + + +  L++   ++   L+++ K+        +
Sbjct: 236  QEQIDNQTRITKEAG---SVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANE 292

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL----L 2239
            L+ W+ E E  L SE+ G DL  VE L KK    + D+ A++ R+ ++N+ A+ L    L
Sbjct: 293  LQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGL 352

Query: 2238 ENDQFQGQQIAE--------------------------------RRKLIADRYDGVKKMA 2155
              ++ Q  Q  E                                  K + +R+  ++++A
Sbjct: 353  MAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA 412

Query: 2154 TDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTEL 1975
             +R   L  A  V +F RD D+ + WI+EK   +++D+YG DL  VQ L+RKH   + +L
Sbjct: 413  EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 472

Query: 1974 ASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESE 1795
            A+   +V+ +    E L++S  E+    + ++++  +L Q+W  +      R  +L +S
Sbjct: 473  AALGDKVNSLGETAERLIQSHPESA---EDLQEKCTELNQAWSSLGKRADQRKAKLGDSH 529

Query: 1794 AFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLI 1615
              Q FL D  +  +W+N  + ++ SD   +++ G + LL++H   + +++
Sbjct: 530  DLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFE 589

Query: 1614 NKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVES 1435
              G  L+ +G++ +P IKQ+ D L     ++E     R   L        F   C+  E+
Sbjct: 590  QFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAEN 649

Query: 1434 WIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQ 1255
            W+A +E  + +ED G  L SV+ L+ K E FD  +N  + E I  +    DQL+++ H
Sbjct: 650  WMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINV-QEEKIAALQAFADQLIAAGHYA 708

Query: 1254 SPAIEKRHTNV 1222
               I  R   V
Sbjct: 709  KGDISSRRNEV 719



 Score =  231 bits (588), Expect = 3e-58
 Identities = 174/729 (23%), Positives = 332/729 (44%), Gaps = 42/729 (5%)
 Frame = -1

Query: 6702 GMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAW 6523
            G DL  V+ L +K      E+  H+ RI  + Q  + +VEEGH   + +  K  ++N  W
Sbjct: 3    GKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKW 62

Query: 6522 HRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKH 6343
              L   A+ R++ L  + Q Q++  DA+E  +W+ EK+  + S DYG+D ++ +AL +KH
Sbjct: 63   EALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKH 122

Query: 6342 EGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGL 6163
            E    DL+A    +  L ++A    +     A    +   +   A    +EK+  R+  +
Sbjct: 123  EALMSDLSAYGSSIQALREQAQSCRQ---QVAPTDDETGKELVLALYDYQEKSP-REVTM 178

Query: 6162 ERSFQLHRFLADYRDLISW---IGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARA 5992
            ++   L    +  +D   W   + D +  + A  + K      A  E+  E +G I  R
Sbjct: 179  KKGDILTLLNSTNKDW--WKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQ 236

Query: 5991 DSF-NQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFY 5815
            +   NQT             E+  V  ++++++    SLL L E+R+ + E+     + +
Sbjct: 237  EQIDNQTRIT---------KEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLF 287

Query: 5814 RDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL 5635
            R+  + + W+N++EA L + ++G  L+ VE L KK +DF+K L A E ++  +++ A  L
Sbjct: 288  REANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDL 347

Query: 5634 IQGQHYAADDV----------------AEXXXXXXXXXXXXXXXXXXRGNALKESYKR-- 5509
             + +   A++V                 +                    N++KE  +R
Sbjct: 348  -ESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWR 406

Query: 5508 -------------------QTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHI 5389
                               Q F RD DE   WI EK      D+Y  D  +++   +KH
Sbjct: 407  SLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHE 466

Query: 5388 NFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLR 5209
             FE++L A  ++++ +  T E++I S   +A+ + ++  ++N  W+ L    +++ AKL
Sbjct: 467  GFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLG 526

Query: 5208 EAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVD 5029
            ++ + Q+F  +  D+ +W++ + G V+S++  KD+   + L ++     ++ +A
Sbjct: 527  DSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQ 586

Query: 5028 GIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIED 4849
              +Q  QQ     H+ +P I +K + L Q    L     +R+  L +  +     RD E
Sbjct: 587  AFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQ 646

Query: 4848 ELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGH 4669
               W+  +E    + ++G  L  V+ LIKK +     I   + +I ++ + A+ +I  GH
Sbjct: 647  AENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGH 706

Query: 4668 FLAPEIRDK 4642
            +   +I  +
Sbjct: 707  YAKGDISSR 715



 Score =  217 bits (552), Expect = 4e-54
 Identities = 178/774 (22%), Positives = 333/774 (42%), Gaps = 15/774 (1%)
 Frame = -1

Query: 5427 DPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNE 5248
            D   ++  L+KH   + E+  +E R+  +   G  +++ GHFAA+ +  +L ++N  W
Sbjct: 5    DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 64

Query: 5247 LVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGL 5068
            L    +++   L ++   QQ+  +  + E+W+ E E  V S DYGKD  S + L KK
Sbjct: 65   LKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEA 124

Query: 5067 IESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRK--- 4897
            + SD +A+   +  +++ AQ  +++      V     E  ++   AL D  EK  R+
Sbjct: 125  LMSDLSAYGSSIQALREQAQSCRQQ------VAPTDDETGKELVLALYDYQEKSPREVTM 178

Query: 4896 -------LGESHQGNQLFRDIEDELAWIR----EKEQVAGSTNRGRDLIGVQNLIKKQQA 4750
                   L  S   +    ++ D   ++     +K   A S +R       +NL+++Q
Sbjct: 179  KKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASR-------ENLLEEQ-- 229

Query: 4749 LIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDD 4570
                IA    QI++ +    +        A  +  ++ Q+ + +  L    EKR+  L+
Sbjct: 230  --GSIALRQEQIDNQTRITKE--------AGSVSLRMKQVEELYHSLLELGEKRKGMLEK 279

Query: 4569 SLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIED 4390
            S +      +ANE   W++EKE  + S + G D +  E L KK      DL+A +  ++D
Sbjct: 280  SCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKD 339

Query: 4389 LRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREV-SMKKGDVLTLLNASNRDWWKVE 4213
            + K A   + +            L   + Q    +EV  M   D      AS    WK
Sbjct: 340  INKVAEDLESEG-----------LMAEEVQAVQQQEVYGMMPRDETDSKTASP---WK-- 383

Query: 4212 VNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
                                   H     NSI     E+ ++++ L  L E R + L  A
Sbjct: 384  -----------------SARLMVHTVATFNSI----KELNERWRSLQQLAEERSQLLGSA 422

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
             +  +  R+A++  EWI+ +         G DL  V+ LQ+K + F+ DL A   ++  +
Sbjct: 423  HEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSL 482

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
             + A  L      E+A  ++++  +LN  W +L         +LG +H++QRF  D  +
Sbjct: 483  GETAERLIQ-SHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFLSDFRDL 541

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPE 3493
              WI      + S++  +D+   +AL  +H+    ++ A     ++ ++   +L
Sbjct: 542  MSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHY 601

Query: 3492 AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQ 3313
            A+ +I      L+++   L      R+  L    + Q F  D      W+A+    ++++
Sbjct: 602  ASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAENWMAAREAFLNTE 661

Query: 3312 ELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENR 3151
            +  + +   EAL+++H+++   I+ +     A   F +QL+ + HYA GDI +R
Sbjct: 662  DKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSR 715



 Score =  216 bits (550), Expect = 7e-54
 Identities = 162/688 (23%), Positives = 297/688 (42%), Gaps = 39/688 (5%)
 Frame = -1

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
            G+DL  VQ L +KH+  + ++A  E ++  + ++ + + E     AE +  K  +    W
Sbjct: 3    GKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKW 62

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
             ALK KA  R+  LE S Q  ++ AD  +  SW+ + + ++G+ +  KD   AEALL+ H
Sbjct: 63   EALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKH 122

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKL--EKLDHEKSSLLGLWEERRI 5851
            +    ++ A   S        Q   +   P   E  ++L     D+++ S   +  ++
Sbjct: 123  EALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGD 182

Query: 5850 LYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEE 5671
            +          +   E  +       A++   D   S  S E+L+++    + S+A ++E
Sbjct: 183  ILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSA-SRENLLEE----QGSIALRQE 237

Query: 5670 KINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRD 5491
            +I+       +        A  V+                   R   L++S K+    R+
Sbjct: 238  QIDNQTRITKE--------AGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFRE 289

Query: 5490 CDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIID 5314
             +E+  WI EK +    +    D   +    +K  +F+++LKANE+RL DI    E +
Sbjct: 290  ANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLES 349

Query: 5313 SGHFAADHIG------------------------------------DRLRQVNNLWNELV 5242
             G  A +                                       + ++++N  W  L
Sbjct: 350  EGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQ 409

Query: 5241 DATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIE 5062
                ++   L  A   Q+F+R+ ++ + W+ E    + +++YG DL SVQ LQ+K    E
Sbjct: 410  QLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFE 469

Query: 5061 SDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESH 4882
             D  A  D+V+ + + A++  +    +A  +  K   L Q +++L    ++RK KLG+SH
Sbjct: 470  RDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSH 529

Query: 4881 QGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVS 4702
               +   D  D ++WI     +  S    +D+ G + L+++ Q    EI       ++
Sbjct: 530  DLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFE 589

Query: 4701 SAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADA 4522
                 ++  GH+ +PEI+ KL  L      L+    +RR  LD  L+   +  D  +A+
Sbjct: 590  QFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAEN 649

Query: 4521 WMSEKEPIVGSTDYGKDEDSAEALLKKH 4438
            WM+ +E  + + D G   DS EAL+KKH
Sbjct: 650  WMAAREAFLNTEDKGDSLDSVEALIKKH 677



 Score =  200 bits (508), Expect = 5e-49
 Identities = 152/610 (24%), Positives = 266/610 (42%), Gaps = 45/610 (7%)
 Frame = -1

Query: 6063 KDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKS 5884
            KD+ G + LL+ HQ  + EI             G  +VE G   + +V+ KL +L+ +
Sbjct: 4    KDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWE 63

Query: 5883 SLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHE 5704
            +L     +RR   E  +  Q ++ D  +AE+WM ++E  + +TD G   DS E L+KKHE
Sbjct: 64   ALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHE 123

Query: 5703 DFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXX--XXXXXRGNA 5530
                 L+A    I AL E A    Q      D+  +                    +G+
Sbjct: 124  ALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDI 183

Query: 5529 L-------KESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQEL 5371
            L       K+ +K +  DR      +++ +KL  A+  S  +    +G     I   QE
Sbjct: 184  LTLLNSTNKDWWKVEVNDRQGFVPAAYV-KKLDPAQSASRENLLEEQGS----IALRQEQ 238

Query: 5370 KANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
              N+ R+                 A  +  R++QV  L++ L++   K+   L ++  +
Sbjct: 239  IDNQTRITK--------------EAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKF 284

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
               R   +++ W++E E  + SE+ G DL  V+ LQKK    + D  A+  R+  I ++A
Sbjct: 285  MLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVA 344

Query: 5010 QQFQEEEHFNAPV-IVRKQE-----------------------------------NLQQR 4939
            +  + E      V  V++QE                                    L +R
Sbjct: 345  EDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNER 404

Query: 4938 YNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKK 4759
            + +L+   E+R + LG +H+  +  RD ++   WI EK Q   + N G DL  VQ L +K
Sbjct: 405  WRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRK 464

Query: 4758 QQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTD 4579
             +    ++A    ++ S+   A  +IQ     A ++++K  +L   W  L  +A++R+
Sbjct: 465  HEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAK 524

Query: 4578 LDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGT 4399
            L DS    ++LSD  +  +W++    +V S +  KD   AEALL++H+   ++++A  GT
Sbjct: 525  LGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGT 584

Query: 4398 IEDLRKQASQ 4369
             +   +   Q
Sbjct: 585  FQAFEQFGQQ 594



 Score =  200 bits (508), Expect = 5e-49
 Identities = 162/719 (22%), Positives = 306/719 (42%), Gaps = 41/719 (5%)
 Frame = -1

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            +D   +Q  ++KH+A +AE+  H   I  + + GNAM++  HFA+E +K +L EL+  W
Sbjct: 4    KDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWE 63

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +   L+ +L+   +    +E   W+REKE  V + D G D +  E L +K +
Sbjct: 64   ALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHE 123

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG-- 6484
              + +L  +   I  + + A    ++     D+  K+       +   +    T K+G
Sbjct: 124  ALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDI 183

Query: 6483 --LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALE 6310
              L  +     +  + ++   ++           Y + L+  Q+  R++   E+   AL
Sbjct: 184  LTLLNSTNKDWWKVEVNDRQGFVPAA--------YVKKLDPAQSASRENLLEEQGSIALR 235

Query: 6309 GKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLA 6130
             + +  +    K        A ++  +    +  +++L E  + RK  LE+S +
Sbjct: 236  QEQIDNQTRITK-------EAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFR 288

Query: 6129 DYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEI---DARADSFNQTA---- 5971
            +  +L  WI + +A + ++E+  D+   E L +   + + ++   ++R    N+ A
Sbjct: 289  EANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLE 348

Query: 5970 SAGQKLVEMGIPESPEVQ-----------------------------EKLEKLDHEKSSL 5878
            S G    E+   +  EV                                +++L+    SL
Sbjct: 349  SEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSL 408

Query: 5877 LGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDF 5698
              L EER  L     ++Q F+RD ++ + W+ ++   L   + G  L SV+ L +KHE F
Sbjct: 409  QQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGF 468

Query: 5697 EKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKES 5518
            E+ LAA  +K+N+L E A +LIQ    +A+D+ E                  R   L +S
Sbjct: 469  ERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDS 528

Query: 5517 YKRQTFDRDCDEMVSWITE-KLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDI 5341
            +  Q F  D  +++SWI   +   + D+   D T     L++H     E+ A
Sbjct: 529  HDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAF 588

Query: 5340 RSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVE 5161
               G+Q++  GH+A+  I  +L  ++    +L  A  ++   L +    Q F+R+ E  E
Sbjct: 589  EQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLELQLFHRDCEQAE 648

Query: 5160 AWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHF 4984
             W++  E  + +ED G  L SV+ L KK    +   N   +++  ++  A Q     H+
Sbjct: 649  NWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHY 707



 Score =  188 bits (478), Expect = 1e-45
 Identities = 151/685 (22%), Positives = 298/685 (43%), Gaps = 40/685 (5%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            A+D+  +  E+   +   K  +  +R  LE++ Q Q +  DA+E   W+ EK       +
Sbjct: 48   AEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTD 107

Query: 7020 F-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHAL 6844
            + +D  + +A ++KHEA  +++ A+  +I  L +   +  Q      +   K L  + AL
Sbjct: 108  YGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKEL--VLAL 165

Query: 6843 WXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRK 6664
            +           +K    L LL+   + D     + +++ +V A  +   L+  +   R
Sbjct: 166  YDYQEKSPREVTMKKGDILTLLNSTNK-DWWKVEVNDRQGFVPAAYV-KKLDPAQSASR- 222

Query: 6663 FDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
             ++ L+E G+   R  +I+       E G      +  +   V + +H L  L   RK
Sbjct: 223  -ENLLEEQGSIALRQEQIDNQTRITKEAG-----SVSLRMKQVEELYHSLLELGEKRKGM 276

Query: 6483 LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGK 6304
            L  + +     R+A+E   WI EK+ AL+S++ G DL  V+ LQ+K +  ++DL A E +
Sbjct: 277  LEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESR 336

Query: 6303 MLQLEKEAHKLAETH--PDRAEAIHQKN---------DDTKAA----------------- 6208
            +  + K A  L       +  +A+ Q+           D+K A
Sbjct: 337  LKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFN 396

Query: 6207 --------WNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVA 6052
                    W +L++ A+ R   L  + ++ RF  D  +   WI +    +  D    D+A
Sbjct: 397  SIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLA 456

Query: 6051 GAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLG 5872
              +AL   H+  + ++ A  D  N      ++L++     + ++QEK  +L+   SSL
Sbjct: 457  SVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGK 516

Query: 5871 LWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEK 5692
              ++R+       DLQ F  D     +W+N     +++ +L   +   E L+++H++
Sbjct: 517  RADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRT 576

Query: 5691 SLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYK 5512
             + A+     A ++F  +L+   HYA+ ++ +                  R   L +  +
Sbjct: 577  EIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCLE 636

Query: 5511 RQTFDRDCDEMVSWITEK---LSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDI 5341
             Q F RDC++  +W+  +   L+T      LD  ++   ++KH +F++ +   E ++  +
Sbjct: 637  LQLFHRDCEQAENWMAAREAFLNTEDKGDSLD--SVEALIKKHEDFDKAINVQEEKIAAL 694

Query: 5340 RSTGEQIIDSGHFAADHIGDRLRQV 5266
            ++  +Q+I +GH+A   I  R  +V
Sbjct: 695  QAFADQLIAAGHYAKGDISSRRNEV 719



 Score =  186 bits (472), Expect = 7e-45
 Identities = 161/709 (22%), Positives = 296/709 (41%), Gaps = 34/709 (4%)
 Frame = -1

Query: 2976 VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEA 2797
            V++L+KKH+     I   E +IK +     ++++  H+ +  V  K  ++  +W  LK
Sbjct: 9    VQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAK 68

Query: 2796 LIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAE 2620
              Q+R  L +S   QQ+  DA+E E+WM EK  I    +Y +D  + +   +K +A  ++
Sbjct: 69   ASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSD 128

Query: 2619 LHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEAN 2440
            L A    I A+ +   +  +       E      L   + Q     + T +K   L   N
Sbjct: 129  LSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLN 188

Query: 2439 KQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMN 2260
                        ++W  EV             A V+ L    S    +++  Q  +
Sbjct: 189  STNK--------DWWKVEVN----DRQGFVPAAYVKKLDPAQSASRENLLEEQGSIALRQ 236

Query: 2259 EQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEES 2080
            EQ D+     +  G  ++ R K + + Y  + ++   R+  L K+      FR+ ++ +
Sbjct: 237  EQIDNQTRITKEAGS-VSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQ 295

Query: 2079 WIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEEL----LRSA 1912
            WI EK+  ++S++ G DL  V+ L++K      +L ++E ++  +    E+L    L +
Sbjct: 296  WINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAEDLESEGLMAE 355

Query: 1911 AEAGVGEDQIKKRM-----------------------------EDLEQSWGQIRDLTGNR 1819
                V + ++   M                             ++L + W  ++ L   R
Sbjct: 356  EVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLAEER 415

Query: 1818 HQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELH 1639
             Q L  +   Q F  D +E + W+ EK Q L +DN+G ++A VQ L +KH+ F+ DL
Sbjct: 416  SQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDLAAL 475

Query: 1638 KQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFM 1459
              +V  L    + LI +    A  ++++C +L      +   A+ R AKL D+    +F+
Sbjct: 476  GDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRKAKLGDSHDLQRFL 535

Query: 1458 WKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQ 1279
                 + SWI      V S++  +D++  + LL + +     ++A      Q   +   Q
Sbjct: 536  SDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDA-RAGTFQAFEQFGQQ 594

Query: 1278 LVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKAST 1099
            L++  H  SP I+++   + Q   +L      RR              EL L F +
Sbjct: 595  LLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMMLDQCL-------ELQL-FHRDCEQ 646

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQ 952
              +W    E  L    + +SL+ + AL   H +F ++++  EE    LQ
Sbjct: 647  AENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQ 695



 Score =  159 bits (403), Expect = 7e-37
 Identities = 141/659 (21%), Positives = 270/659 (40%), Gaps = 42/659 (6%)
 Frame = -1

Query: 2676 RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQ 2497
            +D   +Q   +K QA +AE+  +  RI A+ Q GN ++E       +  V A+L  LN +
Sbjct: 4    KDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAED--VKAKLHELNQK 61

Query: 2496 WDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKK 2317
            W+ L    +++   L+++ + + + A   + E W+ E E ++ S DYGKD  S E LLKK
Sbjct: 62   WEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKK 121

Query: 2316 HSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDK 2137
            H  L +D+ A+   +  + EQA S     Q         ++L+   YD  +K   +   K
Sbjct: 122  HEALMSDLSAYGSSIQALREQAQSC--RQQVAPTDDETGKELVLALYDYQEKSPREVTMK 179

Query: 2136 ------LSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTEL 1975
                  L  + N   +  +++D + ++           Y + L   Q+  R++      L
Sbjct: 180  KGDILTLLNSTNKDWWKVEVNDRQGFVPAA--------YVKKLDPAQSASREN------L 225

Query: 1974 ASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESE 1795
               +  ++L + + +   R   EAG     +  RM+ +E+ +  + +L   R   L++S
Sbjct: 226  LEEQGSIALRQEQIDNQTRITKEAG----SVSLRMKQVEELYHSLLELGEKRKGMLEKSC 281

Query: 1794 AFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLI 1615
                   +  E + W+NEK+  L S+  G ++  V+ L KK D FQ DL+ ++ R+ D+
Sbjct: 282  KKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDIN 341

Query: 1614 NKGDTLIHNG------------------------------------NHHAPHIKQRCDQL 1543
               + L   G                                      H         +L
Sbjct: 342  KVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKEL 401

Query: 1542 RARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQIL 1363
              R   ++ +AE R   L       +F    D  + WI EK Q + ++++G DL+SVQ L
Sbjct: 402  NERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQAL 461

Query: 1362 LTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEA 1183
              K E F+  L A   + +  + E  ++L+ S  + +  ++++ T + Q W +L   ++
Sbjct: 462  QRKHEGFERDLAAL-GDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQ 520

Query: 1182 RRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHG 1003
            R+            + +             SW       ++       +    AL + H
Sbjct: 521  RKAKLGDSHDLQRFLSDF--------RDLMSWINGIRGLVSSDELAKDVTGAEALLERHQ 572

Query: 1002 EFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQEL 826
            E +  + +    F+  +   +++ +     +P     +D L+    +L++   +R   L
Sbjct: 573  EHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMML 631



 Score =  127 bits (318), Expect = 5e-27
 Identities = 132/648 (20%), Positives = 267/648 (40%), Gaps = 38/648 (5%)
 Frame = -1

Query: 2355 GKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRY 2176
            GKDL  V+NLLKKH  L+A+I  H+ R+  + ++ ++++E   F  + +  +   +  ++
Sbjct: 3    GKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKW 62

Query: 2175 DGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKH 1996
            + +K  A+ RR  L  +L   Q+F D ++ ESW++EK+ +V S DYG+D    + L +KH
Sbjct: 63   EALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKH 122

Query: 1995 RRIDTELASHEPQVSLVKLKGEELLRSAA--EAGVGEDQIKKRMEDLEQSWGQIRDLTGN 1822
              + ++L+++   +  ++ + +   +  A  +   G++ +    +  E+S    R++T
Sbjct: 123  EALMSDLSAYGSSIQALREQAQSCRQQVAPTDDETGKELVLALYDYQEKS---PREVTMK 179

Query: 1821 RHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE----NMAGVQGLLKKHDTFQV 1654
            +   L    +       VE     +N++Q  + +    +      A  + LL++    Q
Sbjct: 180  KGDILTLLNSTNKDWWKVE-----VNDRQGFVPAAYVKKLDPAQSASRENLLEE----QG 230

Query: 1653 DLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSA 1474
             + L ++++        T I      A  +  R  Q+      +  + E R   L  +
Sbjct: 231  SIALRQEQI-----DNQTRI---TKEAGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCK 282

Query: 1473 YLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEH--EGIQR 1300
                  + + ++ WI EKE  + SE+ G DL  V++L  K + F   L A E   + I +
Sbjct: 283  KFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINK 342

Query: 1299 ITE-------LKDQLVSSEHQQSPAI---EKRHTNVIQRWQN--LLAHSEARRXXXXXXX 1156
            + E       + +++ + + Q+   +   ++  +     W++  L+ H+ A
Sbjct: 343  VAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVHTVATFNSIKELN 402

Query: 1155 XXXXQIEEL-------------YLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALR 1015
                 +++L                F + A     W E   + L      + L  ++AL+
Sbjct: 403  ERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQ 462

Query: 1014 DAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKERE 835
              H  F+R L++  +    L +   R+   +             L   W +L +   +R+
Sbjct: 463  RKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQAWSSLGKRADQRK 522

Query: 834  QELAREHQRQEENDKLRREFAKLANAFHAWLTNTR-----QEMMEAGGTLEEQLDAVERK 670
             +L   H  Q    +   +F  L     +W+   R      E+ +     E  L+  +
Sbjct: 523  AKLGDSHDLQ----RFLSDFRDLM----SWINGIRGLVSSDELAKDVTGAEALLERHQEH 574

Query: 669  AKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQ 526
              EI A  G  +  E+ G  L         +  +++  I Q  D LDQ
Sbjct: 575  RTEIDARAGTFQAFEQFGQQL-------LAHGHYASPEIKQKLDILDQ 615



 Score = 89.0 bits (219), Expect = 2e-15
 Identities = 90/381 (23%), Positives = 166/381 (42%), Gaps = 10/381 (2%)
 Frame = -1

Query: 1716 NFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRA 1537
            N G+++ GVQ LLKKH   Q ++  H+ R+  +  KG+ ++  G+  A  +K +  +L
Sbjct: 1    NRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQ 60

Query: 1536 RLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLT 1357
            +   +++ A  R   L D+    Q+    +  ESW+ EKE  V S D+G+D  S + LL
Sbjct: 61   KWEALKAKASQRRQDLEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLK 120

Query: 1356 KQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARR 1177
            K EA  + L+A+       I  L++Q  S   Q +P  ++    ++      LA  + +
Sbjct: 121  KHEALMSDLSAYG----SSIQALREQAQSCRQQVAPTDDETGKELV------LALYDYQE 170

Query: 1176 XXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEI----RALRDA 1009
                        I  L        ST   W++    D    V    ++++     A R+
Sbjct: 171  KSPREVTMKKGDILTLL------NSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASREN 224

Query: 1008 HGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQE 829
              E Q S++  +E       + +   S ++         M  +E+ + +L  + ++R+
Sbjct: 225  LLEEQGSIALRQEQIDNQTRITKEAGSVSL--------RMKQVEELYHSLLELGEKRKGM 276

Query: 828  LAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMM--EAGGTLEEQLDAVERK----A 667
            L    ++  +   L RE    AN    W+      +   E G  L EQ++ +++K
Sbjct: 277  L----EKSCKKFMLFRE----ANELQQWINEKEAALTSEEVGADL-EQVEVLQKKFDDFQ 327

Query: 666  KEIKANKGQLRQIEEKGAMLE 604
            K++KAN+ +L+ I +    LE
Sbjct: 328  KDLKANESRLKDINKVAEDLE 348


>gi|31209523|ref|XP_313728.1| ENSANGP00000017034 [Anopheles gambiae]
 gi|21297077|gb|EAA09222.1| ENSANGP00000017034 [Anopheles gambiae str.
            PEST]
          Length = 4091

 Score =  766 bits (1977), Expect = 0.0
 Identities = 575/2301 (24%), Positives = 1047/2301 (44%), Gaps = 59/2301 (2%)
 Frame = -1

Query: 7128 KRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDP-SNLQAKIQKHEAFEAEVQA 6952
            K  +L++  + Q F R+AD+++          + ++  +   +++A +++H  FE  + A
Sbjct: 1308 KEKKLQQCIELQIFNREADKIDATTKSHEAYLEYDDLGNSLDDVEAIMKRHIDFENSLGA 1367

Query: 6951 HAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHF 6772
              K + N  +  + +I++NH+ + +I  R  ++ A           +   LQ +     F
Sbjct: 1368 QDKILKNFSEGADRLIRNNHYNATYIDDRRGQVLARRERVKELAQKRRNALQASKDFQKF 1427

Query: 6771 IRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADK 6592
                D++  W+ +K T + +++   DL ++    +K   F +EL  ++ ++  +N+  +
Sbjct: 1428 SSDVDDLNRWLADK-TKIASDESYKDLSNLPRKLQKHKAFERELRANEGQLRMVNKEGES 1486

Query: 6591 LVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEK 6412
            L++  ++   ++ +    +N  W  L   +  +   L  A   +  NR  +++ +   E
Sbjct: 1487 LIKT-NNRAGEVSETLAAINQNWKDLVATSLDKGRRLEQAALQREHNRYIEDSKSKFEEL 1545

Query: 6411 DLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQ 6232
            D AL S   G DL + + L  KH+  E D+A  E K+ +L     ++A      A  I
Sbjct: 1546 DHALQSKQVGNDLRSCKELMNKHQVLENDIALWEQKVAELVTTGEEMAHEGHFDANNIQN 1605

Query: 6231 KNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVA 6052
            +    +A +  LK  A+ R+D L+ S + H+F+ +    + WI +      ++ + +++
Sbjct: 1606 ETKKLQAQFAGLKTPARQRRDALDESLRFHKFVFELDTELQWINEHLPAAKSEVIGQNLH 1665

Query: 6051 GAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLG 5872
             A++L + H++ + EI+      N+T ++ + L+    PE  +V+E    L+   + L
Sbjct: 1666 QAQSLSKKHKKLEAEIEGHQPMINKTLTSAENLINQNHPERAKVKELCNSLEKAWADLQE 1725

Query: 5871 LWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEK 5692
               ER    E  +  Q +  D  + ETW+ ++   L ++D G   DS   L+ KH+  E
Sbjct: 1726 QSAERSRKLELSLKAQQYLSDAGEIETWLGERNNVLRSSDYGRDRDSATKLLTKHKVIEL 1785

Query: 5691 SLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYK 5512
             L      ++ +   A+ +I  +H  +  +A                   R   L ES
Sbjct: 1786 ELDTYSGIVSEMGHTASAMIAAKHPDSKVIAAKQQLIEKMLKSLQRLAGQRQLRLMESLY 1845

Query: 5511 RQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENRLDDIRS 5335
            R  +  +  E+  WI E+      + Y  D  ++     K  + +  ++    R +   +
Sbjct: 1846 RHEYFVESAELEQWIKEQEQAVNSEDYGHDYEHLLILQNKFDDLKHRIEVGAERFNQCEN 1905

Query: 5334 TGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAW 5155
              +++I         I  R   ++N W  L++  + +  KL  AG   +F+R+  +
Sbjct: 1906 FAKKLIGGDSPYVSEIEKRQELLSNAWQHLLEQLDAREKKLHAAGEIHRFHRDAAEALFR 1965

Query: 5154 LSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDR----VDGIKQLAQQFQEEEH 4987
            + +    ++SE  GKDL S   L +K    E++      +    VD   +L  ++  +
Sbjct: 1966 IQDKNAALSSE-LGKDLNSALALARKHEAFENELVPLEAQLQVLVDDSLRLQTKYPGD-- 2022

Query: 4986 FNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGS 4807
             NA  I  +QEN+ Q +N L++    R  +L  S         + D ++W         +
Sbjct: 2023 -NAKAIAAEQENVIQYWNVLKEKSALRNDQLHASCDLQHFLTQVRDLMSWATNLRAALQA 2081

Query: 4806 TNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLR 4627
                 D  G   L  +  A+  EI   +     ++  ++ M+Q GH+ A E+ +K + L
Sbjct: 2082 EEHVSDAAGATALKIQHDAIYGEIEAREQTFRELNELSDSMVQTGHYAATEVEEKCSALL 2141

Query: 4626 DNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALL 4447
            D    L S   K++  L+  +    ++ DA   D   S +E  + S+D+G+  +  +  +
Sbjct: 2142 DERAKLHSAYNKKKILLEQKIDLFCFMRDAKVIDNISSGQEATLSSSDFGQTVEVVQDQV 2201

Query: 4446 KKHRALLSDLEA-----------------------------FKGTIEDLRKQASQCKYQE 4354
            K+H A    ++                               +  +E  +K    C  +
Sbjct: 2202 KRHEAFEKLIQTQDEKVAILQEHGRKLVEQNHYDSENIRRRLREIVERRQKVKDLCALRR 2261

Query: 4353 QPMG------QLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGF 4192
            Q +       Q  RDC  A     EK  +     + D  +   ASN +    ++   Q F
Sbjct: 2262 QKLANALLYAQFIRDCAEAGAWINEKQKK----LEADAHSYAGASNMEDKVKKLKKLQAF 2317

Query: 4191 VPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLM-----MLGE--TRKRKLEEA 4033
                          +   ++ +        EI+D+  +LM     +L E  +R R L+EA
Sbjct: 2318 DAEVNANEGRIREVRDKGEKLIAKKHECAGEIQDELVKLMQSWNVLLNELASRSRGLKEA 2377

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
                +   + + L  WI+ +E +    E G DLE    L++K DD   D++ ++ R++ +
Sbjct: 2378 QDILEFNTQLDKLEAWIRDKEMMIHAGETGRDLEHCNALRRKLDDVDSDMRVDDQRIKNI 2437

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
            NQ+A  L S  + E    ++Q+ E+ N +W++L          L  A+E+  F+RDVD+T
Sbjct: 2438 NQLADKLVSQDKVE-GKNVQQRRENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDVDDT 2496

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPE 3493
             + I EK  A+  +D GRDL +V+AL+RK E +ERD+ A+  KI+  +  A  L   +P+
Sbjct: 2497 AERIAEKMLAMSVDDTGRDLIAVEALKRKQEAIERDMTAVEQKIREHETSAAALADKYPD 2556

Query: 3492 AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQ 3313
             A  I +   EL +QWN L + +  R E L   Y   +F ++ ++L  W   M + + S
Sbjct: 2557 NAINIVEKLDELRKQWNELQNASVKRAEMLKQGYTAHKFTANVKELELWANEMIKRMDSA 2616

Query: 3312 ELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAA---GDIENRLQG 3142
                 +   EA ++ H E + EID R   F+   + G +L+  +  ++     +E  L+
Sbjct: 2617 SNPATIADCEAQIQLHHERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKALRN 2676

Query: 3141 VNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVES 2968
            + +  K L D+W  R   L +  +LQLF    +Q   W++ +EAFL  +D   S   VE+
Sbjct: 2677 LEDLNKHLHDSWKGRFRGLKEAHQLQLFKEQADQIVEWLTNKEAFLNNDDLGESFTAVEA 2736

Query: 2967 LIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQ 2788
            LIKKHE F+K +++   +I  L+ FAE ++  + +++  + ++   ++ R + L  +
Sbjct: 2737 LIKKHEAFEKLLHSN--RIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAET 2794

Query: 2787 KRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHAN 2608
            ++ KL ES  LQQF R   E+E W  +K QIA +ENYR+P+N+Q K QK  AF+AEL AN
Sbjct: 2795 RKQKLQESLQLQQFLRSLYEVEKWTNQKMQIALDENYREPSNLQSKIQKHAAFDAELLAN 2854

Query: 2607 SDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKS 2428
            S R+ A+I+ G +LI NA+     + V  +L  + ++W  L + + EK  RL EA +
Sbjct: 2855 SGRVTAVIEEGESLI-NAE-HYASSLVQEQLDIVENEWQKLREASREKKERLAEAYEALL 2912

Query: 2427 FMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQAD 2248
            F  +++D   W+ EVE  L SEDYG+DLASV NLLKKH +LEAD+  H D   ++
Sbjct: 2913 FQRSLEDFNNWMDEVEAQLSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDA 2972

Query: 2247 SLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKE 2068
             +L +D F   ++ E   +   RY  + +  T RRD L  +L +HQF RD +DE  W+ E
Sbjct: 2973 KMLSSDHFLKDELHESAMVTIKRYHSLHEPTTIRRDNLEDSLQLHQFLRDAEDELLWLNE 3032

Query: 2067 KKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGED 1888
            K+   +S D G  L  VQ+L++KH+ ++ E+   EP +S +  +G++++R    A    +
Sbjct: 3033 KEPQAASKDLGSSLTAVQSLQKKHQALEAEILIQEPIISALVQRGQQMIRDNHYA---VE 3089

Query: 1887 QIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFG 1708
            QI+++   L+     +R LT  R  RL ++   Q F  +  E E W+ EK+ I+ S ++G
Sbjct: 3090 QIERQCGQLQSKLVNLRHLTNVRRLRLLDAVESQQFYAEANEAEFWLREKKPIISSQDYG 3149

Query: 1707 ENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLI 1528
            ++   V  L KK D  Q +L   K  V  +      L   G+  +  IK + D+++ +
Sbjct: 3150 KDEDSVASLQKKLDGLQRELGAFKPTVEKIETLASGLQARGHFDSEKIKSKNDKIQYQFQ 3209

Query: 1527 EIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQE 1348
            E+  +A  R  KL +     +F+ + D ++ WI  +     SE++G D+  V+ L  + E
Sbjct: 3210 ELNRLAAEREKKLAEMKKLYEFVREIDDLQEWIEVQMTTAGSEEYGTDVEHVEQLTAQFE 3269

Query: 1347 AFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXX 1168
            +F + LNA E   +       + L+S  +     I+ +     Q W+ L     AR+
Sbjct: 3270 SFVSNLNANESR-LTACVAKGEALLSEGNPNRDTIKAKRDETKQLWEELKDLVVARQEAL 3328

Query: 1167 XXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRS 988
                            F + A    +W       +      + LE I++L   H  F+
Sbjct: 3329 AGARQVH--------VFDRTADETIAWVNEKISSVLSEDYGHDLETIQSLVRTHEAFEAE 3380

Query: 987  LSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQR 808
            L + +E    + +  +++         +     D   + W  L+    +R+++L +  Q
Sbjct: 3381 LGAIKEQLESVVNEAQKLADTYPDAKEHIEVKRDETIEVWSELKDRTVQRKEKLTQAEQL 3440

Query: 807  QEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQI 628
            Q   D+ R           AW+ N     + A    ++   A     K   AN     ++
Sbjct: 3441 QAYFDEYR--------DLMAWI-NEMLAKITAPDLAKDVAGAEALIDKHFLAN-----EV 3486

Query: 627  EEKGAMLE-RNLILDNRYTEHSTVGIAQAWDQLD-QLAMRMQHNLEQQIQAR----NQSG 466
            ++K A+LE R  +LDN   +     +      LD Q  ++   ++E  I +R     +S
Sbjct: 3487 QDKIAVLEQRKRLLDNTIVQR----LEMYELNLDTQRFLKEAEDMESWIISRQMQLKESK 3542

Query: 465  VSEEALREFSMMFKHFDKEKT 403
            + +   +   ++ KH D EKT
Sbjct: 3543 LGDSIAQVEDLLRKHEDFEKT 3563



 Score =  759 bits (1960), Expect = 0.0
 Identities = 547/2170 (25%), Positives = 1007/2170 (46%), Gaps = 71/2170 (3%)
 Frame = -1

Query: 6888 ASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAE 6709
            +++ + KR + ++  +         +   L+ ++ L  F R+CD+   WI++KE  +  +
Sbjct: 966  SNDSVDKRQKHINGTYDQLQDLAERRRALLEDSICLFRFYRECDDFEKWIKDKEKMLRTD 1025

Query: 6708 DMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVND 6529
            D       VE  +R+F+ F+ +L     R+  I+   +  V +GHS+ D++  ++  ++
Sbjct: 1026 D---PKGSVETARRQFETFVNDLSASSKRVEAIDSDVEDFVRQGHSQLDKVKARQRQIHQ 1082

Query: 6528 AWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQR 6349
             W  LN L   +++ L GA  V+ F R  +E + W+ EK   L + + G DL  VQALQR
Sbjct: 1083 MWEHLNYLKGQKEKSLEGASSVELFYRTCEEAIDWMNEKMTQLDTAEVGPDLKTVQALQR 1142

Query: 6348 KHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKD 6169
            +HE  ER+LA ++ K+ ++    + +  ++P   + + +K  D +  W  ++EKA+ R+
Sbjct: 1143 RHENLERELAPVKEKVSRVNLLGNTVKNSYPSERDNVSEKQRDIQNLWQKVQEKAKERRS 1202

Query: 6168 GLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARAD 5989
             LE +     F    + L++WI +    + A+E A+DV  AE LL+ H++   +I+A  D
Sbjct: 1203 RLENAVGQQIFNNSTKALLNWIAECNNQLAAEETARDVETAEKLLKKHKDLGEDINAHDD 1262

Query: 5988 SFNQTASAGQKLVEMG--IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFY 5815
             F Q A  GQ+++E    + E  E+  K+ KL+ E+  L G W  +    +QC++LQ+F
Sbjct: 1263 EFVQLAKLGQQIIERNPALTEDHEMANKIAKLEAERQRLHGAWLAKEKKLQQCIELQIFN 1322

Query: 5814 RDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKL 5635
            R+ ++ +      EA+L   DLG+SLD VE ++K+H DFE SL AQ++ +    E A +L
Sbjct: 1323 READKIDATTKSHEAYLEYDDLGNSLDDVEAIMKRHIDFENSLGAQDKILKNFSEGADRL 1382

Query: 5634 IQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKL 5455
            I+  HY A  + +                  R NAL+ S   Q F  D D++  W+ +K
Sbjct: 1383 IRNNHYNATYIDDRRGQVLARRERVKELAQKRRNALQASKDFQKFSSDVDDLNRWLADKT 1442

Query: 5454 STARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRL 5275
              A D+SY D +N+  KLQKH  FE+EL+ANE +L  +   GE +I + + A + + + L
Sbjct: 1443 KIASDESYKDLSNLPRKLQKHKAFERELRANEGQLRMVNKEGESLIKTNNRAGE-VSETL 1501

Query: 5274 RQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSV 5095
              +N  W +LV  +  KG +L +A  +++ NR IED ++   EL+  + S+  G DL S
Sbjct: 1502 AAINQNWKDLVATSLDKGRRLEQAALQREHNRYIEDSKSKFEELDHALQSKQVGNDLRSC 1561

Query: 5094 QNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPL 4915
            + L  K  ++E+D      +V  +    ++   E HF+A  I  + + LQ ++  L+ P
Sbjct: 1562 KELMNKHQVLENDIALWEQKVAELVTTGEEMAHEGHFDANNIQNETKKLQAQFAGLKTPA 1621

Query: 4914 EKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEI 4735
             +R+  L ES + ++   +++ EL WI E    A S   G++L   Q+L KK + L AEI
Sbjct: 1622 RQRRDALDESLRFHKFVFELDTELQWINEHLPAAKSEVIGQNLHQAQSLSKKHKKLEAEI 1681

Query: 4734 ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAH 4555
              H   I    ++A ++I Q H    ++++    L   W  L+ ++ +R   L+ SL+A
Sbjct: 1682 EGHQPMINKTLTSAENLINQNHPERAKVKELCNSLEKAWADLQEQSAERSRKLELSLKAQ 1741

Query: 4554 QYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA 4375
            QYLSDA E + W+ E+  ++ S+DYG+D DSA  LL KH+ +  +L+ + G + ++   A
Sbjct: 1742 QYLSDAGEIETWLGERNNVLRSSDYGRDRDSATKLLTKHKVIELELDTYSGIVSEMGHTA 1801

Query: 4374 S----------------------QCKYQEQPMGQLGRDCVLALYDYQ---EKSPREVSMK 4270
            S                        K  ++  GQ     + +LY ++   E +  E  +K
Sbjct: 1802 SAMIAAKHPDSKVIAAKQQLIEKMLKSLQRLAGQRQLRLMESLYRHEYFVESAELEQWIK 1861

Query: 4269 KGD--------------VLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQ 4132
            + +              +L L N  +    ++EV   +      + K++  G +
Sbjct: 1862 EQEQAVNSEDYGHDYEHLLILQNKFDDLKHRIEVGAERFNQCENFAKKLIGGDS-----P 1916

Query: 4131 QVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQ 3952
             V+ I  +Q  + + +Q L+   + R++KL  A + ++  R+A +    I+ + A A
Sbjct: 1917 YVSEIEKRQELLSNAWQHLLEQLDAREKKLHAAGEIHRFHRDAAEALFRIQDKNA-ALSS 1975

Query: 3951 EIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLN 3772
            E+G DL     L +K + F+ +L   E +LQ +   +  L +    + A  I  + E++
Sbjct: 1976 ELGKDLNSALALARKHEAFENELVPLEAQLQVLVDDSLRLQTKYPGDNAKAIAAEQENVI 2035

Query: 3771 ARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQ 3592
              W  L         QL ++ ++Q F   V +   W      AL +E+   D     AL+
Sbjct: 2036 QYWNVLKEKSALRNDQLHASCDLQHFLTQVRDLMSWATNLRAALQAEEHVSDAAGATALK 2095

Query: 3591 RKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRK 3412
             +H+ +  ++ A     + L+E ++ + Q+   AA ++ +    L ++  +L S  N +K
Sbjct: 2096 IQHDAIYGEIEAREQTFRELNELSDSMVQTGHYAATEVEEKCSALLDERAKLHSAYNKKK 2155

Query: 3411 EKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRA 3232
              L    D   F+ D + +    +     +SS +    V   +  ++RH+ +   I ++
Sbjct: 2156 ILLEQKIDLFCFMRDAKVIDNISSGQEATLSSSDFGQTVEVVQDQVKRHEAFEKLIQTQD 2215

Query: 3231 ATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYR 3052
                   + G +L+  +HY + +I  RL+ + E R+ ++D    RR  L   L    F R
Sbjct: 2216 EKVAILQEHGRKLVEQNHYDSENIRRRLREIVERRQKVKDLCALRRQKLANALLYAQFIR 2275

Query: 3051 DCEQADTWMSAREAFL---AQEDPSGDNVESLI---KKHEDFDKAINTQEEKIKGLKLFA 2890
            DC +A  W++ ++  L   A       N+E  +   KK + FD  +N  E +I+ ++
Sbjct: 2276 DCAEAGAWINEKQKKLEADAHSYAGASNMEDKVKKLKKLQAFDAEVNANEGRIREVRDKG 2335

Query: 2889 ESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMT 2710
            E LI   H  +  +  +  +++  WN L   L  +   L E+Q + +F+   D++E W+
Sbjct: 2336 EKLIAKKHECAGEIQDELVKLMQSWNVLLNELASRSRGLKEAQDILEFNTQLDKLEAWIR 2395

Query: 2709 EK-FQIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEA 2533
            +K   I   E  RD  +     +K    ++++  +  RI  I Q  + L+   K  G
Sbjct: 2396 DKEMMIHAGETGRDLEHCNALRRKLDDVDSDMRVDDQRIKNINQLADKLVSQDKVEGKN- 2454

Query: 2532 AVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYG 2353
             V  R +  N++W  L    +     L  A +   F   V D    + E  + +  +D G
Sbjct: 2455 -VQQRRENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDVDDTAERIAEKMLAMSVDDTG 2513

Query: 2352 KDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYD 2173
            +DL +VE L +K   +E D+ A + ++ E    A +L +        I E+   +  +++
Sbjct: 2514 RDLIAVEALKRKQEAIERDMTAVEQKIREHETSAAALADKYPDNAINIVEKLDELRKQWN 2573

Query: 2172 GVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHR 1993
             ++  +  R + L +    H+F  ++ + E W  E    + S      +   +   + H
Sbjct: 2574 ELQNASVKRAEMLKQGYTAHKFTANVKELELWANEMIKRMDSASNPATIADCEAQIQLHH 2633

Query: 1992 RIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQ 1813
                E+   +     ++  GE L+    E+ V  D ++K + +LE     + D    R +
Sbjct: 2634 ERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKALRNLEDLNKHLHDSWKGRFR 2693

Query: 1812 RLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQ 1633
             L E+   Q F    ++   W+  K+  L +D+ GE+   V+ L+KKH+ F  +  LH
Sbjct: 2694 GLKEAHQLQLFKEQADQIVEWLTNKEAFLNNDDLGESFTAVEALIKKHEAF--EKLLHSN 2751

Query: 1632 RVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWK 1453
            R+ +L    + ++      A  IKQR   + +R  ++ + AE R  KL+++    QF+
Sbjct: 2752 RIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAETRKQKLQESLQLQQFLRS 2811

Query: 1452 CDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLV 1273
               VE W  +K Q    E++ R+ S++Q  + K  AFDA L A     +  + E  + L+
Sbjct: 2812 LYEVEKWTNQKMQIALDENY-REPSNLQSKIQKHAAFDAELLA-NSGRVTAVIEEGESLI 2869

Query: 1272 SSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY--LAFAKKAST 1099
            ++EH  S  ++++   V   WQ L   S  ++           ++ E Y  L F +
Sbjct: 2870 NAEHYASSLVQEQLDIVENEWQKLREASREKK----------ERLAEAYEALLFQRSLED 2919

Query: 1098 FNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRR------ 937
            FN+W +  E  L+       L  +  L   H   +  ++   +   Q++  D +
Sbjct: 2920 FNNWMDEVEAQLSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDAKMLSSDH 2979

Query: 936  -------------IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEEN 796
                         IK ++    P T    D LED+ + L + +++ E EL      ++E
Sbjct: 2980 FLKDELHESAMVTIKRYHSLHEP-TTIRRDNLEDSLQ-LHQFLRDAEDELL--WLNEKEP 3035

Query: 795  DKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDA--VERKAKEIKANKGQLRQIEE 622
                ++      A  +     + + +EA   ++E + +  V+R  + I+ N   + QIE
Sbjct: 3036 QAASKDLGSSLTAVQS--LQKKHQALEAEILIQEPIISALVQRGQQMIRDNHYAVEQIER 3093

Query: 621  KGAMLERNLI 592
            +   L+  L+
Sbjct: 3094 QCGQLQSKLV 3103



 Score =  682 bits (1761), Expect = 0.0
 Identities = 471/1888 (24%), Positives = 885/1888 (45%), Gaps = 45/1888 (2%)
 Frame = -1

Query: 7146 KDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAF 6970
            ++ S  +  +LE + + Q +  DA E+  W+ E+    +  ++ RD  +    + KH+
Sbjct: 1724 QEQSAERSRKLELSLKAQQYLSDAGEIETWLGERNNVLRSSDYGRDRDSATKLLTKHKVI 1783

Query: 6969 EAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQA 6790
            E E+  ++  ++ +  T +AMI   H  S+ I  + + +  +          + ++L ++
Sbjct: 1784 ELELDTYSGIVSEMGHTASAMIAAKHPDSKVIAAKQQLIEKMLKSLQRLAGQRQLRLMES 1843

Query: 6789 LKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEI 6610
            L    +  +  E+  WI+E+E  V +ED G D EH+ ILQ KFDD    +     R N+
Sbjct: 1844 LYRHEYFVESAELEQWIKEQEQAVNSEDYGHDYEHLLILQNKFDDLKHRIEVGAERFNQC 1903

Query: 6609 NQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETL 6430
               A KL+        +I K+++ +++AW  L      R++ L  A ++ RF+RDA E L
Sbjct: 1904 ENFAKKLIGGDSPYVSEIEKRQELLSNAWQHLLEQLDAREKKLHAAGEIHRFHRDAAEAL 1963

Query: 6429 AWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHP-D 6253
              I +K+ ALSS+  G+DLN+  AL RKHE  E +L  LE ++  L  ++ +L   +P D
Sbjct: 1964 FRIQDKNAALSSE-LGKDLNSALALARKHEAFENELVPLEAQLQVLVDDSLRLQTKYPGD 2022

Query: 6252 RAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGAD 6073
             A+AI  + ++    WN LKEK+  R D L  S  L  FL   RDL+SW  +++A + A+
Sbjct: 2023 NAKAIAAEQENVIQYWNVLKEKSALRNDQLHASCDLQHFLTQVRDLMSWATNLRAALQAE 2082

Query: 6072 ELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDH 5893
            E   D AGA AL   H    GEI+AR  +F +       +V+ G   + EV+EK   L
Sbjct: 2083 EHVSDAAGATALKIQHDAIYGEIEAREQTFRELNELSDSMVQTGHYAATEVEEKCSALLD 2142

Query: 5892 EKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIK 5713
            E++ L   + +++IL EQ +DL  F RD +  +   + QEA L+++D G +++ V+  +K
Sbjct: 2143 ERAKLHSAYNKKKILLEQKIDLFCFMRDAKVIDNISSGQEATLSSSDFGQTVEVVQDQVK 2202

Query: 5712 KHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGN 5533
            +HE FEK +  Q+EK+  L E   KL++  HY ++++                    R
Sbjct: 2203 RHEAFEKLIQTQDEKVAILQEHGRKLVEQNHYDSENIRRRLREIVERRQKVKDLCALRRQ 2262

Query: 5532 ALKESYKRQTFDRDCDEMVSWITEKLSTARDD--SYLDPTNIRGK---LQKHINFEQELK 5368
             L  +     F RDC E  +WI EK      D  SY   +N+  K   L+K   F+ E+
Sbjct: 2263 KLANALLYAQFIRDCAEAGAWINEKQKKLEADAHSYAGASNMEDKVKKLKKLQAFDAEVN 2322

Query: 5367 ANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQ 5188
            ANE R+ ++R  GE++I   H  A  I D L ++   WN L++    +   L+EA +  +
Sbjct: 2323 ANEGRIREVRDKGEKLIAKKHECAGEIQDELVKLMQSWNVLLNELASRSRGLKEAQDILE 2382

Query: 5187 FNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQ 5008
            FN  ++ +EAW+ + E  + + + G+DL     L++K+  ++SD    + R+  I QLA
Sbjct: 2383 FNTQLDKLEAWIRDKEMMIHAGETGRDLEHCNALRRKLDDVDSDMRVDDQRIKNINQLAD 2442

Query: 5007 QFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIRE 4828
            +   ++      + +++EN   ++ +L+  L + +  L  +++ +   RD++D    I E
Sbjct: 2443 KLVSQDKVEGKNVQQRRENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDVDDTAERIAE 2502

Query: 4827 KEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIR 4648
            K       + GRDLI V+ L +KQ+A+  ++   + +I    ++A  +  +    A  I
Sbjct: 2503 KMLAMSVDDTGRDLIAVEALKRKQEAIERDMTAVEQKIREHETSAAALADKYPDNAINIV 2562

Query: 4647 DKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDE 4468
            +KL +LR  W  L++ + KR   L     AH++ ++  E + W +E    + S
Sbjct: 2563 EKLDELRKQWNELQNASVKRAEMLKQGYTAHKFTANVKELELWANEMIKRMDSASNPATI 2622

Query: 4467 DSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSP 4288
               EA ++ H    ++++       DL++   +   + +           AL + ++ +
Sbjct: 2623 ADCEAQIQLHHERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKALRNLEDLNK 2682

Query: 4287 REVSMKKGDVLTLLNASNRDWWKVEVN-------DRQGFVP-----------AAYVKRIE 4162
                  KG    L  A     +K + +       +++ F+             A +K+ E
Sbjct: 2683 HLHDSWKGRFRGLKEAHQLQLFKEQADQIVEWLTNKEAFLNNDDLGESFTAVEALIKKHE 2742

Query: 4161 P----------GTAQQHAQQ-------QVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
                       G  ++ A++       + + I  +   +  +  +L+   ETRK+KL+E+
Sbjct: 2743 AFEKLLHSNRIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAETRKQKLQES 2802

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
             +  Q LR   ++ +W   +  +A  +           +QK    F  +L AN  R+  +
Sbjct: 2803 LQLQQFLRSLYEVEKWTNQKMQIALDENYREPSNLQSKIQKHAA-FDAELLANSGRVTAV 2861

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
             +   +L +     +++ +++Q++ +   W+ L         +L  A+E   F R +++
Sbjct: 2862 IEEGESLINAEHYASSL-VQEQLDIVENEWQKLREASREKKERLAEAYEALLFQRSLEDF 2920

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPE 3493
             +W+ E +  L SED+GRDL SV  L +KH+ +E D+A   D  + +     ++  S
Sbjct: 2921 NNWMDEVEAQLSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDAKMLSSDHF 2980

Query: 3492 AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQ 3313
              +++++      ++++ L      R++ L DS    +FL D  D + W+       +S+
Sbjct: 2981 LKDELHESAMVTIKRYHSLHEPTTIRRDNLEDSLQLHQFLRDAEDELLWLNEKEPQAASK 3040

Query: 3312 ELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNE 3133
            +L + +T  ++L ++HQ    EI  +     A  Q G Q++  +HYA   IE +   +
Sbjct: 3041 DLGSSLTAVQSLQKKHQALEAEILIQEPIISALVQRGQQMIRDNHYAVEQIERQCGQLQS 3100

Query: 3132 ARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED--PSGDNVESLIK 2959
                L      RR  L   +E Q FY +  +A+ W+  ++  ++ +D     D+V SL K
Sbjct: 3101 KLVNLRHLTNVRRLRLLDAVESQQFYAEANEAEFWLREKKPIISSQDYGKDEDSVASLQK 3160

Query: 2958 KHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRF 2779
            K +   + +   +  ++ ++  A  L    H+DS  +  K D+I  ++  L     ++
Sbjct: 3161 KLDGLQRELGAFKPTVEKIETLASGLQARGHFDSEKIKSKNDKIQYQFQELNRLAAEREK 3220

Query: 2778 KLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSD 2602
            KL E + L +F R+ D+++ W+  +   A  E Y  D  +++Q   + ++F + L+AN
Sbjct: 3221 KLAEMKKLYEFVREIDDLQEWIEVQMTTAGSEEYGTDVEHVEQLTAQFESFVSNLNANES 3280

Query: 2601 RIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFM 2422
            R+ A +  G  L+           + A+       W+ L      +   L  A +   F
Sbjct: 3281 RLTACVAKGEALLSEGN--PNRDTIKAKRDETKQLWEELKDLVVARQEALAGARQVHVFD 3338

Query: 2421 AAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL 2242
                +   W+ E    + SEDYG DL ++++L++ H   EA++ A ++++  +  +A  L
Sbjct: 3339 RTADETIAWVNEKISSVLSEDYGHDLETIQSLVRTHEAFEAELGAIKEQLESVVNEAQKL 3398

Query: 2241 LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKK 2062
             +      + I  +R    + +  +K     R++KL++A  +  +F +  D  +WI E
Sbjct: 3399 ADTYPDAKEHIEVKRDETIEVWSELKDRTVQRKEKLTQAEQLQAYFDEYRDLMAWINEML 3458

Query: 2061 LLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQI 1882
              +++ D  +D+ G + L      ID    ++E Q  +  L+  + L         ++ I
Sbjct: 3459 AKITAPDLAKDVAGAEAL------IDKHFLANEVQDKIAVLEQRKRLL--------DNTI 3504

Query: 1881 KKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGEN 1702
             +R+E  E +              LD     Q FL + E+ E+W+  +Q  L     G++
Sbjct: 3505 VQRLEMYELN--------------LDT----QRFLKEAEDMESWIISRQMQLKESKLGDS 3546

Query: 1701 MAGVQGLLKKHDTFQVDLELHKQRVADL 1618
            +A V+ LL+KH+ F+  +   +++V  L
Sbjct: 3547 IAQVEDLLRKHEDFEKTVAAQEEKVLAL 3574



 Score =  653 bits (1684), Expect = 0.0
 Identities = 441/1704 (25%), Positives = 805/1704 (46%), Gaps = 110/1704 (6%)
 Frame = -1

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            ++KH     ++ A  +R +D+     ++    +   D +  R  +V   W EL++
Sbjct: 450  VKKHEAISADILARADRFNDLTDMCNELHQENYHGKDRVKKRELEVITKWKELLELLENH 509

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL +  +     R I+     +  L+ Q ASED G  L+ V+ L +   L+E
Sbjct: 510  KLKLSQMSSLMNLLREIDATMTTIKALQAQFASEDVGPHLLGVEELLQAHSLLELQVTTL 569

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             +      +  + F+  ++ +   +  K   L + Y  L      R+ +L E+    Q
Sbjct: 570  GETQRRYVRQGEAFKRGDYKDTSQLDAKLAELAKLYEELLAMSAARRARLDEARDFYQFV 629

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
             D E+E  W+ +K+++  +    +DL  V +L +K +AL  E+     +   ++ A   +
Sbjct: 630  EDHENEEGWLVDKQRICKAGITAKDLRAVMSLQQKHKALEDEMKVRKPKSNQITEAGKKL 689

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I   H    +++ K+  L+++W+ L+   + R+  L+D+ +A+QY +DANEAD+W++EK
Sbjct: 690  IVDKHSRMSDVQGKIDSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEADSWLNEKM 749

Query: 4503 PIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQC-------------- 4366
             +V S D+G DE SA+ALL++HR L  +L A+ G I +L +QA +
Sbjct: 750  ALVASDDFGVDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAEKLIKAGICTLDLSAEP 809

Query: 4365 ---------------------KYQEQPMGQLGRDCVL---------ALYDYQEKSPREVS 4276
                                  ++++P+ +L    V          ALY ++ ++   +
Sbjct: 810  EPVQEMEQEEWVNETRLVPKEVWEDEPVERLEHRTVTENKLLPHVKALYRFEGQN---MK 866

Query: 4275 MKKGDVLTLLNASNRDWWKV-EVNDRQGFVPAAYVKRIEPGTA----------------- 4150
            + KGDV+ L N +N DWW V +++  +GFVPA YVK IEP
Sbjct: 867  VAKGDVMILQNKNNVDWWNVRKLDGTEGFVPANYVKEIEPRPVPCLVRKAEKVKVMQKVK 926

Query: 4149 ---------------------------------QQHAQQQVNSIGGKQSEIEDKYQRLMM 4069
                                             +  A    +S+  +Q  I   Y +L
Sbjct: 927  KTILVKEVIQVKRVRPAKVSQMKPLVKRRAKGDESSAVDSNDSVDKRQKHINGTYDQLQD 986

Query: 4068 LGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKG 3889
            L E R+  LE++   ++  RE +D  +WIK +E +    +       VE  +++F+ F
Sbjct: 987  LAERRRALLEDSICLFRFYRECDDFEKWIKDKEKMLRTDD---PKGSVETARRQFETFVN 1043

Query: 3888 DLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAH 3709
            DL A+  R++ ++         G ++   +++ +   ++  W  L          L  A
Sbjct: 1044 DLSASSKRVEAIDSDVEDFVRQGHSQLD-KVKARQRQIHQMWEHLNYLKGQKEKSLEGAS 1102

Query: 3708 EVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLD 3529
             V+ F+R  +E  DW+ EK   LD+ + G DL++VQALQR+HE +ER+LA + +K+  ++
Sbjct: 1103 SVELFYRTCEEAIDWMNEKMTQLDTAEVGPDLKTVQALQRRHENLERELAPVKEKVSRVN 1162

Query: 3528 EKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
               N ++ S+P   + + + QR++   W ++  KA  R+ +L ++   Q F +  + L+
Sbjct: 1163 LLGNTVKNSYPSERDNVSEKQRDIQNLWQKVQEKAKERRSRLENAVGQQIFNNSTKALLN 1222

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAA 3169
            WIA  N  ++++E A DV  AE LL++H++   +I++    F    + G Q++  +
Sbjct: 1223 WIAECNNQLAAEETARDVETAEKLLKKHKDLGEDINAHDDEFVQLAKLGQQIIERNPALT 1282

Query: 3168 GDIE--NRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQE 2995
             D E  N++  +   R+ L  AW+A+   L QC+ELQ+F R+ ++ D    + EA+L  +
Sbjct: 1283 EDHEMANKIAKLEAERQRLHGAWLAKEKKLQQCIELQIFNREADKIDATTKSHEAYLEYD 1342

Query: 2994 D--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILD 2821
            D   S D+VE+++K+H DF+ ++  Q++ +K     A+ LI+NNHY++  +  +R Q+L
Sbjct: 1343 DLGNSLDDVEAIMKRHIDFENSLGAQDKILKNFSEGADRLIRNNHYNATYIDDRRGQVLA 1402

Query: 2820 RWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQK 2641
            R   +KE   ++R  L  S+  Q+FS D D++  W+ +K +IA +E+Y+D +N+ +K QK
Sbjct: 1403 RRERVKELAQKRRNALQASKDFQKFSSDVDDLNRWLADKTKIASDESYKDLSNLPRKLQK 1462

Query: 2640 QQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
             +AFE EL AN  ++  + + G +LI+     G    VS  L A+N  W  LV T+ +K
Sbjct: 1463 HKAFERELRANEGQLRMVNKEGESLIKTNNRAG---EVSETLAAINQNWKDLVATSLDKG 1519

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             RL++A  Q+     ++D +    E++  LQS+  G DL S + L+ KH +LE DI   +
Sbjct: 1520 RRLEQAALQREHNRYIEDSKSKFEELDHALQSKQVGNDLRSCKELMNKHQVLENDIALWE 1579

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
             +V E+    + +     F    I    K +  ++ G+K  A  RRD L ++L  H+F
Sbjct: 1580 QKVAELVTTGEEMAHEGHFDANNIQNETKKLQAQFAGLKTPARQRRDALDESLRFHKFVF 1639

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            ++D E  WI E      S+  G++L   Q+L +KH++++ E+  H+P ++      E L+
Sbjct: 1640 ELDTELQWINEHLPAAKSEVIGQNLHQAQSLSKKHKKLEAEIEGHQPMINKTLTSAENLI 1699

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
                +      ++K+    LE++W  +++ +  R ++L+ S   Q +L D  E E W+ E
Sbjct: 1700 N---QNHPERAKVKELCNSLEKAWADLQEQSAERSRKLELSLKAQQYLSDAGEIETWLGE 1756

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            +  +L S ++G +      LL KH   +++L+ +   V+++ +    +I   +  +  I
Sbjct: 1757 RNNVLRSSDYGRDRDSATKLLTKHKVIELELDTYSGIVSEMGHTASAMIAAKHPDSKVIA 1816

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
             +   +   L  ++ +A  R  +L ++    ++  +   +E WI E+EQ V SED+G D
Sbjct: 1817 AKQQLIEKMLKSLQRLAGQRQLRLMESLYRHEYFVESAELEQWIKEQEQAVNSEDYGHDY 1876

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKD---QLVSSEHQQSPAIEKRHTNVIQRW 1210
              + IL   Q  FD   +  E  G +R  + ++   +L+  +      IEKR   +   W
Sbjct: 1877 EHLLIL---QNKFDDLKHRIE-VGAERFNQCENFAKKLIGGDSPYVSEIEKRQELLSNAW 1932

Query: 1209 QNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEE 1030
            Q+LL   +AR               E++  F + A+      ++    L+  +    L
Sbjct: 1933 QHLLEQLDAREKKLHAAG-------EIH-RFHRDAAEALFRIQDKNAALSSELG-KDLNS 1983

Query: 1029 IRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRI 850
              AL   H  F+  L   E   + L D   R+++   G N      + A ++       +
Sbjct: 1984 ALALARKHEAFENELVPLEAQLQVLVDDSLRLQTKYPGDNAK---AIAAEQENVIQYWNV 2040

Query: 849  IKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTR------QEMMEAGG--TLEE 694
            +KE+     R  Q     D   + F        +W TN R      + + +A G   L+
Sbjct: 2041 LKEK--SALRNDQLHASCD--LQHFLTQVRDLMSWATNLRAALQAEEHVSDAAGATALKI 2096

Query: 693  QLDAVERKAKEIKANKGQLRQIEE 622
            Q DA+     EI+A +   R++ E
Sbjct: 2097 QHDAI---YGEIEAREQTFRELNE 2117



 Score =  595 bits (1534), Expect = e-168
 Identities = 400/1371 (29%), Positives = 650/1371 (47%), Gaps = 52/1371 (3%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQT--AQE 7027
            +++I +R +E++      KD    +R +L  A  +  F RD  E   WI EK +   A
Sbjct: 2236 SENIRRRLREIVERRQKVKDLCALRRQKLANALLYAQFIRDCAEAGAWINEKQKKLEADA 2295

Query: 7026 ENFRDPSNLQAKIQKH---EAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEE 6856
             ++   SN++ K++K    +AF+AEV A+   I  +   G  +I   H  +  I+  L +
Sbjct: 2296 HSYAGASNMEDKVKKLKKLQAFDAEVNANEGRIREVRDKGEKLIAKKHECAGEIQDELVK 2355

Query: 6855 LHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEI 6676
            L   W         +   L++A  +L F  Q D++  WIR+KE  + A + G DLEH
Sbjct: 2356 LMQSWNVLLNELASRSRGLKEAQDILEFNTQLDKLEAWIRDKEMMIHAGETGRDLEHCNA 2415

Query: 6675 LQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAAT 6496
            L+RK DD   ++     RI  INQ ADKLV +   E   + ++R++ N+ W  L    +
Sbjct: 2416 LRRKLDDVDSDMRVDDQRIKNINQLADKLVSQDKVEGKNVQQRRENFNNKWKSLQGALSR 2475

Query: 6495 RKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAA 6316
             ++ L GA+++  FNRD D+T   I EK LA+S DD GRDL  V+AL+RK E  ERD+ A
Sbjct: 2476 YRDLLAGAYEIHVFNRDVDDTAERIAEKMLAMSVDDTGRDLIAVEALKRKQEAIERDMTA 2535

Query: 6315 LEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRF 6136
            +E K+ + E  A  LA+ +PD A  I +K D+ +  WN L+  +  R + L++ +  H+F
Sbjct: 2536 VEQKIREHETSAAALADKYPDNAINIVEKLDELRKQWNELQNASVKRAEMLKQGYTAHKF 2595

Query: 6135 LADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQK 5956
             A+ ++L  W  +M   + +      +A  EA ++ H E K EID R   F      G++
Sbjct: 2596 TANVKELELWANEMIKRMDSASNPATIADCEAQIQLHHERKAEIDGRDLVFRDLQEHGER 2655

Query: 5955 LVEMGIPES---PEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWM 5785
            LV      S     V++ L  L+     L   W+ R    ++   LQLF    +Q   W+
Sbjct: 2656 LVAENRESSVRNDHVEKALRNLEDLNKHLHDSWKGRFRGLKEAHQLQLFKEQADQIVEWL 2715

Query: 5784 NKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADD 5605
              +EAFL N DLG+S  +VE LIKKHE FEK L     +I  L+ FA +++    + AD
Sbjct: 2716 TNKEAFLNNDDLGESFTAVEALIKKHEAFEKLL--HSNRIGELERFAEEILAESPFEADV 2773

Query: 5604 VAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLD 5425
            + +                  R   L+ES + Q F R   E+  W  +K+  A D++Y +
Sbjct: 2774 IKQRLYAVVSRKDKLLASAETRKQKLQESLQLQQFLRSLYEVEKWTNQKMQIALDENYRE 2833

Query: 5424 PTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
            P+N++ K+QKH  F+ EL AN  R+  +   GE +I++ H+A+  + ++L  V N W +L
Sbjct: 2834 PSNLQSKIQKHAAFDAELLANSGRVTAVIEEGESLINAEHYASSLVQEQLDIVENEWQKL 2893

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
             +A+ +K  +L EA     F R++ED   W+ E+E Q++SEDYG+DL SV NL KK  ++
Sbjct: 2894 REASREKKERLAEAYEALLFQRSLEDFNNWMDEVEAQLSSEDYGRDLASVHNLLKKHDML 2953

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
            E+D   H D  + IK    +    +HF    +        +RY++L +P   R+  L +S
Sbjct: 2954 EADVAHHADTCEQIKATDAKMLSSDHFLKDELHESAMVTIKRYHSLHEPTTIRRDNLEDS 3013

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
             Q +Q  RD EDEL W+ EKE  A S + G  L  VQ+L KK QAL AEI   +  I ++
Sbjct: 3014 LQLHQFLRDAEDELLWLNEKEPQAASKDLGSSLTAVQSLQKKHQALEAEILIQEPIISAL 3073

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
                  MI+  H+   +I  +  QL+     L+     RR  L D++++ Q+ ++ANEA+
Sbjct: 3074 VQRGQQMIRDNHYAVEQIERQCGQLQSKLVNLRHLTNVRRLRLLDAVESQQFYAEANEAE 3133

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQAS--------- 4372
             W+ EK+PI+ S DYGKDEDS  +L KK   L  +L AFK T+E +   AS
Sbjct: 3134 FWLREKKPIISSQDYGKDEDSVASLQKKLDGLQRELGAFKPTVEKIETLASGLQARGHFD 3193

Query: 4371 ---------QCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWK 4219
                     + +YQ Q + +L            E+  +   MKK           ++W +
Sbjct: 3194 SEKIKSKNDKIQYQFQELNRLA----------AEREKKLAEMKKLYEFVREIDDLQEWIE 3243

Query: 4218 VEVNDRQGFVPAAYVKRIEPGTAQ--------------------------QHAQQQVNSI 4117
            V++           V+ +E  TAQ                                 ++I
Sbjct: 3244 VQMTTAGSEEYGTDVEHVEQLTAQFESFVSNLNANESRLTACVAKGEALLSEGNPNRDTI 3303

Query: 4116 GGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTD 3937
              K+ E +  ++ L  L   R+  L  A + +   R A++   W+  + +    ++ G D
Sbjct: 3304 KAKRDETKQLWEELKDLVVARQEALAGARQVHVFDRTADETIAWVNEKISSVLSEDYGHD 3363

Query: 3936 LEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRA 3757
            LE ++ L +  + F+ +L A + +L+ +   A  L      +    I  + ++    W
Sbjct: 3364 LETIQSLVRTHEAFEAELGAIKEQLESVVNEAQKLADT-YPDAKEHIEVKRDETIEVWSE 3422

Query: 3756 LXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEG 3577
            L         +L  A ++Q +  +  +   WI E    + + D  +D+   +AL  KH
Sbjct: 3423 LKDRTVQRKEKLTQAEQLQAYFDEYRDLMAWINEMLAKITAPDLAKDVAGAEALIDKHFL 3482

Query: 3576 VERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLD 3397
                   + DKI  L+++   L  +  +  E +Y+L
Sbjct: 3483 ANE----VQDKIAVLEQRKRLLDNTIVQRLE-MYEL------------------------ 3513

Query: 3396 SYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEI 3244
            + D QRFL +  D+  WI S    +   +L + +   E LL +H+++   +
Sbjct: 3514 NLDTQRFLKEAEDMESWIISRQMQLKESKLGDSIAQVEDLLRKHEDFEKTV 3564



 Score =  410 bits (1053), Expect = e-112
 Identities = 387/1753 (22%), Positives = 769/1753 (43%), Gaps = 73/1753 (4%)
 Frame = -1

Query: 7185 QRRQEVLGH-YSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDP 7009
            ++RQE+L + +    +    +  +L  A +   F RDA E    I +K      E  +D
Sbjct: 1922 EKRQELLSNAWQHLLEQLDAREKKLHAAGEIHRFHRDAAEALFRIQDKNAALSSELGKDL 1981

Query: 7008 SNLQAKIQKHEAFEAE-VQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
            ++  A  +KHEAFE E V   A+    +D +     ++    ++ I    E +   W
Sbjct: 1982 NSALALARKHEAFENELVPLEAQLQVLVDDSLRLQTKYPGDNAKAIAAEQENVIQYWNVL 2041

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  +  +L  +  L HF+ Q  +++ W       + AE+   D      L+ + D
Sbjct: 2042 KEKSALRNDQLHASCDLQHFLTQVRDLMSWATNLRAALQAEEHVSDAAGATALKIQHDAI 2101

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGA 6472
              E+   +    E+N+ +D +V+ GH    ++ +K   + D   +L++    +K  L
Sbjct: 2102 YGEIEAREQTFRELNELSDSMVQTGHYAATEVEEKCSALLDERAKLHSAYNKKKILLEQK 2161

Query: 6471 HQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
              +  F RDA         ++  LSS D+G+ +  VQ   ++HE  E+ +   + K+  L
Sbjct: 2162 IDLFCFMRDAKVIDNISSGQEATLSSSDFGQTVEVVQDQVKRHEAFEKLIQTQDEKVAIL 2221

Query: 6291 EKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLI 6112
            ++   KL E +   +E I ++  +       +K+    R+  L  +    +F+ D  +
Sbjct: 2222 QEHGRKLVEQNHYDSENIRRRLREIVERRQKVKDLCALRRQKLANALLYAQFIRDCAEAG 2281

Query: 6111 SWIGDMKAVIGADELAKDVAGAEAL------LESHQEHKGEIDARADSFNQTASAGQKLV 5950
            +WI + +  + AD  A   AGA  +      L+  Q    E++A      +    G+KL+
Sbjct: 2282 AWINEKQKKLEAD--AHSYAGASNMEDKVKKLKKLQAFDAEVNANEGRIREVRDKGEKLI 2339

Query: 5949 EMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEA 5770
                  + E+Q++L KL    + LL     R    ++  D+  F    ++ E W+  +E
Sbjct: 2340 AKKHECAGEIQDELVKLMQSWNVLLNELASRSRGLKEAQDILEFNTQLDKLEAWIRDKEM 2399

Query: 5769 FLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXX 5590
             +   + G  L+    L +K +D +  +   +++I  +++ A KL+        +V +
Sbjct: 2400 MIHAGETGRDLEHCNALRRKLDDVDSDMRVDDQRIKNINQLADKLVSQDKVEGKNVQQRR 2459

Query: 5589 XXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK-LSTARDDSYLDPTNI 5413
                              + L  +Y+   F+RD D+    I EK L+ + DD+  D   +
Sbjct: 2460 ENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDVDDTAERIAEKMLAMSVDDTGRDLIAV 2519

Query: 5412 RGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDAT 5233
                +K    E+++ A E ++ +  ++   + D     A +I ++L ++   WNEL +A+
Sbjct: 2520 EALKRKQEAIERDMTAVEQKIREHETSAAALADKYPDNAINIVEKLDELRKQWNELQNAS 2579

Query: 5232 NKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDF 5053
             K+   L++     +F  N++++E W +E+   +   D   +  ++ + + +I L
Sbjct: 2580 VKRAEMLKQGYTAHKFTANVKELELWANEM---IKRMDSASNPATIADCEAQIQL----- 2631

Query: 5052 NAHNDR---VDGIKQLAQQFQE----------EEHFNAPVIVRKQENLQQRYNALRDPLE 4912
              H++R   +DG   + +  QE          E       + +   NL+     L D  +
Sbjct: 2632 --HHERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKALRNLEDLNKHLHDSWK 2689

Query: 4911 KRKRKLGESHQGNQLFRDIEDELA-WIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEI 4735
             R R L E+HQ  QLF++  D++  W+  KE    + + G     V+ LIKK +A   E
Sbjct: 2690 GRFRGLKEAHQ-LQLFKEQADQIVEWLTNKEAFLNNDDLGESFTAVEALIKKHEAF--EK 2746

Query: 4734 ANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAH 4555
              H ++I  +   A +++ +  F A  I+ +L  +      L + AE R+  L +SLQ
Sbjct: 2747 LLHSNRIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAETRKQKLQESLQLQ 2806

Query: 4554 QYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA 4375
            Q+L    E + W ++K  I    +Y ++  + ++ ++KH A  ++L A  G +  + ++
Sbjct: 2807 QFLRSLYEVEKWTNQKMQIALDENY-REPSNLQSKIQKHAAFDAELLANSGRVTAVIEEG 2865

Query: 4374 SQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLT------LLNASNRDW--WK 4219
                  E     L ++  L + + + +  RE S +K + L       L   S  D+  W
Sbjct: 2866 ESLINAEHYASSLVQE-QLDIVENEWQKLREASREKKERLAEAYEALLFQRSLEDFNNWM 2924

Query: 4218 VEV-----NDRQGFVPAAYVKRIE-----PGTAQQHAQ--QQVNSIGGK--------QSE 4099
             EV     ++  G   A+    ++           HA   +Q+ +   K        + E
Sbjct: 2925 DEVEAQLSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDAKMLSSDHFLKDE 2984

Query: 4098 IED-------KYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGT 3940
            + +       +Y  L      R+  LE++ + +Q LR+A D   W+  +E  AA +++G+
Sbjct: 2985 LHESAMVTIKRYHSLHEPTTIRRDNLEDSLQLHQFLRDAEDELLWLNEKEPQAASKDLGS 3044

Query: 3939 DLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQT------ETAVRIRQQIED 3778
             L  V+ LQKK    +      E+ +QE   I +AL   GQ           +I +Q
Sbjct: 3045 SLTAVQSLQKKHQALEA-----EILIQE--PIISALVQRGQQMIRDNHYAVEQIERQCGQ 3097

Query: 3777 LNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQA 3598
            L ++   L         +L  A E Q+F+ + +E   W++EK   + S+D+G+D  SV +
Sbjct: 3098 LQSKLVNLRHLTNVRRLRLLDAVESQQFYAEANEAEFWLREKKPIISSQDYGKDEDSVAS 3157

Query: 3597 LQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANN 3418
            LQ+K +G++R+L A    ++ ++  A+ L+      +E+I     ++  Q+  L   A
Sbjct: 3158 LQKKLDGLQRELGAFKPTVEKIETLASGLQARGHFDSEKIKSKNDKIQYQFQELNRLAAE 3217

Query: 3417 RKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDS 3238
            R++KL +      F+ +  DL +WI        S+E   DV   E L  + + + + +++
Sbjct: 3218 REKKLAEMKKLYEFVREIDDLQEWIEVQMTTAGSEEYGTDVEHVEQLTAQFESFVSNLNA 3277

Query: 3237 RAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLF 3058
              +   A    G  LL+  +     I+ +     +  + L+D  VAR+  L    ++ +F
Sbjct: 3278 NESRLTACVAKGEALLSEGNPNRDTIKAKRDETKQLWEELKDLVVARQEALAGARQVHVF 3337

Query: 3057 YRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAES 2884
             R  ++   W++ + + +  ED   D   ++SL++ HE F+  +   +E+++ +   A+
Sbjct: 3338 DRTADETIAWVNEKISSVLSEDYGHDLETIQSLVRTHEAFEAELGAIKEQLESVVNEAQK 3397

Query: 2883 LIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEK 2704
            L          +  KRD+ ++ W+ LK+  +Q++ KL +++ LQ +  +  ++  W+ E
Sbjct: 3398 LADTYPDAKEHIEVKRDETIEVWSELKDRTVQRKEKLTQAEQLQAYFDEYRDLMAWINEM 3457

Query: 2703 F-QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAV 2527
              +I   +  +D    +    K   F A  +   D+I A+++    L++N         +
Sbjct: 3458 LAKITAPDLAKDVAGAEALIDKH--FLA--NEVQDKI-AVLEQRKRLLDN--------TI 3504

Query: 2526 SARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKD 2347
              RL    + ++L + T              + F+   +D+E W+   ++ L+    G
Sbjct: 3505 VQRL----EMYELNLDT--------------QRFLKEAEDMESWIISRQMQLKESKLGDS 3546

Query: 2346 LASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLEN------DQFQGQQIAERRKLIA 2185
            +A VE+LL+KH   E  + A +++V  +  +  +LLE       +  Q  +IAE+ ++
Sbjct: 3547 IAQVEDLLRKHEDFEKTVAAQEEKV--LALKRITLLEQKFKKQLEAEQAARIAEKERIER 3604

Query: 2184 DRYDGVKKMATDR 2146
            +R++ +K+    R
Sbjct: 3605 ERHEALKQKEVQR 3617



 Score =  405 bits (1040), Expect = e-110
 Identities = 378/1827 (20%), Positives = 771/1827 (41%), Gaps = 58/1827 (3%)
 Frame = -1

Query: 7116 LEEARQFQYFKRDADELNVWILEKLQTAQEENF-RDPSNLQAKIQKHEAFEAEVQAHAKT 6940
            +E   + +YF   A EL  WI E+ Q    E++  D  +L     K +  +  ++  A+
Sbjct: 1841 MESLYRHEYFVESA-ELEQWIKEQEQAVNSEDYGHDYEHLLILQNKFDDLKHRIEVGAER 1899

Query: 6939 IANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQC 6760
                +     +I  +      I+KR E L   W         +  KL  A ++  F R
Sbjct: 1900 FNQCENFAKKLIGGDSPYVSEIEKRQELLSNAWQHLLEQLDAREKKLHAAGEIHRFHRDA 1959

Query: 6759 DEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEE 6580
             E L+ I++K   +++E +G DL     L RK + F  EL   + ++  +   + +L  +
Sbjct: 1960 AEALFRIQDKNAALSSE-LGKDLNSALALARKHEAFENELVPLEAQLQVLVDDSLRLQTK 2018

Query: 6579 GHSEHDQ-IYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLA 6403
               ++ + I  ++++V   W+ L   +A R + L  +  +Q F     + ++W      A
Sbjct: 2019 YPGDNAKAIAAEQENVIQYWNVLKEKSALRNDQLHASCDLQHFLTQVRDLMSWATNLRAA 2078

Query: 6402 LSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKND 6223
            L ++++  D     AL+ +H+    ++ A E    +L + +  + +T    A  + +K
Sbjct: 2079 LQAEEHVSDAAGATALKIQHDAIYGEIEAREQTFRELNELSDSMVQTGHYAATEVEEKCS 2138

Query: 6222 DTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAE 6043
                    L      +K  LE+   L  F+ D + + +     +A + + +  + V   +
Sbjct: 2139 ALLDERAKLHSAYNKKKILLEQKIDLFCFMRDAKVIDNISSGQEATLSSSDFGQTVEVVQ 2198

Query: 6042 ALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWE 5863
              ++ H+  +  I  + +        G+KLVE    +S  ++ +L ++   +  +  L
Sbjct: 2199 DQVKRHEAFEKLIQTQDEKVAILQEHGRKLVEQNHYDSENIRRRLREIVERRQKVKDLCA 2258

Query: 5862 ERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL---ANTDLGDS-LDSVEHLIKKHEDFE 5695
             RR      +    F RD  +A  W+N+++  L   A++  G S ++     +KK + F+
Sbjct: 2259 LRRQKLANALLYAQFIRDCAEAGAWINEKQKKLEADAHSYAGASNMEDKVKKLKKLQAFD 2318

Query: 5694 KSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESY 5515
              + A E +I  + +   KLI  +H  A ++ +                  R   LKE+
Sbjct: 2319 AEVNANEGRIREVRDKGEKLIAKKHECAGEIQDELVKLMQSWNVLLNELASRSRGLKEAQ 2378

Query: 5514 KRQTFDRDCDEMVSWITEKL------STARDDSYLDPTNIRGKLQKHINFEQELKANENR 5353
                F+   D++ +WI +K        T RD  + +   +R KL    + + +++ ++ R
Sbjct: 2379 DILEFNTQLDKLEAWIRDKEMMIHAGETGRDLEHCNA--LRRKLD---DVDSDMRVDDQR 2433

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            + +I    ++++        ++  R    NN W  L  A ++    L  A     FNR++
Sbjct: 2434 IKNINQLADKLVSQDKVEGKNVQQRRENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDV 2493

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
            +D    ++E    ++ +D G+DL++V+ L++K   IE D  A   ++   +  A    ++
Sbjct: 2494 DDTAERIAEKMLAMSVDDTGRDLIAVEALKRKQEAIERDMTAVEQKIREHETSAAALADK 2553

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
               NA  IV K + L++++N L++   KR   L + +  ++   ++++   W  E  +
Sbjct: 2554 YPDNAINIVEKLDELRKQWNELQNASVKRAEMLKQGYTAHKFTANVKELELWANEMIKRM 2613

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLA---PEIRDK 4642
             S +    +   +  I+      AEI   D     +      ++ +    +     +
Sbjct: 2614 DSASNPATIADCEAQIQLHHERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKA 2673

Query: 4641 LAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDS 4462
            L  L D  + L    + R   L ++ Q   +   A++   W++ KE  + + D G+   +
Sbjct: 2674 LRNLEDLNKHLHDSWKGRFRGLKEAHQLQLFKEQADQIVEWLTNKEAFLNNDDLGESFTA 2733

Query: 4461 AEALLKKHRAL--------LSDLEAFKGTI----------------------EDLRKQAS 4372
             EAL+KKH A         + +LE F   I                      + L   A
Sbjct: 2734 VEALIKKHEAFEKLLHSNRIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAE 2793

Query: 4371 QCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGF 4192
              K + Q   QL +  + +LY+ ++ + +++ +   +     +       K    D +
Sbjct: 2794 TRKQKLQESLQL-QQFLRSLYEVEKWTNQKMQIALDENYREPSNLQSKIQKHAAFDAELL 2852

Query: 4191 VPAAYVKR-IEPGTAQQHAQQQVNSIGGKQSEI-EDKYQRLMMLGETRKRKLEEACKGYQ 4018
              +  V   IE G +  +A+   +S+  +Q +I E+++Q+L      +K +L EA +
Sbjct: 2853 ANSGRVTAVIEEGESLINAEHYASSLVQEQLDIVENEWQKLREASREKKERLAEAYEALL 2912

Query: 4017 LLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIAT 3838
              R   D   W+   EA  + ++ G DL  V  L KK D  + D+  +    +++
Sbjct: 2913 FQRSLEDFNNWMDEVEAQLSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDA 2972

Query: 3837 ALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQ 3658
             + S         + +       R+ +L          L  + ++ +F RD ++   W+
Sbjct: 2973 KMLSSDHF-LKDELHESAMVTIKRYHSLHEPTTIRRDNLEDSLQLHQFLRDAEDELLWLN 3031

Query: 3657 EKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQI 3478
            EK+    S+D G  L +VQ+LQ+KH+ +E ++      I +L ++  ++ + +  A EQI
Sbjct: 3032 EKEPQAASKDLGSSLTAVQSLQKKHQALEAEILIQEPIISALVQRGQQMIRDNHYAVEQI 3091

Query: 3477 YDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELAND 3298
                 +L  +   L    N R+ +LLD+ + Q+F ++  +   W+     ++SSQ+   D
Sbjct: 3092 ERQCGQLQSKLVNLRHLTNVRRLRLLDAVESQQFYAEANEAEFWLREKKPIISSQDYGKD 3151

Query: 3297 VTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGL 3118
                 +L ++    + E+ +   T +  +   + L    H+ +  I+++   +    + L
Sbjct: 3152 EDSVASLQKKLDGLQRELGAFKPTVEKIETLASGLQARGHFDSEKIKSKNDKIQYQFQEL 3211

Query: 3117 EDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLIKKHEDF 2944
                  R   L +  +L  F R+ +    W+  +      E+   D  +VE L  + E F
Sbjct: 3212 NRLAAEREKKLAEMKKLYEFVREIDDLQEWIEVQMTTAGSEEYGTDVEHVEQLTAQFESF 3271

Query: 2943 DKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGES 2764
               +N  E ++       E+L+   + +   +  KRD+    W  LK+ ++ ++  L  +
Sbjct: 3272 VSNLNANESRLTACVAKGEALLSEGNPNRDTIKAKRDETKQLWEELKDLVVARQEALAGA 3331

Query: 2763 QTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAI 2587
            + +  F R ADE   W+ EK      E+Y  D   IQ   +  +AFEAEL A  +++ ++
Sbjct: 3332 RQVHVFDRTADETIAWVNEKISSVLSEDYGHDLETIQSLVRTHEAFEAELGAIKEQLESV 3391

Query: 2586 IQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKD 2407
            +     L +       +  +  +     + W  L   T ++  +L +A + +++    +D
Sbjct: 3392 VNEAQKLADTYP--DAKEHIEVKRDETIEVWSELKDRTVQRKEKLTQAEQLQAYFDEYRD 3449

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQ 2227
            L  W+ E+   + + D  KD+A  E L+ KH L        QD++  + EQ   LL+N
Sbjct: 3450 LMAWINEMLAKITAPDLAKDVAGAEALIDKHFLANEV----QDKIAVL-EQRKRLLDNTI 3504

Query: 2226 FQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSS 2047
             Q  ++ E                          L+  +F ++ +D ESWI  +++ +
Sbjct: 3505 VQRLEMYELN------------------------LDTQRFLKEAEDMESWIISRQMQLKE 3540

Query: 2046 DDYGRDLPGVQNLRRKHRRIDTELASHEPQV------SLVKLKGEELLRSAAEAGVGEDQ 1885
               G  +  V++L RKH   +  +A+ E +V      +L++ K ++ L +   A + E +
Sbjct: 3541 SKLGDSIAQVEDLLRKHEDFEKTVAAQEEKVLALKRITLLEQKFKKQLEAEQAARIAEKE 3600

Query: 1884 --IKKRMEDLEQSWGQIRDLTGNRHQR 1810
               ++R E L+Q   +++ +T  R +R
Sbjct: 3601 RIERERHEALKQK--EVQRITEERRRR 3625



 Score =  352 bits (902), Expect = 1e-94
 Identities = 279/1135 (24%), Positives = 509/1135 (44%), Gaps = 18/1135 (1%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEK-LQTAQEENF 7018
            ++ QRR+     +   +      RD L  A +   F RD D+    I EK L  + ++
Sbjct: 2454 NVQQRRENFNNKWKSLQGALSRYRDLLAGAYEIHVFNRDVDDTAERIAEKMLAMSVDDTG 2513

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            RD   ++A  +K EA E ++ A  + I   + +  A+       + +I ++L+EL   W
Sbjct: 2514 RDLIAVEALKRKQEAIERDMTAVEQKIREHETSAAALADKYPDNAINIVEKLDELRKQWN 2573

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +   L+Q      F     E+  W  E    + +      +   E   +
Sbjct: 2574 ELQNASVKRAEMLKQGYTAHKFTANVKELELWANEMIKRMDSASNPATIADCEAQIQLHH 2633

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSE---HDQIYKKRDDVNDAWHRLNTLAATRKE 6487
            +   E+        ++ +  ++LV E       +D + K   ++ D    L+     R
Sbjct: 2634 ERKAEIDGRDLVFRDLQEHGERLVAENRESSVRNDHVEKALRNLEDLNKHLHDSWKGRFR 2693

Query: 6486 GLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEG 6307
            GL  AHQ+Q F   AD+ + W+  K+  L++DD G     V+AL +KHE  E+ L +
Sbjct: 2694 GLKEAHQLQLFKEQADQIVEWLTNKEAFLNNDDLGESFTAVEALIKKHEAFEKLLHS--N 2751

Query: 6306 KMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLAD 6127
            ++ +LE+ A ++    P  A+ I Q+     +  + L   A+ RK  L+ S QL +FL
Sbjct: 2752 RIGELERFAEEILAESPFEADVIKQRLYAVVSRKDKLLASAETRKQKLQESLQLQQFLRS 2811

Query: 6126 YRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVE 5947
              ++  W  + K  I  DE  ++ +  ++ ++ H     E+ A +         G+ L+
Sbjct: 2812 LYEVEKWT-NQKMQIALDENYREPSNLQSKIQKHAAFDAELLANSGRVTAVIEEGESLIN 2870

Query: 5946 MGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAF 5767
                 S  VQE+L+ +++E   L     E++    +  +  LF R  E    WM++ EA
Sbjct: 2871 AEHYASSLVQEQLDIVENEWQKLREASREKKERLAEAYEALLFQRSLEDFNNWMDEVEAQ 2930

Query: 5766 LANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXX 5587
            L++ D G  L SV +L+KKH+  E  +A   +    +     K++   H+  D++ E
Sbjct: 2931 LSSEDYGRDLASVHNLLKKHDMLEADVAHHADTCEQIKATDAKMLSSDHFLKDELHESAM 2990

Query: 5586 XXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKL-STARDDSYLDPTNIR 5410
                           R + L++S +   F RD ++ + W+ EK    A  D     T ++
Sbjct: 2991 VTIKRYHSLHEPTTIRRDNLEDSLQLHQFLRDAEDELLWLNEKEPQAASKDLGSSLTAVQ 3050

Query: 5409 GKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATN 5230
               +KH   E E+   E  +  +   G+Q+I   H+A + I  +  Q+ +    L   TN
Sbjct: 3051 SLQKKHQALEAEILIQEPIISALVQRGQQMIRDNHYAVEQIERQCGQLQSKLVNLRHLTN 3110

Query: 5229 KKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFN 5050
             +  +L +A   QQF     + E WL E +  ++S+DYGKD  SV +LQKK+  ++ +
Sbjct: 3111 VRRLRLLDAVESQQFYAEANEAEFWLREKKPIISSQDYGKDEDSVASLQKKLDGLQRELG 3170

Query: 5049 AHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQ 4870
            A    V+ I+ LA   Q   HF++  I  K + +Q ++  L     +R++KL E  +  +
Sbjct: 3171 AFKPTVEKIETLASGLQARGHFDSEKIKSKNDKIQYQFQELNRLAAEREKKLAEMKKLYE 3230

Query: 4869 LFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAN 4690
              R+I+D   WI  +   AGS   G D+  V+ L  + ++ ++ +  ++S++ +  +
Sbjct: 3231 FVREIDDLQEWIEVQMTTAGSEEYGTDVEHVEQLTAQFESFVSNLNANESRLTACVAKGE 3290

Query: 4689 DMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSE 4510
             ++ +G+     I+ K  + +  W  LK     R+  L  + Q H +   A+E  AW++E
Sbjct: 3291 ALLSEGNPNRDTIKAKRDETKQLWEELKDLVVARQEALAGARQVHVFDRTADETIAWVNE 3350

Query: 4509 KEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK--YQEQPMG-Q 4339
            K   V S DYG D ++ ++L++ H A  ++L A K  +E +  +A +    Y +     +
Sbjct: 3351 KISSVLSEDYGHDLETIQSLVRTHEAFEAELGAIKEQLESVVNEAQKLADTYPDAKEHIE 3410

Query: 4338 LGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEP 4159
            + RD  + ++   E   R V  K+     L  A     +  E  D   ++     K   P
Sbjct: 3411 VKRDETIEVWS--ELKDRTVQRKE----KLTQAEQLQAYFDEYRDLMAWINEMLAKITAP 3464

Query: 4158 GTAQQHAQQQVNSIGGKQ---SEIEDKY----QRLMMLGETRKRKLEEA---CKGYQLLR 4009
              A+  A  +  ++  K    +E++DK     QR  +L  T  ++LE         + L+
Sbjct: 3465 DLAKDVAGAE--ALIDKHFLANEVQDKIAVLEQRKRLLDNTIVQRLEMYELNLDTQRFLK 3522

Query: 4008 EANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQI 3844
            EA D+  WI SR+    + ++G  + QVE L +K +DF+  + A E ++  + +I
Sbjct: 3523 EAEDMESWIISRQMQLKESKLGDSIAQVEDLLRKHEDFEKTVAAQEEKVLALKRI 3577



 Score =  142 bits (358), Expect = 1e-31
 Identities = 100/458 (21%), Positives = 209/458 (44%), Gaps = 11/458 (2%)
 Frame = -1

Query: 2925 QEEKIKGLKLFAESLIK--NNHYDSPAVTRKRDQILDRWNGLKEAL----IQKRFKLGES 2764
            +  +I+ L     +L+K  N  + +P   +  + I   W  L+ A     +  R +L
Sbjct: 347  ERSEIEALYFHVNTLLKSLNQPHYTPQDGKMINDIEKAWQRLENAEHNREVALRDELLRQ 406

Query: 2763 QTLQQ----FSRDADEIENWMTEKFQIAQEENYRDPTN-IQQKHQKQQAFEAELHANSDR 2599
            + L+Q    F + +   E ++ E  Q+  +  Y      +    +K +A  A++ A +DR
Sbjct: 407  EKLEQLNFKFEKKSVLREGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILARADR 466

Query: 2598 IAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMA 2419
               +    N L +      G+  V  R   +  +W  L++       +L + +   + +
Sbjct: 467  FNDLTDMCNELHQENY--HGKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLR 524

Query: 2418 AVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLL 2239
             +      +  ++    SED G  L  VE LL+ HSLLE  +    +       Q ++
Sbjct: 525  EIDATMTTIKALQAQFASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQGEAFK 584

Query: 2238 ENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKL 2059
              D     Q+  +   +A  Y+ +  M+  RR +L +A + +QF  D ++EE W+ +K+
Sbjct: 585  RGDYKDTSQLDAKLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQR 644

Query: 2058 LVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIK 1879
            +  +    +DL  V +L++KH+ ++ E+   +P+ + +   G++L+    +       ++
Sbjct: 645  ICKAGITAKDLRAVMSLQQKHKALEDEMKVRKPKSNQITEAGKKLI---VDKHSRMSDVQ 701

Query: 1878 KRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENM 1699
             +++ L++ W  + DL   R ++L+++     +  D  E ++W+NEK  ++ SD+FG +
Sbjct: 702  GKIDSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVDE 761

Query: 1698 AGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
               Q LL++H   Q +L  +   + +L  + + LI  G
Sbjct: 762  PSAQALLQRHRDLQGELNAYSGDILNLNQQAEKLIKAG 799



 Score =  139 bits (349), Expect = 1e-30
 Identities = 92/380 (24%), Positives = 186/380 (48%), Gaps = 1/380 (0%)
 Frame = -1

Query: 2403 EFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQF 2224
            E +L E+  +L    YG  L  V+  +KKH  + ADI+A  DR  ++ +  + L + +
Sbjct: 424  EGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILARADRFNDLTDMCNELHQENYH 483

Query: 2223 QGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSD 2044
               ++ +R   +  ++  + ++  + + KLS+  ++    R+ID   + IK  +   +S+
Sbjct: 484  GKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLREIDATMTTIKALQAQFASE 543

Query: 2043 DYGRDLPGVQNLRRKHRRIDTELAS-HEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRME 1867
            D G  L GV+ L + H  ++ ++ +  E Q   V+ +GE   R   +      Q+  ++
Sbjct: 544  DVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVR-QGEAFKRGDYK---DTSQLDAKLA 599

Query: 1866 DLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQ 1687
            +L + + ++  ++  R  RLDE+  F  F+ D E EE W+ +KQ+I  +    +++  V
Sbjct: 600  ELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQRICKAGITAKDLRAVM 659

Query: 1686 GLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAE 1507
             L +KH   + ++++ K +   +   G  LI + +     ++ + D L+     +E + +
Sbjct: 660  SLQQKHKALEDEMKVRKPKSNQITEAGKKLIVDKHSRMSDVQGKIDSLQEHWKALEDLVD 719

Query: 1506 GRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLN 1327
             R  +L D +   Q+    +  +SW+ EK   V S+DFG D  S Q LL +       LN
Sbjct: 720  LRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVDEPSAQALLQRHRDLQGELN 779

Query: 1326 AFEHEGIQRITELKDQLVSS 1267
            A+  + I  + +  ++L+ +
Sbjct: 780  AYSGD-ILNLNQQAEKLIKA 798



 Score =  135 bits (341), Expect = 1e-29
 Identities = 94/399 (23%), Positives = 180/399 (44%), Gaps = 15/399 (3%)
 Frame = -1

Query: 7002 LQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXX 6823
            + A ++KHEA  A++ A A    +L    N + Q N+   + +KKR  E+   W
Sbjct: 446  VDATVKKHEAISADILARADRFNDLTDMCNELHQENYHGKDRVKKRELEVITKWKELLEL 505

Query: 6822 XXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKE 6643
                 +KL Q   L++ +R+ D  +  I+  +    +ED+G  L  VE L +     L E
Sbjct: 506  LENHKLKLSQMSSLMNLLREIDATMTTIKALQAQFASEDVGPHLLGVEELLQAHS--LLE 563

Query: 6642 LGNHQYRINEINQAADKLVEEG-------HSEHDQIYKKRDDVNDAWHRLNTLAATRKEG 6484
            L     ++  + +   + V +G       + +  Q+  K  ++   +  L  ++A R+
Sbjct: 564  L-----QVTTLGETQRRYVRQGEAFKRGDYKDTSQLDAKLAELAKLYEELLAMSAARRAR 618

Query: 6483 LFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGK 6304
            L  A    +F  D +    W+ +K     +    +DL  V +LQ+KH+  E ++   + K
Sbjct: 619  LDEARDFYQFVEDHENEEGWLVDKQRICKAGITAKDLRAVMSLQQKHKALEDEMKVRKPK 678

Query: 6303 MLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
              Q+ +   KL      R   +  K D  +  W AL++    RK  LE + + +++ AD
Sbjct: 679  SNQITEAGKKLIVDKHSRMSDVQGKIDSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADA 738

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEM 5944
             +  SW+ +  A++ +D+   D   A+ALL+ H++ +GE++A +          +KL++
Sbjct: 739  NEADSWLNEKMALVASDDFGVDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAEKLIKA 798

Query: 5943 GI--------PESPEVQEKLEKLDHEKSSLLGLWEERRI 5851
            GI        PE  +  E+ E ++  +     +WE+  +
Sbjct: 799  GICTLDLSAEPEPVQEMEQEEWVNETRLVPKEVWEDEPV 837



 Score =  122 bits (305), Expect = 2e-25
 Identities = 96/457 (21%), Positives = 186/457 (40%), Gaps = 19/457 (4%)
 Frame = -1

Query: 4188 PAAYVKRIEPGTAQQHAQQQVNSIG--------GKQ-SEIEDKYQRLMMLGETRKRKLEE 4036
            P  Y +R E      H    + S+         GK  ++IE  +QRL      R+  L +
Sbjct: 342  PPKYKERSEIEALYFHVNTLLKSLNQPHYTPQDGKMINDIEKAWQRLENAEHNREVALRD 401

Query: 4035 ACKGYQLLREANDLAE--------WIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLK 3880
                 + L + N   E        ++     V      G  L QV+   KK +    D+
Sbjct: 402  ELLRQEKLEQLNFKFEKKSVLREGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADIL 461

Query: 3879 ANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQ 3700
            A   R  ++  +   L          R++++  ++  +W+ L         +L     +
Sbjct: 462  ARADRFNDLTDMCNELHQENY-HGKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLM 520

Query: 3699 RFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKA 3520
               R++D T   I+       SED G  L  V+ L + H  +E  +  LG+  +    +
Sbjct: 521  NLLREIDATMTTIKALQAQFASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQG 580

Query: 3519 NRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA 3340
               ++   +   Q+     EL + +  L + +  R+ +L ++ D+ +F+ D+ +   W+
Sbjct: 581  EAFKRGDYKDTSQLDAKLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLV 640

Query: 3339 SMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDI 3160
               ++  +   A D+    +L ++H+    E+  R        + G +L+   H    D+
Sbjct: 641  DKQRICKAGITAKDLRAVMSLQQKHKALEDEMKVRKPKSNQITEAGKKLIVDKHSRMSDV 700

Query: 3159 ENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD 2980
            + ++  + E  K LED    R+  L+   E   +Y D  +AD+W++ + A +A +D   D
Sbjct: 701  QGKIDSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVD 760

Query: 2979 --NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIK 2875
              + ++L+++H D    +N     I  L   AE LIK
Sbjct: 761  EPSAQALLQRHRDLQGELNAYSGDILNLNQQAEKLIK 797



 Score =  121 bits (303), Expect = 3e-25
 Identities = 106/502 (21%), Positives = 219/502 (43%), Gaps = 20/502 (3%)
 Frame = -1

Query: 3360 DLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRT-----EIDSRAATFQAFDQFGNQ 3196
            +L+ WI +    +  +   N V G +  L   +EYRT     +   R+     +
Sbjct: 302  NLLSWIRAKTVELEKRNFPNSVEGIQGELLAFKEYRTVEKPPKYKERSEIEALYFHVNTL 361

Query: 3195 L--LNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNIL-DQCLELQLFYRDCEQADTWM 3025
            L  LN  HY   D    +  + +A + LE+A   R   L D+ L  +   +   + +
Sbjct: 362  LKSLNQPHYTPQD-GKMINDIEKAWQRLENAEHNREVALRDELLRQEKLEQLNFKFEKKS 420

Query: 3024 SAREAFLAQE---------DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKN 2872
              RE +L +           P+   V++ +KKHE     I  + ++   L      L +
Sbjct: 421  VLREGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILARADRFNDLTDMCNELHQE 480

Query: 2871 NHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQI 2695
            N++    V ++  +++ +W  L E L   + KL +  +L    R+ D     +   + Q
Sbjct: 481  NYHGKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLREIDATMTTIKALQAQF 540

Query: 2694 AQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGE--AAVSA 2521
            A E+       +++  Q     E ++    +     ++ G    E  K G  +  + + A
Sbjct: 541  ASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQG----EAFKRGDYKDTSQLDA 596

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            +L  L   ++ L+  +  +  RL EA     F+   ++ E WL + + + ++    KDL
Sbjct: 597  KLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQRICKAGITAKDLR 656

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            +V +L +KH  LE ++   + +  ++ E    L+ +   +   +  +   + + +  ++
Sbjct: 657  AVMSLQQKHKALEDEMKVRKPKSNQITEAGKKLIVDKHSRMSDVQGKIDSLQEHWKALED 716

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
            +   R+ +L  A   +Q++ D ++ +SW+ EK  LV+SDD+G D P  Q L ++HR +
Sbjct: 717  LVDLRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVDEPSAQALLQRHRDLQG 776

Query: 1980 ELASHEPQVSLVKLKGEELLRS 1915
            EL ++   +  +  + E+L+++
Sbjct: 777  ELNAYSGDILNLNQQAEKLIKA 798



 Score =  117 bits (293), Expect = 4e-24
 Identities = 90/403 (22%), Positives = 171/403 (42%), Gaps = 2/403 (0%)
 Frame = -1

Query: 6798 QQALKLLHFIRQCDEILY--WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQY 6625
            Q+ L+ L+F  +   +L   ++ E    +T    G  L  V+   +K +    ++
Sbjct: 406  QEKLEQLNFKFEKKSVLREGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILARAD 465

Query: 6624 RINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
            R N++    ++L +E +   D++ K+  +V   W  L  L    K  L     +    R+
Sbjct: 466  RFNDLTDMCNELHQENYHGKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLRE 525

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
             D T+  I       +S+D G  L  V+ L + H   E  +  L     +  ++
Sbjct: 526  IDATMTTIKALQAQFASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQGEAFKR 585

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
                    +  K  +    +  L   +  R+  L+ +   ++F+ D+ +   W+ D + +
Sbjct: 586  GDYKDTSQLDAKLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQRI 645

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
              A   AKD+    +L + H+  + E+  R    NQ   AG+KL+        +VQ K++
Sbjct: 646  CKAGITAKDLRAVMSLQQKHKALEDEMKVRKPKSNQITEAGKKLIVDKHSRMSDVQGKID 705

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             L     +L  L + R+   E   +   +Y D  +A++W+N++ A +A+ D G    S +
Sbjct: 706  SLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVDEPSAQ 765

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAE 5596
             L+++H D +  L A    I  L++ A KLI+      D  AE
Sbjct: 766  ALLQRHRDLQGELNAYSGDILNLNQQAEKLIKAGICTLDLSAE 808



 Score =  103 bits (258), Expect = 5e-20
 Identities = 74/310 (23%), Positives = 135/310 (42%), Gaps = 1/310 (0%)
 Frame = -1

Query: 7197 DDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILE-KLQTAQEEN 7021
            D + +R  EV+  +    +  +  + +L +        R+ D     I   + Q A E+
Sbjct: 486  DRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLREIDATMTTIKALQAQFASEDV 545

Query: 7020 FRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
                  ++  +Q H   E +V    +T     + G A  + ++  +  +  +L EL  L+
Sbjct: 546  GPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQGEAFKRGDYKDTSQLDAKLAELAKLY 605

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     +  +L +A     F+   +    W+ +K+    A     DL  V  LQ+K
Sbjct: 606  EELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQRICKAGITAKDLRAVMSLQQKH 665

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
                 E+   + + N+I +A  KL+ + HS    +  K D + + W  L  L   RK  L
Sbjct: 666  KALEDEMKVRKPKSNQITEAGKKLIVDKHSRMSDVQGKIDSLQEHWKALEDLVDLRKRQL 725

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              A +  ++  DA+E  +W+ EK   ++SDD+G D  + QAL ++H   + +L A  G +
Sbjct: 726  EDAAEAYQYYADANEADSWLNEKMALVASDDFGVDEPSAQALLQRHRDLQGELNAYSGDI 785

Query: 6300 LQLEKEAHKL 6271
            L L ++A KL
Sbjct: 786  LNLNQQAEKL 795



 Score = 93.6 bits (231), Expect = 6e-17
 Identities = 111/511 (21%), Positives = 204/511 (39%), Gaps = 62/511 (12%)
 Frame = -1

Query: 4857 IEDELAWIREKEQVAGSTNRGRDLIGVQN--LIKKQQALIAEIANHD--SQIESVSSAAN 4690
            I + L+WIR K       N    + G+Q   L  K+   + +   +   S+IE++    N
Sbjct: 300  ITNLLSWIRAKTVELEKRNFPNSVEGIQGELLAFKEYRTVEKPPKYKERSEIEALYFHVN 359

Query: 4689 DMIQ---QGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEA--- 4528
             +++   Q H+  P+    +  +   W+ L++    R   L D L   + L   N
Sbjct: 360  TLLKSLNQPHY-TPQDGKMINDIEKAWQRLENAEHNREVALRDELLRQEKLEQLNFKFEK 418

Query: 4527 -----DAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
                 + +++E   ++    YG      +A +KKH A+ +D+ A      DL    ++
Sbjct: 419  KSVLREGYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILARADRFNDLTDMCNEL- 477

Query: 4362 YQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKV--------EVN 4207
            +QE   G+          D  +K   EV  K  ++L LL        ++        E++
Sbjct: 478  HQENYHGK----------DRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLREID 527

Query: 4206 DRQGFVPAAYVKRIEPGTA----------QQHA--QQQVNSIGGKQ-------------- 4105
                 + A   +                 Q H+  + QV ++G  Q
Sbjct: 528  ATMTTIKALQAQFASEDVGPHLLGVEELLQAHSLLELQVTTLGETQRRYVRQGEAFKRGD 587

Query: 4104 -----------SEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAA 3958
                       +E+   Y+ L+ +   R+ +L+EA   YQ + +  +   W+  ++ +
Sbjct: 588  YKDTSQLDAKLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVDKQRICK 647

Query: 3957 QQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATA--LTSVGQTETAVRIRQQI 3784
                  DL  V  LQ+K    + ++K   VR  + NQI  A     V +      ++ +I
Sbjct: 648  AGITAKDLRAVMSLQQKHKALEDEMK---VRKPKSNQITEAGKKLIVDKHSRMSDVQGKI 704

Query: 3783 EDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSV 3604
            + L   W+AL         QL  A E  +++ D +E   W+ EK   + S+DFG D  S
Sbjct: 705  DSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEADSWLNEKMALVASDDFGVDEPSA 764

Query: 3603 QALQRKHEGVERDLAALGDKIKSLDEKANRL 3511
            QAL ++H  ++ +L A    I +L+++A +L
Sbjct: 765  QALLQRHRDLQGELNAYSGDILNLNQQAEKL 795



 Score = 53.9 bits (128), Expect = 6e-05
 Identities = 99/461 (21%), Positives = 180/461 (38%), Gaps = 26/461 (5%)
 Frame = -1

Query: 1755 AWMNEKQQILGSDNFGENMAGVQGLL---KKHDTFQVDLEL-HKQRVADLINKGDTLIHN 1588
            +W+  K   L   NF  ++ G+QG L   K++ T +   +   +  +  L    +TL+ +
Sbjct: 305  SWIRAKTVELEKRNFPNSVEGIQGELLAFKEYRTVEKPPKYKERSEIEALYFHVNTLLKS 364

Query: 1587 GN--HHAPHIKQRCDQLRARLIEIESMAEGRLAKLRD--------NSAYLQFMWKCDVVE 1438
             N  H+ P   +  + +      +E+    R   LRD             +F  K  + E
Sbjct: 365  LNQPHYTPQDGKMINDIEKAWQRLENAEHNREVALRDELLRQEKLEQLNFKFEKKSVLRE 424

Query: 1437 SWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQ 1258
             ++ E  Q +    +G  L  V   + K EA  A + A   +    +T++ ++L    +
Sbjct: 425  GYLNEMIQVLTDPRYGPALRQVDATVKKHEAISADILA-RADRFNDLTDMCNELHQENYH 483

Query: 1257 QSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFEN 1078
                ++KR   VI +W+ LL   E  +            + E+  A         + F
Sbjct: 484  GKDRVKKRELEVITKWKELLELLENHKLKLSQMSSLMNLLREID-ATMTTIKALQAQF-- 540

Query: 1077 AEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTW 898
            A ED+        L  +  L  AH   +  +++  E  R+     R+ ++F  G    T
Sbjct: 541  ASEDVGP-----HLLGVEELLQAHSLLELQVTTLGETQRRYV---RQGEAFKRGDYKDT- 591

Query: 897  FTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLR--REFAKLANAFHAWLTNTRQE 724
              +DA       L  + K  E+ LA    R+   D+ R   +F +       WL + +Q
Sbjct: 592  SQLDA------KLAELAKLYEELLAMSAARRARLDEARDFYQFVEDHENEEGWLVD-KQR 644

Query: 723  MMEAGGTLEE--QLDAVERKAK----EIKANKGQLRQIEEKGAMLERNLILDNRYTEHST 562
            + +AG T ++   + ++++K K    E+K  K +  QI E G    + LI+D
Sbjct: 645  ICKAGITAKDLRAVMSLQQKHKALEDEMKVRKPKSNQITEAG----KKLIVDKHSRMSDV 700

Query: 561  VG----IAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEA 451
             G    + + W  L+ L    +  LE   +A      + EA
Sbjct: 701  QGKIDSLQEHWKALEDLVDLRKRQLEDAAEAYQYYADANEA 741


>gi|161334|gb|AAA30008.1| alpha-spectrin
          Length = 682

 Score =  759 bits (1959), Expect = 0.0
 Identities = 386/678 (56%), Positives = 497/678 (72%), Gaps = 6/678 (0%)
 Frame = -1

Query: 4719 QIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSD 4540
            +I+ V+     M+ +GHF   EI  K+  L + W+ LK K+ +R+ DL+DSL+A QY +D
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFAD 64

Query: 4539 ANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKY 4360
            ANEA++WM EKEPIV S DYGKDEDSAE+ LKKH+ L++DL A++ TIE L+KQA  C+
Sbjct: 65   ANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGCRQ 124

Query: 4359 QEQPMGQ-LGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPA 4183
            Q+ P+ + +G++ V+ALYDY EKSPREVSMKKGDVL LLN+SN+DWWKVEVNDRQGFVPA
Sbjct: 125  QDIPISEDVGKEYVVALYDYMEKSPREVSMKKGDVLVLLNSSNKDWWKVEVNDRQGFVPA 184

Query: 4182 AYVKRIEPG-TAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLRE 4006
            AYVK+++   +A Q    +  +I  +Q  IE +YQ L+     RK  LEE+ K + L+RE
Sbjct: 185  AYVKKMDAAQSASQANLVEDANIMRRQENIEQEYQALLDKAGVRKEALEESVKRHSLVRE 244

Query: 4005 ANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTS 3826
            ANDL +W+  + AV    E+G DLEQVEVLQKKFDDF+ DLKANE RL E+N I   L
Sbjct: 245  ANDLIQWVNDKAAVVESAEVGDDLEQVEVLQKKFDDFQKDLKANESRLLEINTILETLDL 304

Query: 3825 VGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDD 3646
                E  + + Q++ DLN  W+AL          L +AHEVQRF RD DET+DWI +K+
Sbjct: 305  EKVPELTL-LSQKVNDLNTEWQALQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNK 363

Query: 3645 ALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQ 3466
            AL++E+FG DL SVQALQRKH+G+ERDL ALG ++++LDE A+RL Q+HP+ AE I   +
Sbjct: 364  ALNTENFGHDLHSVQALQRKHQGLERDLNALGKQVQTLDETADRLVQTHPDQAEPIVAKR 423

Query: 3465 RELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGA 3286
             E++E W+ L  +AN RK KL+DSYD QRFLSD+RDLM W   M  LV+S ELA DVTGA
Sbjct: 424  AEIDEAWHTLQDRANARKAKLMDSYDLQRFLSDFRDLMSWTNGMKTLVASDELAKDVTGA 483

Query: 3285 EALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAG-DIENRLQGVNEAR-KGLED 3112
            EALLERHQE  TE++ RA TFQAF+ FG +L+ + HYAA  +++ +L  + + R K LE
Sbjct: 484  EALLERHQELHTEMEPRAGTFQAFEAFGQELIKNDHYAASPEVQEKLDILGKRREKDLEV 543

Query: 3111 AWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQE--DPSGDNVESLIKKHEDFDK 2938
            +W  RR+ LDQCLELQLF RDCEQA+ WM AREAFLA E    S D+VESLIKKHEDFDK
Sbjct: 544  SWNDRRHKLDQCLELQLFLRDCEQAEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDK 603

Query: 2937 AINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQT 2758
            A++ QE+KI  ++ F + LI N+HYD PA+  KRDQ+L+RW+ LK ALI+KR KLGES T
Sbjct: 604  ALSLQEQKINAIESFPQQLINNDHYDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHT 663

Query: 2757 LQQFSRDADEIENWMTEK 2704
            LQQFSRDADE+E W++EK
Sbjct: 664  LQQFSRDADEVEAWISEK 681



 Score =  377 bits (969), Expect = e-102
 Identities = 205/485 (42%), Positives = 297/485 (60%), Gaps = 2/485 (0%)
 Frame = -1

Query: 6903 QHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKET 6724
            Q N     +I +R E +   +         +   L++++K    +R+ ++++ W+ +K
Sbjct: 198  QANLVEDANIMRRQENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAA 257

Query: 6723 YVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKR 6544
             V + ++G DLE VE+LQ+KFDDF K+L  ++ R+ EIN   + L  E   E   + +K
Sbjct: 258  VVESAEVGDDLEQVEVLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKV 317

Query: 6543 DDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNV 6364
            +D+N  W  L  L   R   L  AH+VQRF RDADET  WI +K+ AL+++++G DL++V
Sbjct: 318  NDLNTEWQALQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSV 377

Query: 6363 QALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKA 6184
            QALQRKH+G ERDL AL  ++  L++ A +L +THPD+AE I  K  +   AW+ L+++A
Sbjct: 378  QALQRKHQGLERDLNALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRA 437

Query: 6183 QHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEI 6004
              RK  L  S+ L RFL+D+RDL+SW   MK ++ +DELAKDV GAEALLE HQE   E+
Sbjct: 438  NARKAKLMDSYDLQRFLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEM 497

Query: 6003 DARADSFNQTASAGQKLVEMG-IPESPEVQEKLEKLDHEKSSLLGL-WEERRILYEQCMD 5830
            + RA +F    + GQ+L++      SPEVQEKL+ L   +   L + W +RR   +QC++
Sbjct: 498  EPRAGTFQAFEAFGQELIKNDHYAASPEVQEKLDILGKRREKDLEVSWNDRRHKLDQCLE 557

Query: 5829 LQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDE 5650
            LQLF RD EQAE WM  +EAFLA+  L DSLDSVE LIKKHEDF+K+L+ QE+KINA++
Sbjct: 558  LQLFLRDCEQAEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIES 617

Query: 5649 FATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSW 5470
            F  +LI   HY    +                    + + L ES+  Q F RD DE+ +W
Sbjct: 618  FPQQLINNDHYDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAW 677

Query: 5469 ITEKL 5455
            I+EK+
Sbjct: 678  ISEKI 682



 Score =  225 bits (574), Expect = 1e-56
 Identities = 171/723 (23%), Positives = 331/723 (45%), Gaps = 14/723 (1%)
 Frame = -1

Query: 3546 KIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSD 3367
            +IK + +   ++      A ++I    + L E+W  L  K++ RK+ L DS + Q++ +D
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFAD 64

Query: 3366 YRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLN 3187
              +   W+     +V+S++   D   AE+ L++H+    ++ +   T +   +
Sbjct: 65   ANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGC-- 122

Query: 3186 SHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAF 3007
                       R Q +  +    ++  VA  + +++                  S RE
Sbjct: 123  -----------RQQDIPISEDVGKEYVVALYDYMEK------------------SPREVS 153

Query: 3006 LAQEDPSGDNVESLIKKHEDFDKA-INTQEEKIKGLKL----FAESLIKNNHYDSPAVTR 2842
            + +    GD +  L   ++D+ K  +N ++  +    +     A+S  + N  +   + R
Sbjct: 154  MKK----GDVLVLLNSSNKDWWKVEVNDRQGFVPAAYVKKMDAAQSASQANLVEDANIMR 209

Query: 2841 KRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTN 2662
            +++ I   +  L +    ++  L ES       R+A+++  W+ +K  + +     D
Sbjct: 210  RQENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLE 269

Query: 2661 -IQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGE--AAVSARLKALNDQWD 2491
             ++   +K   F+ +L AN  R+  I    N ++E            +S ++  LN +W
Sbjct: 270  QVEVLQKKFDDFQKDLKANESRLLEI----NTILETLDLEKVPELTLLSQKVNDLNTEWQ 325

Query: 2490 LLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHS 2311
             L K T ++S  L  A++ + F     + + W+ +    L +E++G DL SV+ L +KH
Sbjct: 326  ALQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQ 385

Query: 2310 LLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLS 2131
             LE D+ A   +V  ++E AD L++    Q + I  +R  I + +  ++  A  R+ KL
Sbjct: 386  GLERDLNALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLM 445

Query: 2130 KALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVS 1951
             + ++ +F  D  D  SW    K LV+SD+  +D+ G + L  +H+ + TE+
Sbjct: 446  DSYDLQRFLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQ 505

Query: 1950 LVKLKGEELLRSAAEAGVGEDQI------KKRMEDLEQSWGQIRDLTGNRHQRLDESEAF 1789
              +  G+EL+++   A   E Q       K+R +DLE SW        +R  +LD+
Sbjct: 506  AFEAFGQELIKNDHYAASPEVQEKLDILGKRREKDLEVSW-------NDRRHKLDQCLEL 558

Query: 1788 QAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINK 1609
            Q FL D E+ EAWM  ++  L S+   +++  V+ L+KKH+ F   L L +Q++  + +
Sbjct: 559  QLFLRDCEQAEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESF 618

Query: 1608 GDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWI 1429
               LI+N ++  P I  + DQ+  R   +++    + +KL ++    QF    D VE+WI
Sbjct: 619  PQQLINNDHYDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWI 678

Query: 1428 AEK 1420
            +EK
Sbjct: 679  SEK 681



 Score =  218 bits (555), Expect = 2e-54
 Identities = 157/709 (22%), Positives = 324/709 (45%), Gaps = 3/709 (0%)
 Frame = -1

Query: 6624 RINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
            RI  + +  +++++EGH  +D+I  K   + + W  L   ++ RK+ L  + + Q++  D
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFAD 64

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
            A+E  +W+ EK+  ++S+DYG+D ++ ++  +KH+    DL A    +  L+K+A
Sbjct: 65   ANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGC-- 122

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
                       +  D   + +  KE      D +E+S          R++    GD+  +
Sbjct: 123  -----------RQQDIPISEDVGKEYVVALYDYMEKS---------PREVSMKKGDVLVL 162

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            + +    KD    E       + +G + A   ++ +   A Q   +  + E   +  + E
Sbjct: 163  LNSSN--KDWWKVEV-----NDRQGFVPA---AYVKKMDAAQSASQANLVEDANIMRRQE 212

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             ++ E  +LL     R+   E+ +      R+      W+N + A + + ++GD L+ VE
Sbjct: 213  NIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLEQVE 272

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXX 5545
             L KK +DF+K L A E ++  ++     L   +      +++
Sbjct: 273  VLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQALQKLTD 332

Query: 5544 XRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELK 5368
             R  +L  +++ Q F RD DE   WI +K      +++  D  +++   +KH   E++L
Sbjct: 333  DRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQGLERDLN 392

Query: 5367 ANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQ 5188
            A   ++  +  T ++++ +    A+ I  +  +++  W+ L D  N + AKL ++ + Q+
Sbjct: 393  ALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLMDSYDLQR 452

Query: 5187 FNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQ 5008
            F  +  D+ +W + ++  VAS++  KD+   + L ++   + ++           +   Q
Sbjct: 453  FLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQAFEAFGQ 512

Query: 5007 QFQEEEHFNAPVIVRKQENL--QQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWI 4834
            +  + +H+ A   V+++ ++  ++R   L      R+ KL +  +     RD E   AW+
Sbjct: 513  ELIKNDHYAASPEVQEKLDILGKRREKDLEVSWNDRRHKLDQCLELQLFLRDCEQAEAWM 572

Query: 4833 REKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPE 4654
              +E    S      L  V++LIKK +     ++  + +I ++ S    +I   H+  P
Sbjct: 573  GAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESFPQQLINNDHYDGPA 632

Query: 4653 IRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEK 4507
            I  K  Q+ + W  LK+   ++R+ L +S    Q+  DA+E +AW+SEK
Sbjct: 633  IGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWISEK 681



 Score =  213 bits (542), Expect = 6e-53
 Identities = 165/714 (23%), Positives = 311/714 (43%), Gaps = 9/714 (1%)
 Frame = -1

Query: 6939 IANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQC 6760
            I  + KTG  M+   HFA++ I  +++ L   W         +   L+ +L+   +
Sbjct: 6    IKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFADA 65

Query: 6759 DEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEE 6580
            +E   W++EKE  V +ED G D +  E   +K    + +L  ++  I  + + A+   ++
Sbjct: 66   NEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGCRQQ 125

Query: 6579 GHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLAL 6400
                 + + K+       +   +    + K+G               + L  +
Sbjct: 126  DIPISEDVGKEYVVALYDYMEKSPREVSMKKG---------------DVLVLLNSS---- 166

Query: 6399 SSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDD 6220
            + D +  ++N+ Q         + D AA       L ++A+            I ++ ++
Sbjct: 167  NKDWWKVEVNDRQGFVPAAYVKKMD-AAQSASQANLVEDAN------------IMRRQEN 213

Query: 6219 TKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEA 6040
             +  + AL +KA  RK+ LE S + H  + +  DLI W+ D  AV+ + E+  D+   E
Sbjct: 214  IEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLEQVEV 273

Query: 6039 LLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEE 5860
            L +   + + ++ A      +  +  + L    +PE   + +K+  L+ E  +L  L ++
Sbjct: 274  LQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQALQKLTDD 333

Query: 5859 RRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAA 5680
            R        ++Q F+RD ++ + W++ +   L   + G  L SV+ L +KH+  E+ L A
Sbjct: 334  RSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQGLERDLNA 393

Query: 5679 QEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTF 5500
              +++  LDE A +L+Q     A+ +                    R   L +SY  Q F
Sbjct: 394  LGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLMDSYDLQRF 453

Query: 5499 DRDCDEMVSWIT-EKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQ 5323
              D  +++SW    K   A D+   D T     L++H     E++          + G++
Sbjct: 454  LSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQAFEAFGQE 513

Query: 5322 IIDSGHFAA--------DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIED 5167
            +I + H+AA        D +G R  +      +L  + N +  KL +    Q F R+ E
Sbjct: 514  LIKNDHYAASPEVQEKLDILGKRREK------DLEVSWNDRRHKLDQCLELQLFLRDCEQ 567

Query: 5166 VEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEH 4987
             EAW+   E  +ASE     L SV++L KK    +   +    +++ I+   QQ    +H
Sbjct: 568  AEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESFPQQLINNDH 627

Query: 4986 FNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREK 4825
            ++ P I  K++ + +R+++L+  L +++ KLGESH   Q  RD ++  AWI EK
Sbjct: 628  YDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWISEK 681



 Score =  193 bits (490), Expect = 6e-47
 Identities = 166/688 (24%), Positives = 295/688 (42%), Gaps = 13/688 (1%)
 Frame = -1

Query: 6237 HQKNDDTKAA-------WNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIG 6079
            H  ND+  A        W  LK+K+  RKD LE S +  ++ AD  +  SW+ + + ++
Sbjct: 21   HFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFADANEAESWMQEKEPIVA 80

Query: 6078 ADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKL 5899
            +++  KD   AE+ L+ H+    ++ A   +        +   +  IP S +V
Sbjct: 81   SEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGCRQQDIPISEDVG------ 134

Query: 5898 DHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHL 5719
               K  ++ L++               Y +    E  M K +  +           VE
Sbjct: 135  ---KEYVVALYD---------------YMEKSPREVSMKKGDVLVLLNSSNKDWWKVE-- 174

Query: 5718 IKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXR 5539
            +   + F    AA  +K++A    A    Q       ++                    R
Sbjct: 175  VNDRQGFVP--AAYVKKMDA----AQSASQANLVEDANIMRRQENIEQEYQALLDKAGVR 228

Query: 5538 GNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHIN-FEQELKAN 5362
              AL+ES KR +  R+ ++++ W+ +K +        D       LQK  + F+++LKAN
Sbjct: 229  KEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLEQVEVLQKKFDDFQKDLKAN 288

Query: 5361 ENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFN 5182
            E+RL +I +  E +          +  ++  +N  W  L   T+ + A L  A   Q+F
Sbjct: 289  ESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQALQKLTDDRSASLATAHEVQRFF 348

Query: 5181 RNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQF 5002
            R+ ++ + W+ +    + +E++G DL SVQ LQ+K   +E D NA   +V  + + A +
Sbjct: 349  RDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQGLERDLNALGKQVQTLDETADRL 408

Query: 5001 QEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKE 4822
             +     A  IV K+  + + ++ L+D    RK KL +S+   +   D  D ++W    +
Sbjct: 409  VQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLMDSYDLQRFLSDFRDLMSWTNGMK 468

Query: 4821 QVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLA-PEIRD 4645
             +  S    +D+ G + L+++ Q L  E+       ++  +   ++I+  H+ A PE+++
Sbjct: 469  TLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQAFEAFGQELIKNDHYAASPEVQE 528

Query: 4644 KLAQL-RDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDE 4468
            KL  L +   + L+     RR  LD  L+   +L D  +A+AWM  +E  + S
Sbjct: 529  KLDILGKRREKDLEVSWNDRRHKLDQCLELQLFLRDCEQAEAWMGAREAFLASEGLTDSL 588

Query: 4467 DSAEALLKKHR---ALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQE 4297
            DS E+L+KKH      LS  E     IE   +Q     + + P     RD VL  +   +
Sbjct: 589  DSVESLIKKHEDFDKALSLQEQKINAIESFPQQLINNDHYDGPAIGTKRDQVLERWHSLK 648

Query: 4296 KSPREVSMKKGDVLTLLNASNRDWWKVE 4213
             +  E   K G+  TL   S RD  +VE
Sbjct: 649  AALIEKRSKLGESHTLQQFS-RDADEVE 675



 Score =  171 bits (433), Expect = 2e-40
 Identities = 159/727 (21%), Positives = 312/727 (42%), Gaps = 5/727 (0%)
 Frame = -1

Query: 2601 RIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFM 2422
            RI  + + G  +++       E  +SA++K L ++W  L   ++++   L+++ + + +
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDE--ISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYF 62

Query: 2421 AAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL 2242
            A   + E W+ E E ++ SEDYGKD  S E+ LKKH  L AD+VA++  +  + +QA+
Sbjct: 63   ADANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGC 122

Query: 2241 LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKK 2062
             + D    + +   ++ +   YD ++K                         E  +K+
Sbjct: 123  RQQDIPISEDVG--KEYVVALYDYMEK----------------------SPREVSMKKGD 158

Query: 2061 LLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGED-Q 1885
            +LV  +   +D   V            E+   +  V    +K  +  +SA++A + ED
Sbjct: 159  VLVLLNSSNKDWWKV------------EVNDRQGFVPAAYVKKMDAAQSASQANLVEDAN 206

Query: 1884 IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE 1705
            I +R E++EQ +  + D  G R + L+ES    + + +  +   W+N+K  ++ S   G+
Sbjct: 207  IMRRQENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGD 266

Query: 1704 NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE 1525
            ++  V+ L KK D FQ DL+ ++ R+ ++    +TL          + Q+ + L
Sbjct: 267  DLEQVEVLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQA 326

Query: 1524 IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA 1345
            ++ + + R A L       +F    D  + WI +K + + +E+FG DL SVQ L  K +
Sbjct: 327  LQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQG 386

Query: 1344 FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXX 1165
             +  LNA   + +Q + E  D+LV +   Q+  I  +   + + W  L   + AR+
Sbjct: 387  LERDLNALGKQ-VQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLM 445

Query: 1164 XXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL 985
                    + +             SW    +  +        +    AL + H E    +
Sbjct: 446  DSYDLQRFLSDF--------RDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEM 497

Query: 984  SSAEEDFRQLQDLDRR-IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQR 808
                  F+  +   +  IK+ +   +P     +D L           +E++ E++   +R
Sbjct: 498  EPRAGTFQAFEAFGQELIKNDHYAASPEVQEKLDILGKR--------REKDLEVSWNDRR 549

Query: 807  QEENDKLRRE-FAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQ 631
             + +  L  + F +      AW+   R+  + + G L + LD+VE   K+ +     L
Sbjct: 550  HKLDQCLELQLFLRDCEQAEAWM-GAREAFLASEG-LTDSLDSVESLIKKHEDFDKALSL 607

Query: 630  IEEKGAMLER--NLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSE 457
             E+K   +E     +++N + +   +G  +     DQ+  R        I+ R++ G S
Sbjct: 608  QEQKINAIESFPQQLINNDHYDGPAIGTKR-----DQVLERWHSLKAALIEKRSKLGES- 661

Query: 456  EALREFS 436
              L++FS
Sbjct: 662  HTLQQFS 668



 Score =  168 bits (425), Expect = 2e-39
 Identities = 158/729 (21%), Positives = 312/729 (42%), Gaps = 3/729 (0%)
 Frame = -1

Query: 2916 KIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRD 2737
            +IK +    E ++   H+ +  ++ K   + ++W  LK+   Q++  L +S   QQ+  D
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFAD 64

Query: 2736 ADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIE 2560
            A+E E+WM EK  I   E+Y +D  + + + +K +   A+L A    I  + +
Sbjct: 65   ANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEG--- 121

Query: 2559 NAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVE 2380
               C   +  +S   + +  ++ + +    EKS R  E + +K             G+V
Sbjct: 122  ---CRQQDIPIS---EDVGKEYVVALYDYMEKSPR--EVSMKK-------------GDVL 160

Query: 2379 ILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAER 2200
            +LL S +  KD   VE +  +   + A  V   D        A S  + +  +   I  R
Sbjct: 161  VLLNSSN--KDWWKVE-VNDRQGFVPAAYVKKMDA-------AQSASQANLVEDANIMRR 210

Query: 2199 RKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPG 2020
            ++ I   Y  +   A  R++ L +++  H   R+ +D   W+ +K  +V S + G DL
Sbjct: 211  QENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLEQ 270

Query: 2019 VQNLRRKHRRIDTELASHEPQVSLVKLKGEEL-LRSAAEAGVGEDQIKKRMEDLEQSWGQ 1843
            V+ L++K      +L ++E ++  +    E L L    E  +    + +++ DL   W
Sbjct: 271  VEVLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTL----LSQKVNDLNTEWQA 326

Query: 1842 IRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDT 1663
            ++ LT +R   L  +   Q F  D +E + W+++K + L ++NFG ++  VQ L +KH
Sbjct: 327  LQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQG 386

Query: 1662 FQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRD 1483
             + DL    ++V  L    D L+      A  I  +  ++      ++  A  R AKL D
Sbjct: 387  LERDLNALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLMD 446

Query: 1482 NSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQ 1303
            +    +F+     + SW    +  V S++  +D++  + LL + +     +        Q
Sbjct: 447  SYDLQRFLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEP-RAGTFQ 505

Query: 1302 RITELKDQLVSSEH-QQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY 1126
                   +L+ ++H   SP ++++   + +R +  L  S   R              EL
Sbjct: 506  AFEAFGQELIKNDHYAASPEVQEKLDILGKRREKDLEVSWNDRRHKLDQCL------ELQ 559

Query: 1125 LAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDL 946
            L F +      +W    E  L      +SL+ + +L   H +F ++LS  E+    ++
Sbjct: 560  L-FLRDCEQAEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESF 618

Query: 945  DRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKL 766
             +++ + +    P      D + + W +L+  + E+  +L   H  Q        +F++
Sbjct: 619  PQQLINNDHYDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQ--------QFSRD 670

Query: 765  ANAFHAWLT 739
            A+   AW++
Sbjct: 671  ADEVEAWIS 679



 Score =  163 bits (413), Expect = 5e-38
 Identities = 160/708 (22%), Positives = 304/708 (42%), Gaps = 36/708 (5%)
 Frame = -1

Query: 5355 RLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRN 5176
            R+  +  TGEQ++D GHFA D I  +++ +   W  L D ++++   L ++   QQ+  +
Sbjct: 5    RIKMVTKTGEQMLDEGHFANDEISAKVKGLEEKWKNLKDKSSQRKDDLEDSLEAQQYFAD 64

Query: 5175 IEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQE 4996
              + E+W+ E E  VASEDYGKD  S ++  KK   + +D  A+   ++ +K+ A+  ++
Sbjct: 65   ANEAESWMQEKEPIVASEDYGKDEDSAESQLKKHKTLMADLVAYRTTIEMLKKQAEGCRQ 124

Query: 4995 EEHFNAPVIVRKQENLQQRY-NALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQ 4819
            ++       +   E++ + Y  AL D +EK  R++        +  +  ++  W  E
Sbjct: 125  QD-------IPISEDVGKEYVVALYDYMEKSPREVSMKKGDVLVLLNSSNKDWWKVEVND 177

Query: 4818 VAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKL 4639
              G              +KK  A  A+ A+  + +E     AN M +Q
Sbjct: 178  RQGFVPAA--------YVKKMDA--AQSASQANLVED----ANIMRRQ------------ 211

Query: 4638 AQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSA 4459
              +   ++ L  KA  R+  L++S++ H  + +AN+   W+++K  +V S + G D +
Sbjct: 212  ENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVGDDLEQV 271

Query: 4458 EALLKKHRALLSDLEAFKGTIED------------------LRKQASQCKYQEQPMGQL- 4336
            E L KK      DL+A +  + +                  L ++ +    + Q + +L
Sbjct: 272  EVLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQALQKLT 331

Query: 4335 -GRDCVLALYDYQEKSPREVSMKK---GDVLTLLNASN--RDWWKVEVNDR--QGFVP-- 4186
              R   LA     ++  R+    K    D    LN  N   D   V+   R  QG
Sbjct: 332  DDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQGLERDL 391

Query: 4185 AAYVKRIE--PGTAQQHAQ---QQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGY 4021
             A  K+++    TA +  Q    Q   I  K++EI++ +  L      RK KL ++
Sbjct: 392  NALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLMDSYDLQ 451

Query: 4020 QLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIA 3841
            + L +  DL  W    + + A  E+  D+   E L ++  +   +++      Q
Sbjct: 452  RFLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQAFEAFG 511

Query: 3840 TALTSVGQTETAVRIRQQIEDL-NARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDW 3664
              L        +  ++++++ L   R + L         +L    E+Q F RD ++   W
Sbjct: 512  QELIKNDHYAASPEVQEKLDILGKRREKDLEVSWNDRRHKLDQCLELQLFLRDCEQAEAW 571

Query: 3663 IQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAE 3484
            +  ++  L SE     L SV++L +KHE  ++ L+    KI +++    +L  +
Sbjct: 572  MGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESFPQQLINNDHYDGP 631

Query: 3483 QIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIA 3340
             I   + ++ E+W+ L +    ++ KL +S+  Q+F  D  ++  WI+
Sbjct: 632  AIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWIS 679



 Score =  159 bits (403), Expect = 7e-37
 Identities = 102/483 (21%), Positives = 216/483 (44%), Gaps = 10/483 (2%)
 Frame = -1

Query: 7194 DIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFR 7015
            +I +R++ +   Y    D +  +++ LEE+ +     R+A++L  W+ +K    +
Sbjct: 206  NIMRRQENIEQEYQALLDKAGVRKEALEESVKRHSLVREANDLIQWVNDKAAVVESAEVG 265

Query: 7014 DP-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            D    ++   +K + F+ +++A+   +  ++     +          + +++ +L+  W
Sbjct: 266  DDLEQVEVLQKKFDDFQKDLKANESRLLEINTILETLDLEKVPELTLLSQKVNDLNTEWQ 325

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +   L  A ++  F R  DE   WI +K   +  E+ G DL  V+ LQRK
Sbjct: 326  ALQKLTDDRSASLATAHEVQRFFRDADETKDWIDDKNKALNTENFGHDLHSVQALQRKHQ 385

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
               ++L     ++  +++ AD+LV+    + + I  KR ++++AWH L   A  RK  L
Sbjct: 386  GLERDLNALGKQVQTLDETADRLVQTHPDQAEPIVAKRAEIDEAWHTLQDRANARKAKLM 445

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKML 6298
             ++ +QRF  D  + ++W       ++SD+  +D+   +AL  +H+    ++    G
Sbjct: 446  DSYDLQRFLSDFRDLMSWTNGMKTLVASDELAKDVTGAEALLERHQELHTEMEPRAGTFQ 505

Query: 6297 QLEKEAHKLAET-HPDRAEAIHQKND--------DTKAAWNALKEKAQHRKDGLERSFQL 6145
              E    +L +  H   +  + +K D        D + +WN        R+  L++  +L
Sbjct: 506  AFEAFGQELIKNDHYAASPEVQEKLDILGKRREKDLEVSWN-------DRRHKLDQCLEL 558

Query: 6144 HRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASA 5965
              FL D     +W+G  +A + ++ L   +   E+L++ H++    +  +    N   S
Sbjct: 559  QLFLRDCEQAEAWMGAREAFLASEGLTDSLDSVESLIKKHEDFDKALSLQEQKINAIESF 618

Query: 5964 GQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWM 5785
             Q+L+     + P +  K +++     SL     E+R    +   LQ F RD ++ E W+
Sbjct: 619  PQQLINNDHYDGPAIGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWI 678

Query: 5784 NKQ 5776
            +++
Sbjct: 679  SEK 681



 Score = 39.7 bits (91), Expect = 1.1
 Identities = 20/50 (40%), Positives = 27/50 (54%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKL 7042
            I  +R +VL  +   K     KR +L E+   Q F RDADE+  WI EK+
Sbjct: 633  IGTKRDQVLERWHSLKAALIEKRSKLGESHTLQQFSRDADEVEAWISEKI 682


>gi|45552921|ref|NP_995987.1| CG12008-PC [Drosophila melanogaster]
 gi|45445783|gb|AAS64957.1| CG12008-PC [Drosophila melanogaster]
          Length = 4207

 Score =  756 bits (1952), Expect = 0.0
 Identities = 577/2347 (24%), Positives = 1044/2347 (43%), Gaps = 92/2347 (3%)
 Frame = -1

Query: 7128 KRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEA-------F 6970
            K+  L +    Q F R+AD+++        T   E F + +NL A + + EA       F
Sbjct: 1283 KQKWLLQCVDLQMFNREADKIDA------TTKSHEAFLEYNNLGASLDEVEAILKRHLDF 1336

Query: 6969 EAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQA 6790
            E  + A  K +       + +I ++H+ S++I  R  ++             +   LQ +
Sbjct: 1337 EKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQAS 1396

Query: 6789 LKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEI 6610
                 F  + D++  W+++K T +  ++   DL ++    +K   F +EL  ++ ++  +
Sbjct: 1397 KDFHKFAAEADDLKVWLQDK-TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNV 1455

Query: 6609 NQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETL 6430
             +    LV+ G+    ++  +  D+N  W  L TL+  +   L  A   +  NR  ++
Sbjct: 1456 TKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAK 1514

Query: 6429 AWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDR 6250
              + E D AL S D G DL + + L  K +  E ++   + K+ +L      +A
Sbjct: 1515 KKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFN 1574

Query: 6249 AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADE 6070
            A+ I     + +  +  L++  Q R+  LE S   H+F+ +      WI +      ++E
Sbjct: 1575 AQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNE 1634

Query: 6069 LAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHE 5890
            L +++  A++L + H++ + EI       N+   AGQ L+    PE  +V+   ++L+
Sbjct: 1635 LGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQA 1694

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L     ER    +  +  Q +  D  + E+W+ ++   L +T+ G   DS   L+ K
Sbjct: 1695 WQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTK 1754

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  L      +  +      ++   H  +  +A                   R
Sbjct: 1755 HKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGR 1814

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENR 5353
            L ES  +  +  + DE+  WI E+   A  + Y  D  +++    K  + +  ++   +R
Sbjct: 1815 LMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADR 1874

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +D      +++IDS    A+ +  R  Q+   W  L+   N++  KL  AG   +F+R++
Sbjct: 1875 VDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDV 1934

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
             +    + + +    S++ G+DL S   L +K    E+D  A   ++  + + + + Q +
Sbjct: 1935 AEALFRIQD-KNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAK 1993

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
               NA  I ++Q+ +   +N L++    R  +L  S        D+ D ++W
Sbjct: 1994 YPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAAL 2053

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQ 4633
             +     D  G   L  +  A+  EI   + +   ++  ++ M+Q GH+ A ++ +K A
Sbjct: 2054 QAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAA 2113

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEA 4453
            + D  + L +   K++  L+  +    +L DA + D   S ++  + S+D+G+  +  +
Sbjct: 2114 MLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQN 2173

Query: 4452 LLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPM-------------------- 4345
             ++KH    R + +  E      E  RK   Q  Y    +
Sbjct: 2174 KIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAV 2233

Query: 4344 -----------GQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQ 4198
                        +  RDC  A Y   EK  +     + D  +    +N D    ++   Q
Sbjct: 2234 RRYKLEDALLYAKFVRDCAEAKYWINEKQKK----LEADAASYAEVTNLDEKIKKLQKHQ 2289

Query: 4197 GFVPAAYVKRIEPGTAQQHAQQQVNSIG----GKQSE-----------IEDKYQRLMMLG 4063
             F             A Q   Q++   G     KQ E           + + +Q L+
Sbjct: 2290 AFQAEV--------AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAEL 2341

Query: 4062 ETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDL 3883
            E R R LEEA    +   + + +  WI+ +E +    + G DLE    L +K DD   D+
Sbjct: 2342 EQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDM 2401

Query: 3882 KANEVRLQEMNQIATALTSVGQTETAVR-IRQQIEDLNARWRALXXXXXXXXXQLGSAHE 3706
            + ++ R++ +NQ+A  L +  Q     + + ++ +D N  WR L          LG A+E
Sbjct: 2402 RVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANE 2461

Query: 3705 VQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDE 3526
            +  F+RDVD+T D I EK  A+ S D GRDL +V+AL R+ E +ERD++A+  KI   +
Sbjct: 2462 IHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHET 2521

Query: 3525 KANRLRQSHPE-AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
             A  L + +PE  A+ I     EL++ W  L + +  R+  L ++Y   +F+SD ++L
Sbjct: 2522 AAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELEL 2581

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAA 3169
            W+  M + +++ +  + +   E  LE HQE + EI+ R   F    Q G QL
Sbjct: 2582 WVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQ 2641

Query: 3168 GD-IENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED 2992
             D +   L  + E  + L +AW  R   L +  +LQLF    EQ + W++ +EAFL  +D
Sbjct: 2642 PDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDD 2701

Query: 2991 PSGDN---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILD 2821
              GD+   VE L+KKH++F+K ++   + +  L+ FA S+++    D+  +  K   IL
Sbjct: 2702 -LGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAYILR 2758

Query: 2820 RWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQK 2641
            R   L E   +++ +L +S  LQ+F R   EI+ W+ +K Q+A +ENYR+P+N+Q K QK
Sbjct: 2759 RKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQK 2818

Query: 2640 QQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
              AF+AEL +NS R+ ++I  G  LI        E A   +L  L   W  L   +  K
Sbjct: 2819 HAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL--LEGDWLKLKGASQTKK 2876

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             +L++A    +F  +V +   W+ EVE+ L SEDYGKDLA+V NLLKKH  LEAD+  H
Sbjct: 2877 DKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHG 2936

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
            +   ++ ++ +   + + F   +I ER  +   RY+ + +    RR+ L  +L++ QF R
Sbjct: 2937 ELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLR 2996

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D +DE  W+ EK+L+  S D G  L  VQ L++KH  ++ EL S EP +  +  +G++++
Sbjct: 2997 DAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMI 3056

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
            R   +     +Q++ + E L++   Q+RDL   R  RL ++   Q F  +  E +AWM E
Sbjct: 3057 R---DNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            K+ +L S ++G +   VQG  KK +  Q +L   K  +  +      LI   +  + +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
            ++  Q+     ++  +A+ R ++L +     +++ + + +  W+ ++     SED+G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
              V+ L+   E+F + LNA E   ++   E  D+L+   +    +I+ +     Q W+ L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEAR-VEACLERGDRLIQENNPYRSSIKSKRDETKQLWEEL 3292

Query: 1200 L----AHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLE 1033
                 A  +A               E + L   K AS  +   E+  +D         LE
Sbjct: 3293 KDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLIS---EDYGQD---------LE 3340

Query: 1032 EIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQR 853
             I+AL   H  F+  L   +     +     ++         +     D   + W +L+
Sbjct: 3341 SIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKE 3400

Query: 852  IIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVER 673
                R+ +L++  Q Q   D+ R   A + N   A +T        AG  L   L + +
Sbjct: 3401 KTAARKNKLSQAEQLQSYFDEYRDLIAWI-NEMLAKITAPELANSVAGAEL--LLASTKD 3457

Query: 672  KAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHST---VGIAQAWDQL---------- 532
               EI+       +    G    + LI +  +  H     + + QA  +L
Sbjct: 3458 HDTEIRTRDETFAKFAANG----QQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRRE 3513

Query: 531  -------DQLAMRMQHNLEQQIQAR----NQSGVSEEALREFSMMFKHFDKEKTGRLDHQ 385
                    QL ++    LEQ I +R      + + +   +   ++ +H D EKT     +
Sbjct: 3514 IYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEE 3573

Query: 384  QFKSCLR 364
            +F++  R
Sbjct: 3574 KFQAIKR 3580



 Score =  755 bits (1949), Expect = 0.0
 Identities = 547/2178 (25%), Positives = 1007/2178 (46%), Gaps = 67/2178 (3%)
 Frame = -1

Query: 6924 KTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILY 6745
            +T    I  N   ++ ++KR + ++  +         +   L+ ++ L  F R+CD+
Sbjct: 936  RTSTQSINEN---ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 6744 WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 6565
            W++EKE  + +++     E V+  +RKF+ F+ +L     R+ EI+ A D    +GHS+
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQL 1048

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            D+I  ++  ++  W RLN   A R++ L GA  V+ FNR  DE   W+ EK L L +
Sbjct: 1049 DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVI 1108

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
              DL  VQALQR+H+  ER+LA +E K+ ++    + +   +P   + ++ +  + +  W
Sbjct: 1109 TPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMW 1168

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
              ++++    ++ +E       F    + L++WI  +K  + ADE A+DV  A  LL+ H
Sbjct: 1169 QQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKH 1228

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
             +   +I A    F +    G++L + G P   E    +E+L  E+ ++   W E++
Sbjct: 1229 NDLGDDIRAHDTEFVEVIQLGKQLSD-GKPNMAETVAVIERLKAEQDAIHRGWAEKQKWL 1287

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
             QC+DLQ+F R+ ++ +      EAFL   +LG SLD VE ++K+H DFEKSL AQ++ +
Sbjct: 1288 LQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKIL 1347

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
                + A KLI   HY +  + +                  R   L+ S     F  + D
Sbjct: 1348 KGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEAD 1407

Query: 5484 EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 5305
            ++  W+ +K   A D++Y D +N+  KLQKH  FE+EL+ANE +L ++   G+ ++ +G+
Sbjct: 1408 DLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN 1467

Query: 5304 FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 5125
               + +  R+  +N  W +L+  +  KG KL +A ++++ NR++ED +  + EL+  + S
Sbjct: 1468 RVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRS 1526

Query: 5124 EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 4945
             D G DL S ++L  K  ++ES+    + +V  +           HFNA  I    + LQ
Sbjct: 1527 GDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQ 1586

Query: 4944 QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 4765
            QR+  LRDP ++R+ KL ES   ++   +++ E  WI E    A S   G++L   Q+L
Sbjct: 1587 QRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLH 1646

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 4585
            KK + L AEI  H   I     A   +I Q H    ++     QL   W+ L+    +R
Sbjct: 1647 KKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERS 1706

Query: 4584 TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 4405
              LD SL+A QYL DA E ++W+ E+  ++ ST+YG+D DSA  LL KH+ +  +L+ +
Sbjct: 1707 RKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYS 1766

Query: 4404 GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLT-------LL 4246
            G + ++    +       P  ++       +    +   +  S ++G ++         L
Sbjct: 1767 GIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFL 1826

Query: 4245 NASNRDWWKVEVNDR-------QGFVPAAYVK--------RIEPGT-----AQQHAQQQV 4126
             +   + W  E           Q F     ++        R+E G       +  A++ +
Sbjct: 1827 ESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLI 1886

Query: 4125 NS-------IGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREA 3967
            +S       +  +Q ++   ++ L+ L   R++KL  A + ++  R+  +    I+ + A
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNA 1946

Query: 3966 VAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ 3787
             A  QE+G DL     L +K + F+ DL A E +LQ + + +  L        A  I QQ
Sbjct: 1947 -ALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRL-QAKYPSNASAIAQQ 2004

Query: 3786 IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRS 3607
             + + A W  L         +L ++ ++Q F  DV +   W      AL +E+   D
Sbjct: 2005 QDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAG 2064

Query: 3606 VQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSK 3427
              AL+ +H+ +  ++ A  DK + L+E ++ + Q+   AA  + +    + ++  +L +
Sbjct: 2065 ATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAA 2124

Query: 3426 ANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTE 3247
             N +K  L    D   FL D + +    +S    +SS +    V   +  + +H E+
Sbjct: 2125 WNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERL 2184

Query: 3246 IDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLEL 3067
            I ++        + G +L+   HY + +I+  LQGV   R+ ++D    RR  L+  L
Sbjct: 2185 IQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLY 2244

Query: 3066 QLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL------IKKHEDFDKAINTQEEKIKG 2905
              F RDC +A  W++ ++  L  +  S   V +L      ++KH+ F   +   + +I+
Sbjct: 2245 AKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQE 2304

Query: 2904 LKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEI 2725
            ++     L+   H  SP + R  + +L+ W GL   L Q+   L E+Q   +F+   D+I
Sbjct: 2305 IQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKI 2364

Query: 2724 ENWMTEKFQIAQ-EENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKC 2548
            E W+ +K  + Q  +  RD  +     +K    ++++  +  R+  I Q  + LI  A+
Sbjct: 2365 EAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQV 2424

Query: 2547 GGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQ 2368
                 +V  R K  N  W  L          L  AN+   F   V D    + E  + +
Sbjct: 2425 PADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMS 2484

Query: 2367 SEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR-KL 2191
            S D G+DLA+VE L+++   LE D+ A + ++ +    A+ L++    +G Q  ER+ +
Sbjct: 2485 STDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEE 2544

Query: 2190 IADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQN 2011
            +   +  ++ ++  R+  L++A   H+F  D+ + E W+ +    +++      +   +
Sbjct: 2545 LHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCET 2604

Query: 2010 LRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDL 1831
                H+    E+   +   + +K +GE+L +   +     D ++K +  LE+    + +
Sbjct: 2605 QLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQ--QPDNVRKYLLVLEELHQTLNEA 2662

Query: 1830 TGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVD 1651
               R + L E+   Q F   VE+ E W+  K+  L +D+ G++   V+ LLKKHD F  +
Sbjct: 2663 WSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEF--E 2720

Query: 1650 LELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAY 1471
              LH   V  L    ++++      A  I+++   +  R  ++  ++E R  +L  +
Sbjct: 2721 KLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1470 LQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE 1291
             +F+     ++ W+ +K Q    E++ R+ S++Q  + K  AFDA L +     +Q +
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAELLS-NSPRVQSVIH 2838

Query: 1290 LKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY--LAF 1117
              ++L+  +H     I ++   +   W  L   S+ ++           ++++ Y  LAF
Sbjct: 2839 EGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKK----------DKLQQAYDALAF 2888

Query: 1116 AKKASTFNSWFENAEEDLT------DPVRCNSL----EEIRALRDAHGEFQRSLSSAEED 967
             +    FN+W +  E  L+      D    ++L    E + A    HGE    L   +E
Sbjct: 2889 NRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQ 2948

Query: 966  FRQLQDLDRR---------IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQEL--AR 820
            F Q +   R          I+ +N    P      + LED+  +LQ+ +++ E EL
Sbjct: 2949 FFQAEHFLRHEIHERATVSIRRYNTLHEP-LGIRRENLEDS-LSLQQFLRDAEDELQWLA 3006

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQL--DAVERKAKEIKANK 646
            E Q    +  L      +           +   +EA  T +E L    ++R  + I+ N
Sbjct: 3007 EKQLVAGSQDLGTSLLSVQG------LQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNH 3060

Query: 645  GQLRQIEEKGAMLERNLI 592
                Q++ K  +L++ L+
Sbjct: 3061 FASEQLQYKSELLQKQLV 3078



 Score =  637 bits (1643), Expect = e-180
 Identities = 404/1525 (26%), Positives = 749/1525 (48%), Gaps = 100/1525 (6%)
 Frame = -1

Query: 5472 WITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAAD 5293
            ++ E +    D  YL    +   L+KH     ++ A   R +D+ +  E++    +   +
Sbjct: 411  YLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKE 468

Query: 5292 HIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYG 5113
             +  R ++V   W +L++    +   L +  N     R I      + EL+ Q ASED G
Sbjct: 469  RVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVG 528

Query: 5112 KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYN 4933
              L+ V+ L +   L E   N + + +    + A  ++  EH +A ++ ++  +L++ Y+
Sbjct: 529  PHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYS 588

Query: 4932 ALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQ 4753
             L      R+ +L E+   +    D ++E +W+ +K+++  +    +DL  V +L +K +
Sbjct: 589  ELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHK 648

Query: 4752 ALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLD 4573
            AL  EI +   +   +S+A   +I + H  + EI+ ++  L ++W+ L++  E RR  L+
Sbjct: 649  ALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLE 708

Query: 4572 DSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIE 4393
            D+ +A+Q+ +DANEA++W++EK  +V S DYG DE SA+ALL++HR L  +L A+ G I
Sbjct: 709  DAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDIL 768

Query: 4392 DLRKQ------ASQCKYQ----EQPMGQLGRD---------------------------- 4327
            +L +Q      A  C  +    E  + ++ ++
Sbjct: 769  NLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVT 828

Query: 4326 ------CVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEV-NDRQGFVPAAYVKR 4168
                   V +L+ ++ +    + M KG+V+ L + +N DWW V   N  +GFVPA YV+
Sbjct: 829  ETKMLPHVKSLFPFEGQG---MKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVRE 885

Query: 4167 IEPG-----------------------------------------------TAQQHAQQQ 4129
            +EP                                                T+ Q   +
Sbjct: 886  VEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINEN 945

Query: 4128 VNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQE 3949
             +S+  +Q  I   Y  L  + + R   LE++   +   RE +D  +W+K +E +    E
Sbjct: 946  ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDE 1005

Query: 3948 IGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNA 3769
                 E V+  ++KF+ F  DL A   R++E++         G ++    I +Q   ++
Sbjct: 1006 G----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQ-RQIHQ 1060

Query: 3768 RWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQR 3589
             W+ L          L  A  V+ F+R  DE + W+ EK   LD+     DLR+VQALQR
Sbjct: 1061 IWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQR 1120

Query: 3588 KHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKE 3409
            +H+ +ER+LA + DK+  +    N ++ ++P   + +   Q+E+ + W ++  + ++ +
Sbjct: 1121 RHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRN 1180

Query: 3408 KLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAA 3229
            ++      Q F +  + L+ WI S+   +++ E A DV  A  LL++H +   +I +
Sbjct: 1181 RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDT 1240

Query: 3228 TFQAFDQFGNQLLNSHHYAAGDIE--NRLQGVNEARKGLEDAWVARRNILDQCLELQLFY 3055
             F    Q G QL +     A  +    RL+   +A   +   W  ++  L QC++LQ+F
Sbjct: 1241 EFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDA---IHRGWAEKQKWLLQCVDLQMFN 1297

Query: 3054 RDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESL 2881
            R+ ++ D    + EAFL   +   S D VE+++K+H DF+K++  Q++ +KG    A+ L
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 2880 IKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKF 2701
            I N+HYDS  +  +R+Q+L +   +K+   +++  L  S+   +F+ +AD+++ W+ +K
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            +IA +ENYRD +N+ +K QK QAFE EL AN  ++  + + G  L++    G     V +
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQ---AGNRVPEVES 1474

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            R+  LN +W  L+  + +K  +L++A  Q+    +++D +  + E++  L+S D G DL
Sbjct: 1475 RVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLR 1534

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            S ++L+ K  +LE++I     +V E+    D +     F  Q I    K +  R+  ++
Sbjct: 1535 SCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRD 1594

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
                RR KL ++LN H+F  ++D E  WI E      S++ G++L   Q+L +KH++++
Sbjct: 1595 PTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEA 1654

Query: 1980 ELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDE 1801
            E+  H+P ++   + G+ L+   ++     +Q++   + LEQ+W  +    G R ++LD
Sbjct: 1655 EIKGHQPMINKALVAGQSLI---SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDM 1711

Query: 1800 SEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVAD 1621
            S   Q +L D  E E+W+ E+  +L S  +G +      LL KH T +++L+ +   V +
Sbjct: 1712 SLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTE 1771

Query: 1620 LINKGDTLIHNGNHHAPHIKQRCDQLRARLIE-IESMAEGRLAKLRDNSAYLQFMWKCDV 1444
            + +    ++   NH    +     QL  ++++ +  +A  R  +L ++    ++  + D
Sbjct: 1772 MGHSCAAMV-AANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDE 1830

Query: 1443 VESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE---LKDQLV 1273
            VE WI E+EQ   SED+G+D   +Q+L   Q  FD  L      G  R+ +   L  +L+
Sbjct: 1831 VEQWIREQEQAASSEDYGQDFEHLQLL---QNKFD-DLKHRVEVGADRVDQCELLAKKLI 1886

Query: 1272 SSEHQQSPAIEKRHTNVIQRWQNLL 1198
             SE   +  +EKR   +   W+NLL
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLL 1911



 Score =  610 bits (1573), Expect = e-172
 Identities = 410/1364 (30%), Positives = 666/1364 (48%), Gaps = 44/1364 (3%)
 Frame = -1

Query: 7176 QEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEE--NFRDPSN 7003
            Q VL      KD    +R +LE+A  +  F RD  E   WI EK +  + +  ++ + +N
Sbjct: 2218 QGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTN 2277

Query: 7002 LQAKI---QKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
            L  KI   QKH+AF+AEV A+   I  +  TG  ++   H +S  IK+ +E +   W
Sbjct: 2278 LDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGL 2337

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  +G  L++A   L F  Q D+I  WIR+KE  V A D G DLEH   L RK DD
Sbjct: 2338 LAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDV 2397

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHD--QIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
              ++     R+  INQ ADKL+ +     D   + K+R D N  W +L       +  L
Sbjct: 2398 DSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLG 2457

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKML 6298
            GA+++  FNRD D+T   I EK LA+SS D GRDL  V+AL R+ E  ERD++A++ K+
Sbjct: 2458 GANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517

Query: 6297 QLEKEAHKLAETHPDR-AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
            Q E  A  L + +P+R A+ I +K ++   +W  L+  +  R+  L  ++  H+F++D +
Sbjct: 2518 QHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVK 2577

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +L  W+ DM   +   +    +   E  LE HQE K EI+ R ++F      G++L +
Sbjct: 2578 ELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRP 2637

Query: 5940 IPESPE-VQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              + P+ V++ L  L+    +L   W ER     +   LQLF    EQ E W+  +EAFL
Sbjct: 2638 QQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFL 2697

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
             N DLGDS  +VE L+KKH++FEK L A  + ++ L +FA  +++G+   AD + E
Sbjct: 2698 NNDDLGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAY 2755

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L +S++ Q F R   E+  W+ +KL  A D++Y +P+N++ K
Sbjct: 2756 ILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSK 2815

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            +QKH  F+ EL +N  R+  +   GE++I   HFA D I  +++ +   W +L  A+  K
Sbjct: 2816 IQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTK 2875

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL++A +   FNR++++   W+ E+E Q++SEDYGKDL +V NL KK   +E+D   H
Sbjct: 2876 KDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHH 2935

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             +  D +KQ  +QF + EHF    I  +     +RYN L +PL  R+  L +S    Q
Sbjct: 2936 GELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFL 2995

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD EDEL W+ EK+ VAGS + G  L+ VQ L KK  +L AE+ + +  I+++      M
Sbjct: 2996 RDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQM 3055

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+  HF + +++ K   L+     L+  A  RR  L D++++  +  +ANEADAWM EK
Sbjct: 3056 IRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKR 3115

Query: 4503 PIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQAS--------QCKYQEQP 4348
            P++ S+DYG+DE S +   KK   L  +L AFK +IE + K A+              +
Sbjct: 3116 PVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEK 3175

Query: 4347 MGQLGRDCVLALYDYQEKSPREVSMKK---------------GDVLTLLNASNRDWWKVE 4213
              Q+G++    L   +E+  R    KK               GD +  + AS      VE
Sbjct: 3176 NAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMA-VTASEDYGEDVE 3234

Query: 4212 VNDRQGFVPAAYVKRIEPGTAQ------------QHAQQQVNSIGGKQSEIEDKYQRLMM 4069
              ++      ++V  +    A+            Q      +SI  K+ E +  ++ L
Sbjct: 3235 HVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKD 3294

Query: 4068 LGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKG 3889
            L   R+  L  A + +   R A++  + I  ++A    ++ G DLE ++ L +K   F+
Sbjct: 3295 LVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFES 3354

Query: 3888 DLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAH 3709
            +L   + ++  +   A  L  +   +    I  + ++    W  L         +L  A
Sbjct: 3355 ELVGIQGQVDSVLAEAAKLGEI-YPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 3708 EVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLD 3529
            ++Q +  +  +   WI E    + + +    +   + L    +  + ++    +
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 3528 EKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
                +L +     A ++ D  + L  +   L    N R+E    + D Q FL D   L Q
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQA 3217
            WI+S    +   +L + +   E LL RH+++   + ++   FQA
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQA 3577



 Score =  544 bits (1401), Expect = e-152
 Identities = 479/2308 (20%), Positives = 974/2308 (41%), Gaps = 62/2308 (2%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRD 7012
            I  RR +VLG     KD +  ++  L+ ++ F  F  +AD+L VW+ +K + A +EN+RD
Sbjct: 1368 IGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRD 1427

Query: 7011 PSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
             SNL  K+QKH+AFE E++A+   + N+ K G A++Q  +   E ++ R+ +L+  W
Sbjct: 1428 LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDL 1486

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  KG KL+QA       R  ++    + E ++ + + D+G DL   + L  K
Sbjct: 1487 LTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQIL 1546

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGA 6472
              E+     ++ E+    D +   GH     I     ++   +  L      R+  L  +
Sbjct: 1547 ESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEES 1606

Query: 6471 HQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
                +F  + D    WI E   A  S++ G++L+  Q+L +KH+  E   A ++G    +
Sbjct: 1607 LNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLE---AEIKGHQPMI 1663

Query: 6291 EKEA----HKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
             K        +++ HP+R E +       + AW  L+     R   L+ S +  ++L D
Sbjct: 1664 NKALVAGQSLISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDA 1722

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEM 5944
             ++ SW+G+   V+ + E  +D   A  LL  H+  + E+D  +    +   +   +V
Sbjct: 1723 GEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAA 1782

Query: 5943 GIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              P+S  +  K + ++    SL  L  +R+    + +    ++ ++++ E W+ +QE
Sbjct: 1783 NHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAA 1842

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
            ++ D G   + ++ L  K +D +  +    ++++  +  A KLI  +   A++V +
Sbjct: 1843 SSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQ 1902

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L  + +   F RD  E +  I +K +    +   D  +
Sbjct: 1903 LRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALAL 1962

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            L+KH  FE +L A E +L  +     ++       A  I  +  +V   WN+L + +  +
Sbjct: 1963 LRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTAR 2022

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
            G +L  + + Q F  ++ D+ +W S L   + +E++  D      L+ +   I  +  A
Sbjct: 2023 GDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAR 2082

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             D+   + +L+    +  H+ A  +  K   +      L     K+K  L +
Sbjct: 2083 EDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFL 2142

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD +        ++    S++ G+ +  VQN I+K       I   + ++  +      +
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKL 2202

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+Q H+ +  I+  L  +    + +K     RR  L+D+L   +++ D  EA  W++EK+
Sbjct: 2203 IEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQ 2262

Query: 4503 PIV--GSTDYGKDEDSAEAL--LKKHRALLSDLEAFKGTIEDLRKQ-ASQCKYQEQPMGQ 4339
              +   +  Y +  +  E +  L+KH+A  +++ A +G I++++         Q +   +
Sbjct: 2263 KKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPE 2322

Query: 4338 LGRDCVLALYDYQ----EKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPA---- 4183
            + R   + L  +Q    E   R   +++       N S  D  +  + D++  V A
Sbjct: 2323 IKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFN-SQLDKIEAWIRDKEMMVQASDTG 2381

Query: 4182 -------AYVKRIEPGTAQQHAQQQ----VNSIGGKQSEIEDKYQRLMMLGETRK----- 4051
                   A +++++   +      Q    +N +  K             + + RK
Sbjct: 2382 RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYN 2441

Query: 4050 -RKLEEACKGYQLL-----------REANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKK 3907
             R+L+ A   Y+ L           R+ +D A+ I  +    +  + G DL  VE L ++
Sbjct: 2442 WRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRR 2501

Query: 3906 FDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXX 3727
             +  + D+ A + ++ +    A  L        A  I +++E+L+  W  L
Sbjct: 2502 EEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQS 2561

Query: 3726 QLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGD 3547
             L  A+   +F  DV E   W+ +    +++      +   +     H+  + ++    +
Sbjct: 2562 ILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQE 2621

Query: 3546 KIKSLDEKANRL----RQSHPEAAEQ----IYDLQRELNEQWNRLTSKANNRKEKLLDSY 3391
                L ++  +L    +Q  P+   +    + +L + LNE W       + R   L +++
Sbjct: 2622 AFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-------SERARDLTEAH 2674

Query: 3390 DYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFD 3211
              Q F +    +  W+A+    +++ +L +  T  E LL++H E+   +   A
Sbjct: 2675 QLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQ 2732

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
            +F N +L      A  I  +L  +   ++ L +    R+  L Q  +LQ F R   + D
Sbjct: 2733 KFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDR 2792

Query: 3030 WMSAR-EAFLAQEDPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSP 2854
            W+  + +  L +      N++S I+KH  FD  + +   +++ +    E LI+ +H+
Sbjct: 2793 WLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD 2852

Query: 2853 AVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENY 2677
             + ++   +   W  LK A   K+ KL ++     F+R  DE  NWM E + Q++ E+
Sbjct: 2853 EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYG 2912

Query: 2676 RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQ 2497
            +D   +    +K +  EA++  + +    + Q      +       E  +  R      +
Sbjct: 2913 KDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHE--IHERATVSIRR 2970

Query: 2496 WDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKK 2317
            ++ L +    +   L+++   + F+   +D   WL E +++  S+D G  L SV+ L KK
Sbjct: 2971 YNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKK 3030

Query: 2316 HSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDK 2137
            H+ LEA++ + +  +  + ++   ++ ++ F  +Q+  + +L+  +   ++ +A  RR +
Sbjct: 3031 HNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLR 3090

Query: 2136 LSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQ 1957
            L  A+    F+ + ++ ++W++EK+ ++SS DYGRD   VQ  ++K   +  EL + +P
Sbjct: 3091 LLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPS 3150

Query: 1956 VSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFL 1777
            +  V      L+            I ++   + Q +  +  L   R  RL E +    +L
Sbjct: 3151 IEKVAKLATGLIE---RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYL 3207

Query: 1776 GDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTL 1597
             + EE   W+ ++  +  S+++GE++  V+ L+   ++F  +L  ++ RV   + +GD L
Sbjct: 3208 RETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRL 3267

Query: 1596 IHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKE 1417
            I   N +   IK + D+ +    E++ +   R   L        +    D     I EK+
Sbjct: 3268 IQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD 3327

Query: 1416 QQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEK 1237
              + SED+G+DL S+Q L  K + F++ L   + + +  +     +L          IE
Sbjct: 3328 ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ-VDSVLAEAAKLGEIYPDAKEHIEV 3386

Query: 1236 RHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTD 1057
            +    ++ W +L   + AR+             +E     A        W       +T
Sbjct: 3387 KRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIA--------WINEMLAKITA 3438

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALE 877
            P   NS+     L  +  +    + + +E F +     +++            F    +E
Sbjct: 3439 PELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIK-------EKHFLAHEVE 3491

Query: 876  DTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEA--GGT 703
            D  + LQ   +  +  L +  +  E N   +  F K A     W+++   ++ +   G +
Sbjct: 3492 DKIKVLQARHELLKHTLNKRREIYELNLDTQL-FLKDAEILEQWISSREPQLKDTKLGDS 3550

Query: 702  LEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY---TEHSTVGIAQAWDQL 532
            + +  D + R     K    Q    EEK   ++R  +L+  +    E   +   Q  ++L
Sbjct: 3551 IPQVEDLLRRHEDFEKTVAAQ----EEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERL 3606

Query: 531  --DQLAMRMQHNLEQQIQARNQSGVSEE 454
              ++L    Q  L++    R ++    E
Sbjct: 3607 EKERLEQLKQRELQRLADERRRAEKQHE 3634



 Score =  511 bits (1316), Expect = e-142
 Identities = 471/2295 (20%), Positives = 948/2295 (40%), Gaps = 57/2295 (2%)
 Frame = -1

Query: 7212 ILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTA 7033
            I E AD + +R+Q +   Y   ++ +Q +   LE++     F R+ D+   W+ EK +
Sbjct: 942  INENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMI 1001

Query: 7032 QEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEEL 6853
            + +      N + K +K   F  ++ A +K +  +D   +   +  H   + I  R  ++
Sbjct: 1002 KSDEGEGVDNAKRKFEK---FITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQI 1058

Query: 6852 HALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEIL 6673
            H +W         +   L+ A  +  F R CDE   W+ EK   +    +  DL  V+ L
Sbjct: 1059 HQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQAL 1118

Query: 6672 QRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR 6493
            QR+  +  +EL   + ++N +    + +     +E D +  ++ +V D W ++    +
Sbjct: 1119 QRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDL 1178

Query: 6492 KEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAAL 6313
            +  +      Q FN  A   LAWI      L++D+  RD+     L +KH     D+ A
Sbjct: 1179 RNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAH 1238

Query: 6312 EGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + + +++ +   +L++  P+ AE +    +  KA  +A+      ++  L +   L  F
Sbjct: 1239 DTEFVEVIQLGKQLSDGKPNMAETV-AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFN 1297

Query: 6132 ADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKL 5953
             +   + +     +A +  + L   +   EA+L+ H + +  + A+       +    KL
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 5952 VEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQE 5773
            +     +S  + ++  ++  ++ ++     ER+ L +   D   F  + +  + W+  +
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 5772 AFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEX 5593
                + +  D L ++   ++KH+ FE+ L A E ++  + +    L+Q  +    +V
Sbjct: 1418 RIAGDENYRD-LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESR 1475

Query: 5592 XXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARD-DSYLDPTN 5416
                             +G  L+++  ++  +R  ++    + E  S  R  D   D  +
Sbjct: 1476 VADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRS 1535

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
             +  + K    E E+   + ++ ++ STG+ +   GHF A +I    +++   + +L D
Sbjct: 1536 CKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDP 1595

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T ++ AKL E+ N  +F   ++    W++E      S + G++L   Q+L KK   +E++
Sbjct: 1596 TQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAE 1655

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
               H   ++      Q    ++H     +    + L+Q +  L     +R RKL  S +
Sbjct: 1656 IKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKA 1715

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q   D  +  +W+ E+  V  ST  GRD      L+ K + +  E+  +   +  +  +
Sbjct: 1716 QQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHS 1775

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
               M+   H  +  +  K   +    + L   A +R+  L +SL  H+Y  +++E + W+
Sbjct: 1776 CAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWI 1835

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLK-----KHRA----------------LLSDLEAFKGT 4399
             E+E    S DYG+D +  + L       KHR                 L+     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 4398 IEDLRKQ--------ASQCKYQEQPMGQLG------RDCVLALYDYQEKSPREVSMKKGD 4261
            +E  ++Q              +EQ +   G      RD   AL+  Q+K+   +S + G
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGR 1954

Query: 4260 VLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQ 4081
             L    A  R     E ND         V   +    Q       ++I  +Q ++   +
Sbjct: 1955 DLNSALALLRKHEGFE-NDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWN 2013

Query: 4080 RLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFD 3901
             L      R  +L  +      L +  D+  W  +  A    +E  +D      L+ + D
Sbjct: 2014 DLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHD 2073

Query: 3900 DFKGDLKANEVRLQEMNQIATALTSVGQ------TETAVRIRQQIEDLNARWRALXXXXX 3739
               G+++A E + + +N+++ ++   G        E    +  + + L+A W
Sbjct: 2074 AIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWN------- 2126

Query: 3738 XXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLA 3559
                 L    ++  F RD  +  +    +  AL S DFG+ +  VQ   RKH+  ER +
Sbjct: 2127 KKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQ 2186

Query: 3558 ALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQR 3379
               +K+  L E   +L +     +  I  + + +  +  ++      R+ KL D+  Y +
Sbjct: 2187 TQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAK 2246

Query: 3378 FLSDYRDLMQWI-ASMNQLVSSQELANDVTGAE---ALLERHQEYRTEIDSRAATFQAFD 3211
            F+ D  +   WI     +L +      +VT  +     L++HQ ++ E+ +     Q
Sbjct: 2247 FVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
              G  LL+  H ++ +I+  ++ V EA +GL      R   L++  +   F    ++ +
Sbjct: 2307 DTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEA 2366

Query: 3030 WMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHY-- 2863
            W+  +E  +   D   D  +  +L++K +D D  +   ++++K +   A+ LI
Sbjct: 2367 WIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA 2426

Query: 2862 DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEK-FQIAQE 2686
            D+ +V ++R      W  L+ AL   R  LG +  +  F+RD D+  + + EK   ++
Sbjct: 2427 DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSST 2486

Query: 2685 ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKAL 2506
            +  RD   ++   ++++A E ++ A   +I     A   LI+     G +  +  +L+ L
Sbjct: 2487 DTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQ-HIERKLEEL 2545

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
            +  W  L   + ++   L EA     F++ VK+LE W+ ++   + +      +   E
Sbjct: 2546 HKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQ 2605

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR-YDGVKKMATD 2149
            L+ H   + +I   Q+    + +Q + L +  Q Q      +  L+ +  +  + +  ++
Sbjct: 2606 LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSE 2665

Query: 2148 RRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELAS 1969
            R   L++A  +  F   ++  E W+  K+  +++DD G     V+ L +KH   +  L
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL-- 2723

Query: 1968 HEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAF 1789
            H   V  ++     +L    +     D I++++  + +   ++ +L+  R QRL +S
Sbjct: 2724 HADHVDTLQKFANSILEGEPK---DADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1788 QAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINK 1609
            Q FL  + E + W+ +K Q+   +N+ E  + +Q  ++KH  F  +L  +  RV  +I++
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENYRE-PSNLQSKIQKHAAFDAELLSNSPRVQSVIHE 2839

Query: 1608 GDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWI 1429
            G+ LI   +     I Q+   L    ++++  ++ +  KL+     L F    D   +W+
Sbjct: 2840 GERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM 2899

Query: 1428 AEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSP 1249
             E E Q+ SED+G+DL++V  LL K E  +A + A   E   ++ +  +Q   +EH
Sbjct: 2900 DEVELQLSSEDYGKDLAAVSNLLKKHERLEADV-AHHGELADQLKQKDEQFFQAEHFLRH 2958

Query: 1248 AIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEE 1069
             I +R T  I+R+  L      RR                   F + A     W    +
Sbjct: 2959 EIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQ--------QFLRDAEDELQWLAEKQL 3010

Query: 1068 DLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTM 889
                     SL  ++ L+  H   +  L+S E   + L    +++   N   +    +
Sbjct: 3011 VAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS 3070

Query: 888  DALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAG 709
            + L+     L+ +   R   L    + Q         F   AN   AW+   R  +  +
Sbjct: 3071 ELLQKQLVQLRDLAAIRRLRLLDAVESQ--------LFYVEANEADAWMREKRPVLSSSD 3122

Query: 708  -GTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTE----HSTVGIAQA 544
             G  E  +   ++K + ++      +   EK A L   LI  N +           + Q
Sbjct: 3123 YGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQE 3182

Query: 543  WDQLDQLAMRMQHNL 499
            ++ L +LA   +  L
Sbjct: 3183 YEDLLRLAKERESRL 3197



 Score =  503 bits (1294), Expect = e-140
 Identities = 491/2306 (21%), Positives = 986/2306 (42%), Gaps = 133/2306 (5%)
 Frame = -1

Query: 7119 RLEEARQFQY-FKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAK 6943
            R E+  Q  Y F++ +     ++ E +Q   +  +     + A ++KHEA  A++ A  +
Sbjct: 390  RQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVE 447

Query: 6942 TIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQ 6763
               +L      + + N+   E +++R +E+ A W         + + L Q   L++ +R+
Sbjct: 448  RFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLRE 507

Query: 6762 CDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQY--RINEINQAADKL 6589
                   +RE +    +ED+G  L  VE L +     L+EL  + Y   +   N+ A
Sbjct: 508  IASTTEAVRELQQQFASEDVGPHLLGVEELLQAHS--LQELQVNTYGETLKRFNRQALPY 565

Query: 6588 VEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKD 6409
                H +   + ++  D+ +A+  L   +A R+  L  A     F  D D   +W+ +K
Sbjct: 566  KSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQ 625

Query: 6408 LALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAEAIHQ 6232
                +    +DL  V +LQ+KH+  E ++ + + K  Q+     +L  E HP R+  I
Sbjct: 626  RICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHP-RSSEIQS 684

Query: 6231 KNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVA 6052
            + D     W AL+   + R+  LE + + ++F  D  +  SW+ +  A++ + +   D
Sbjct: 685  RIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEP 744

Query: 6051 GAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGI---------PESPEVQEK---- 5911
             A+ALL+ H++ +GE++A +           KL++ GI         PE PEV+++
Sbjct: 745  SAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVN 804

Query: 5910 --------------LEKLDHEKSSLLGLWEERRILYE---QCMDLQ----LFYRDTEQAE 5794
                          +EKL+H+K +   +    + L+    Q M +     +  +     +
Sbjct: 805  ETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDD 864

Query: 5793 TWMNKQEAFLANTDLGDSLDSVE-----------HLIKKHEDFEKSLAAQE----EKINA 5659
             W  +++  +      + +  VE             +K  +  +K++  ++    ++I
Sbjct: 865  WWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKP 924

Query: 5658 LDEFATKLIQGQ------HYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFD 5497
            +      L+Q +      +  AD V +                  R   L++S     F
Sbjct: 925  VSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFY 984

Query: 5496 RDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQII 5317
            R+CD+   W+ EK    + D      N + K +K I    +L A   R+++I    +
Sbjct: 985  RECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFIT---DLSAASKRVEEIDGAVDTFR 1041

Query: 5316 DSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEG 5137
              GH   D I  R RQ++ +W  L +A  ++   L  A + + FNR  ++ + W+SE
Sbjct: 1042 RQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKML 1101

Query: 5136 QVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQ-----EEEHFNAPV 4972
            Q+ +     DL +VQ LQ++   +E +     D+V+ +  L    +     E+++ NA
Sbjct: 1102 QLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNA-- 1159

Query: 4971 IVRKQE------NLQQRYNALRDPLEKRKRKLGESHQGNQLFRD-IEDELAWIREKEQVA 4813
              R+QE       +QQR + LR+ +        ES  G Q+F +  +  LAWI   +
Sbjct: 1160 --RQQEVQDMWQQVQQRGSDLRNRI--------ESEVGQQVFNNSAKVLLAWIDSVKDQL 1209

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLA---PEIRDK 4642
             +    RD+    NL+KK   L  +I  HD++   V       IQ G  L+   P + +
Sbjct: 1210 NADESARDVETANNLLKKHNDLGDDIRAHDTEFVEV-------IQLGKQLSDGKPNMAET 1262

Query: 4641 LAQLR----DNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGK 4474
            +A +     +   I +  AEK++  L   +    +  +A++ DA     E  +   + G
Sbjct: 1263 VAVIERLKAEQDAIHRGWAEKQKW-LLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGA 1321

Query: 4473 DEDSAEALLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVL---- 4318
              D  EA+LK+H    ++L++  +  KG  ++  K  S   Y  + +G   R+ VL
Sbjct: 1322 SLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGD-RRNQVLGKRK 1380

Query: 4317 ALYDYQEKSPREVSMKKGDVLTLLNASNRDWW---KVEVNDRQGFVPAAYVKR------- 4168
            A+ D   +  R +   K        A +   W   K  +   + +   + + R
Sbjct: 1381 AVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQA 1440

Query: 4167 ---------------IEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
                            + G A   A  +V  +  + +++  +++ L+ L E + RKLE+A
Sbjct: 1441 FERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQA 1500

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
                +  R   D  + +   ++     ++G DL   + L  K    + ++   + ++ E+
Sbjct: 1501 ASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL 1560

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
                  +   G    A  I    ++L  R++ L         +L  +    +F  ++D
Sbjct: 1561 VSTGDDMAHGGHF-NAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSE 1619

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKI-KSLDEKANRLRQSHP 3496
              WI E   A  S + G++L   Q+L +KH+ +E ++      I K+L    + + Q HP
Sbjct: 1620 FQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP 1679

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
            E  EQ+  L ++L + W  L      R  KL  S   Q++L D  ++  W+   N ++ S
Sbjct: 1680 E-REQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRS 1738

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
             E   D   A  LL +H+    E+D+ +            ++ ++H  +  +  + Q +
Sbjct: 1739 TEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIE 1798

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
            +  K L      R+  L + L    ++ + ++ + W+  +E   + ED   D  +++ L
Sbjct: 1799 KMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQ 1858

Query: 2961 KKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKR 2782
             K +D    +    +++   +L A+ LI +    +  V ++++Q+   W  L + L Q+
Sbjct: 1859 NKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQRE 1918

Query: 2781 FKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSD 2602
             KL  +  + +F RD  E    + +K     +E  RD  +     +K + FE +L A
Sbjct: 1919 QKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 2601 RIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFM 2422
            ++  +++    L   AK     +A++ +   +   W+ L + +T +  RL  ++  ++F+
Sbjct: 1979 QLQVLVEDSVRL--QAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFL 2036

Query: 2421 AAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL 2242
              V+D+  W   +   LQ+E++  D A    L  +H  +  +I A +D+   +NE +DS+
Sbjct: 2037 TDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSM 2096

Query: 2241 LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKK 2062
            ++   +    + E+   + D    +      ++  L + +++  F RD    ++    ++
Sbjct: 2097 VQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQ 2156

Query: 2061 LLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQI 1882
              +SS D+G+ +  VQN  RKH   +  + + E +VSL++  G +L+    +       I
Sbjct: 2157 AALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIE---QRHYDSANI 2213

Query: 1881 KKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSD--NFG 1708
            +  ++ +     +++DL   R  +L+++  +  F+ D  E + W+NEKQ+ L +D  ++
Sbjct: 2214 QTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYA 2273

Query: 1707 E--NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQL--- 1543
            E  N+      L+KH  FQ ++  ++ R+ ++ + G  L+   +  +P IK+  + +
Sbjct: 2274 EVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEA 2333

Query: 1542 -RARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
             +  L E+E    G    L +    L+F  + D +E+WI +KE  V++ D GRDL
Sbjct: 2334 WQGLLAELEQRGRG----LEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNA 2389

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEH--QQSPAIEKRHTNVIQRWQNLLAH 1192
            L+ K +  D+ +   + + ++ I +L D+L++       + +++KR  +    W+ L
Sbjct: 2390 LMRKLDDVDSDMRV-DDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGA 2448

Query: 1191 SEARRX---XXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRA 1021
              A R               +++     A+K+   +S         TD  R   L  + A
Sbjct: 2449 LNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSS---------TDTGR--DLAAVEA 2497

Query: 1020 LRDAHGEFQRSLSSAEEDFRQLQD-LDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIK 844
            L       +R +S+ ++   Q +   +  IK +      +    ++ L  +W NLQ +
Sbjct: 2498 LIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSV 2557

Query: 843  EREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEM--MEAGGTL---EEQLDAV 679
            +R+  L   +        L  +F         W+ +  ++M   ++  T+   E QL+
Sbjct: 2558 KRQSILNEAY--------LAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELH 2609

Query: 678  ERKAKEIKANKGQLRQIEEKGAMLER 601
            + +  EI+  +     ++++G  L +
Sbjct: 2610 QERKVEIEGRQEAFAGLKQQGEQLSK 2635



 Score =  455 bits (1170), Expect = e-126
 Identities = 455/2234 (20%), Positives = 916/2234 (40%), Gaps = 59/2234 (2%)
 Frame = -1

Query: 7185 QRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQ----EENF 7018
            QR  ++   YS     S  +R RLEEAR F +F  D D    W+++K +  +     ++
Sbjct: 578  QRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDL 637

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            R   +LQ   QKH+A E E+++       +   G  +I   H  S  I+ R++ L   W
Sbjct: 638  RAVLSLQ---QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQ 694

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +  +L+ A +   F    +E   W+ EK   V + D G D    + L ++
Sbjct: 695  ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
            D   EL  +   I  +NQ ADKL++ G                    + TL  +  E
Sbjct: 755  DLQGELNAYSGDILNLNQQADKLIKAG--------------------ICTLELSAAEP-- 792

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLA---LSSDDYGRDLNNVQALQRKHEGTERDLAALEG 6307
                         E   W+ E  L    +  D++   L + +  + K     + L   EG
Sbjct: 793  --------ELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEG 844

Query: 6306 KMLQLEK-EAHKLAETHPDRAEAIHQKND-DTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + ++++K E   L     D    + + N  +     N ++E        +    +  + L
Sbjct: 845  QGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSL 904

Query: 6132 ADYRD--LISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
               +   L+  +  +K +       K +       +S  E+   ++ R    NQT
Sbjct: 905  QKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYD--- 961

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
                       E+QE  +K              R  L E  + L  FYR+ +  E WM +
Sbjct: 962  -----------ELQEMAQK--------------RHALLEDSIHLFGFYRECDDFEKWMKE 996

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            +E  +  +D G+ +D+ +   +K E F   L+A  +++  +D       +  H   D +
Sbjct: 997  KERMI-KSDEGEGVDNAK---RKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKII 1052

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDP- 5422
                               R  +L+ +   + F+R CDE   W++EK+    D + + P
Sbjct: 1053 ARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKM-LQLDTAVITPD 1111

Query: 5421 -TNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
               ++   ++H N E+EL   E++++ +   G  + ++     D++  R ++V ++W ++
Sbjct: 1112 LRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV 1171

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
                +    ++     +Q FN + + + AW+  ++ Q+ +++  +D+ +  NL KK   +
Sbjct: 1172 QQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDL 1231

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
              D  AH+     + QL +Q  + +  N    V   E L+   +A+     ++++ L +
Sbjct: 1232 GDDIRAHDTEFVEVIQLGKQLSDGKP-NMAETVAVIERLKAEQDAIHRGWAEKQKWLLQC 1290

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
                   R+ +   A  +  E      N G  L  V+ ++K+       +   D  ++
Sbjct: 1291 VDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGF 1350

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
            S  A+ +I   H+ +  I D+  Q+    + +K +A +R+  L  S   H++ ++A++
Sbjct: 1351 SDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLK 1410

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA---------- 4375
             W+ +K  I G  +Y +D  +    L+KH+A   +L A +G + ++ K
Sbjct: 1411 VWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV 1469

Query: 4374 --------------------SQCKYQEQPMGQLGRDCVLALYDYQEK-SPREVSMKKGDV 4258
                                S+ K ++       R+   +L D ++K    + +++ GDV
Sbjct: 1470 PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529

Query: 4257 LTLLNASNRDWWKVEVNDRQGFV-PAAYVKRIEPGTAQQHAQQ-QVNSIGGKQSEIEDKY 4084
               L +      K ++ + +  +      + +  G    H       +I     E++ ++
Sbjct: 1530 GNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRF 1589

Query: 4083 QRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKF 3904
            + L    + R+ KLEE+   ++ + E +   +WI      A   E+G +L Q + L KK
Sbjct: 1590 KDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKH 1649

Query: 3903 DDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQ 3724
               + ++K ++  + +      +L S    E   ++    + L   W+ L         +
Sbjct: 1650 KKLEAEIKGHQPMINKALVAGQSLISQQHPERE-QVESLCQQLEQAWQDLERHCGERSRK 1708

Query: 3723 LGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK 3544
            L  + + Q++  D  E   W+ E+++ L S ++GRD  S   L  KH+ +E +L
Sbjct: 1709 LDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGI 1768

Query: 3543 IKSLDEK-ANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSD 3367
            +  +    A  +  +HP+ ++ +   Q+ + +    L   A+ R+ +L++S     +  +
Sbjct: 1769 VTEMGHSCAAMVAANHPD-SKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLE 1827

Query: 3366 YRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLN 3187
              ++ QWI    Q  SS++   D    + L  +  + +  ++  A      +    +L++
Sbjct: 1828 SDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLID 1887

Query: 3186 SHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAF 3007
            S    A ++E R + +  + + L      R   L    E+  F+RD  +A   +  + A
Sbjct: 1888 SESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAA 1947

Query: 3006 LAQE-DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQ 2830
            L+QE     ++  +L++KHE F+  +   E +++ L   +  L      ++ A+ +++D+
Sbjct: 1948 LSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDK 2007

Query: 2829 ILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENYRDPTNIQQ 2653
            ++  WN LKE    +  +L  S  LQ F  D  +I +W +  +  +  EE+  D
Sbjct: 2008 VVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATA 2067

Query: 2652 KHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTT 2473
               +  A   E+ A  D+   + +  +++++        A V  +  A+ D+   L
Sbjct: 2068 LKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAA--ADVEEKCAAMLDERQKLHAAW 2125

Query: 2472 TEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADI 2293
             +K   L++      F+   K ++      +  L S D+G+ +  V+N ++KH   E  I
Sbjct: 2126 NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLI 2185

Query: 2292 VAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVH 2113
               +++V  + E    L+E   +    I    + +  R   VK +   RR KL  AL
Sbjct: 2186 QTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYA 2245

Query: 2112 QFFRDIDDEESWI--KEKKLLVSSDDYGRDLPGVQNLRR--KHRRIDTELASHEPQVSLV 1945
            +F RD  + + WI  K+KKL   +  Y       + +++  KH+    E+A+++ ++  +
Sbjct: 2246 KFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEI 2305

Query: 1944 KLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVE 1765
            +  G  LL    E+     +IK+ +E + ++W  +      R + L+E++    F   ++
Sbjct: 2306 QDTGVILLSKQHES---SPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLD 2362

Query: 1764 EEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            + EAW+ +K+ ++ + + G ++     L++K D    D+ +  QRV  +    D LI+
Sbjct: 2363 KIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQA 2422

Query: 1584 NHHA--PHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQ 1411
               A    + +R         +++       A L   +    F    D     IAEK
Sbjct: 2423 QVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLA 2482

Query: 1410 VRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRH 1231
            + S D GRDL++V+ L+ ++EA +  ++A + +  Q  T  +  +     + +  IE++
Sbjct: 2483 MSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKL 2542

Query: 1230 TNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA--FAKKASTFNSWFENAEEDLTD 1057
              + + W NL A S  R+            + E YLA  F         W  +  + + +
Sbjct: 2543 EELHKSWGNLQALSVKRQ----------SILNEAYLAHKFVSDVKELELWVNDMIKKMNN 2592

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI--KSFNVGPNPYTWFTMDA 883
                +++ +     + H E +  +   +E F  L+    ++  +     P+    + +
Sbjct: 2593 TQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLL-V 2651

Query: 882  LEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGT 703
            LE+  + L     ER ++L   HQ Q         F         WL N  +E
Sbjct: 2652 LEELHQTLNEAWSERARDLTEAHQLQ--------LFKAQVEQVEIWLAN--KEAFLNNDD 2701

Query: 702  LEEQLDAVERKAKE 661
            L +   AVER  K+
Sbjct: 2702 LGDSYTAVERLLKK 2715



 Score =  328 bits (840), Expect = 2e-87
 Identities = 188/525 (35%), Positives = 297/525 (55%), Gaps = 2/525 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSI-FKDHSQTKRDRLEEARQFQYFKRDADELNVWILE 7048
            Q IR    A +  Q + E+L    +  +D +  +R RL +A + Q F  +A+E + W+ E
Sbjct: 3054 QMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 7047 KLQTAQEENF-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIK 6871
            K       ++ RD  ++Q   +K E  + E+ A   +I  + K    +I+ NHF S +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 6870 KRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDL 6691
            ++  ++   +         +  +L +  KL  ++R+ +E+  W+ ++     +ED G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 6690 EHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLN 6511
            EHVE L   F+ F+  L  ++ R+    +  D+L++E +     I  KRD+    W  L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELK 3293

Query: 6510 TLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTE 6331
             L   R++ L GA QV  ++R ADET+  I EKD +L S+DYG+DL ++QAL RKH+  E
Sbjct: 3294 DLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFE 3353

Query: 6330 RDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSF 6151
             +L  ++G++  +  EA KL E +PD  E I  K D+T  AW  LKEK   RK+ L ++
Sbjct: 3354 SELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 6150 QLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTA 5971
            QL  +  +YRDLI+WI +M A I A ELA  VAGAE LL S ++H  EI  R ++F + A
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 5970 SAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAET 5791
            + GQ+L++     + EV++K++ L      L     +RR +YE  +D QLF +D E  E
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 5790 WMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINAL 5656
            W++ +E  L +T LGDS+  VE L+++HEDFEK++AAQEEK  A+
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAI 3578



 Score =  313 bits (802), Expect = 4e-83
 Identities = 227/909 (24%), Positives = 428/909 (46%), Gaps = 5/909 (0%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            AD I ++   +L       + S+ ++ RL ++ Q Q F R   E++ W+++KLQ A +EN
Sbjct: 2746 ADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDEN 2805

Query: 7020 FRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
            +R+PSNLQ+KIQKH AF+AE+ +++  + ++   G  +I+ +HFA + I ++++ L   W
Sbjct: 2806 YREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDW 2865

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KLQQA   L F R  DE   W+ E E  +++ED G DL  V  L +K
Sbjct: 2866 LKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH 2925

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
            +    ++ +H    +++ Q  ++  +  H    +I+++       ++ L+     R+E L
Sbjct: 2926 ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENL 2985

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +  +Q+F RDA++ L W+ EK L   S D G  L +VQ LQ+KH   E +L + E  +
Sbjct: 2986 EDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLI 3045

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              L +   ++   +   +E +  K++  +     L++ A  R+  L  + +   F  +
Sbjct: 3046 QALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEAN 3105

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +W+ + + V+ + +  +D    +   +  +  + E+ A   S  + A     L+E
Sbjct: 3106 EADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERN 3165

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
              +S  + EK  ++  E   LL L +ER     +C  L  + R+TE+   W+  Q A  A
Sbjct: 3166 HFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTA 3225

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXX 5581
            + D G+ ++ VE LI   E F  +L A E ++ A  E   +LIQ  +     +
Sbjct: 3226 SEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDET 3285

Query: 5580 XXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK-LSTARDDSYLDPTNIRGK 5404
                         R +AL  + +   +DR  DE +  I EK  S   +D   D  +I+
Sbjct: 3286 KQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQAL 3345

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
             +KH  FE EL   + ++D + +   ++ +    A +HI  +  +    W +L + T  +
Sbjct: 3346 GRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAAR 3405

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL +A   Q +     D+ AW++E+  ++ + +    +   + L       +++
Sbjct: 3406 KNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTR 3465

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
            ++         QQ  +E+HF A  +  K + LQ R+  L+  L KR R++ E +   QLF
Sbjct: 3466 DETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKR-REIYELNLDTQLF 3524

Query: 4863 -RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAND 4687
             +D E    WI  +E     T  G  +  V++L+++ +     +A  + + +++
Sbjct: 3525 LKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT-- 3582

Query: 4686 MIQQGHFLAPEIRDKLAQLRDNWRILKSKAEK-RRTDLDDSLQAHQYLSDANE--ADAWM 4516
            M++Q  F     ++K+++L++  R+ K + E+ ++ +L       +     +E   +A
Sbjct: 3583 MLEQ-LFRHQLEQEKISKLQEKERLEKERLEQLKQRELQRLADERRRAEKQHEHRQNAAS 3641

Query: 4515 SEKEPIVGS 4489
             EK PI  S
Sbjct: 3642 QEKTPIFSS 3650



 Score =  219 bits (557), Expect = 1e-54
 Identities = 252/1272 (19%), Positives = 506/1272 (38%), Gaps = 86/1272 (6%)
 Frame = -1

Query: 3999 DLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQ-----IATA 3835
            +L  WI+ +     Q+++   LE ++     F +++   K  + + +   +     I T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQ--------RFHRDVD 3679
            L ++ Q     +  Q + D+   W+ L          L      Q        +F +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 3678 ETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSH 3499
                +++E    L      R LR V A  +KHE +  D+ A  ++   L   A  L + +
Sbjct: 407  LREGYLKEMIQVLSDP---RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDREN 463

Query: 3498 PEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVS 3319
                E++   ++E+  +W +L     N++  L    +    L +     + +  + Q  +
Sbjct: 464  YHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFA 523

Query: 3318 SQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGV 3139
            S+++   + G E LL+ H     ++++   T + F++      +S H  A  +  RL  +
Sbjct: 524  SEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADL 583

Query: 3138 NEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESL 2965
             EA   L     ARR  L++      F  D +  ++W+  ++        + D   V SL
Sbjct: 584  EEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSL 643

Query: 2964 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
             +KH+  +  I +++ K   +    + LI   H  S  +  + D + + W  L+  +  +
Sbjct: 644  QQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELR 703

Query: 2784 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHAN 2608
            R +L ++    QF  DA+E E+W+ EK  +    +Y  D  + Q   Q+ +  + EL+A
Sbjct: 704  RRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763

Query: 2607 SDRIAAIIQAGNNLIENAKCGGGEAAVSARL-----------------KALNDQW----- 2494
            S  I  + Q  + LI+   C    +A    L                 +   D+W
Sbjct: 764  SGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLE 823

Query: 2493 -------------------------------DLLVKTTTEKSYRLKEANKQKSFMAAVKD 2407
                                            LL   T +  + +++ N  + F+ A
Sbjct: 824  HKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYV 883

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLL-----------KKHSLLEADIVAHQDRVGEMN 2260
             E     V  ++   +  K L  V+  +           K  S+    +V  +     +N
Sbjct: 884  REVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSIN 943

Query: 2259 EQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEES 2080
            E ADS           + +R++ I   YD +++MA  R   L  ++++  F+R+ DD E
Sbjct: 944  ENADS-----------VEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 2079 WIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAG 1900
            W+KEK+ ++ SD+      GV N +RK  +  T+L++   +V  +    +   R
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQ- 1047

Query: 1899 VGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGS 1720
               D+I  R   + Q W ++ +    R + L+ + + + F    +E + WM+EK   L +
Sbjct: 1048 --LDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDT 1105

Query: 1719 DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLR 1540
                 ++  VQ L ++H   + +L   + +V  +   G+++ +       ++  R  +++
Sbjct: 1106 AVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQ 1165

Query: 1539 ARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL 1360
                +++        ++        F     V+ +WI   + Q+ +++  RD+ +   LL
Sbjct: 1166 DMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLL 1225

Query: 1359 TKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR 1180
             K       + A + E ++ + +L  QL   +   +  +      VI+R   L A  +A
Sbjct: 1226 KKHNDLGDDIRAHDTEFVE-VIQLGKQLSDGKPNMAETVA-----VIER---LKAEQDAI 1276

Query: 1179 RXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGE 1000
                        Q  +L + F ++A   ++  ++ E  L       SL+E+ A+   H +
Sbjct: 1277 HRGWAEKQKWLLQCVDLQM-FNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLD 1335

Query: 999  FQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAR 820
            F++SL + ++  +   D   ++ S +   + Y    +    +     ++ +K+R    A
Sbjct: 1336 FEKSLMAQDKILKGFSDNADKLISNDHYDSKY----IGDRRNQVLGKRKAVKDR----AF 1387

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTN-TR---QEMMEAGGTLEEQLDAVERKAKEIKA 652
            E +R  +  K   +FA  A+    WL + TR    E       L  +L   +   +E++A
Sbjct: 1388 ERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA 1447

Query: 651  NKGQLRQIEEKGAMLERNLILDNRY--TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQAR 478
            N+GQLR + + G  L +     NR    E     + + W  L  L+      LEQ    R
Sbjct: 1448 NEGQLRNVTKDGQALVQ---AGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQR 1504

Query: 477  NQSGVSEEALRE 442
              +   E+A ++
Sbjct: 1505 EHNRSLEDAKKK 1516



 Score =  145 bits (366), Expect = 1e-32
 Identities = 99/418 (23%), Positives = 192/418 (45%)
 Frame = -1

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNI 2659
            RD++L +     E L Q  +K  +   L+         E ++ E  Q+  +  Y    +
Sbjct: 385  RDELLRQ-----EKLEQLNYKFEKKSVLR---------EGYLKEMIQVLSDPRYLRQVDA 430

Query: 2658 QQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVK 2479
              K  K +A  A++ A  +R   +      L  + +   G+  V  R + +  +W  L++
Sbjct: 431  TLK--KHEAISADILARVERFNDLTAMAEEL--DRENYHGKERVRRREQEVMAKWRQLLE 486

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
                +   L + +   + +  +      + E++    SED G  L  VE LL+ HSL E
Sbjct: 487  LLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQEL 546

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
             +  + + +   N QA     ++      +A+R   + + Y  + + +  RR +L +A N
Sbjct: 547  QVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARN 606

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
             H F  D D+EESW+ +K+ +  +    +DL  V +L++KH+ ++ E+ S +P+   +
Sbjct: 607  FHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMST 666

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEE 1759
             G+ L+    E      +I+ R++ L + W  +  L   R ++L+++     F  D  E
Sbjct: 667  AGKRLI---GEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEA 723

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            E+W+NEK  ++ S ++G +    Q LL++H   Q +L  +   + +L  + D LI  G
Sbjct: 724  ESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAG 781



 Score =  137 bits (344), Expect = 5e-30
 Identities = 120/502 (23%), Positives = 222/502 (43%), Gaps = 20/502 (3%)
 Frame = -1

Query: 3360 DLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRT-----------EIDSRAATFQAF 3214
            +L+ WI      +  ++L N + G +  L   +EYRT           EI++   T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3213 DQFGNQLLNSHH--YAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQ 3040
             +  NQ   +        DIE   Q +  A    E A   R  +L Q    QL Y+  ++
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVA--LRDELLRQEKLEQLNYKFEKK 404

Query: 3039 ADTWMSAREAFLAQ-----EDPSG-DNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLI 2878
            +      RE +L +      DP     V++ +KKHE     I  + E+   L   AE L
Sbjct: 405  S----VLREGYLKEMIQVLSDPRYLRQVDATLKKHEAISADILARVERFNDLTAMAEELD 460

Query: 2877 KNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KF 2701
            + N++    V R+  +++ +W  L E L  +R  L +   L    R+       + E +
Sbjct: 461  RENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQ 520

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            Q A E+       +++  Q     E +++   + +    +    L   +      A ++
Sbjct: 521  QFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQA--LPYKSSEHKDAALLAQ 578

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            RL  L + +  L++ +  +  RL+EA     FM    + E WL + + + ++    KDL
Sbjct: 579  RLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLR 638

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            +V +L +KH  LE +I + + + G+M+     L+     +  +I  R   +A+ +  ++
Sbjct: 639  AVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEA 698

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
            +   RR +L  A   +QF+ D ++ ESW+ EK  LV+S DYG D P  Q L ++HR +
Sbjct: 699  LVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQG 758

Query: 1980 ELASHEPQVSLVKLKGEELLRS 1915
            EL ++   +  +  + ++L+++
Sbjct: 759  ELNAYSGDILNLNQQADKLIKA 780



 Score = 95.9 bits (237), Expect = 1e-17
 Identities = 92/499 (18%), Positives = 195/499 (38%), Gaps = 17/499 (3%)
 Frame = -1

Query: 6753 ILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF--------LKELGNHQYRINEINQAA 6598
            +L WIR+K   +   D+   LE ++     F ++         KE    +     IN
Sbjct: 288  LLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLL 347

Query: 6597 DKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR----KEGLFGAHQVQRFNRDADETL 6430
              L +  ++  D   +  +D+  AW  L      R    ++ L    ++++ N   ++
Sbjct: 348  KALNQPPYNPQDG--QLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKS 405

Query: 6429 A----WIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAET 6262
                 ++ E    LS   Y   L  V A  +KHE    D+ A   +   L   A +L
Sbjct: 406  VLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRE 462

Query: 6261 HPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVI 6082
            +    E + ++  +  A W  L E  ++++  L +   L   L +       + +++
Sbjct: 463  NYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQF 522

Query: 6081 GADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEK 5902
             ++++   + G E LL++H   + +++   ++  +              ++  + ++L
Sbjct: 523  ASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLAD 582

Query: 5901 LDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEH 5722
            L+   S LL     RR   E+  +   F  D +  E+W+  ++           L +V
Sbjct: 583  LEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLS 642

Query: 5721 LIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXX 5542
            L +KH+  E  + +++ K   +     +LI  QH  + ++
Sbjct: 643  LQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVEL 702

Query: 5541 RGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA 5365
            R   L+++ +   F  D +E  SW+ EK++      Y  D  + +  LQ+H + + EL A
Sbjct: 703  RRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762

Query: 5364 NENRLDDIRSTGEQIIDSG 5308
                + ++    +++I +G
Sbjct: 763  YSGDILNLNQQADKLIKAG 781



 Score = 38.9 bits (89), Expect = 1.9
 Identities = 57/242 (23%), Positives = 94/242 (38%), Gaps = 16/242 (6%)
 Frame = -1

Query: 1092 SWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQ--------RSLSSAEEDFRQLQDLDRR 937
            SW      +L      NSLE I+    A  E++        +  S  E  +  +  L
Sbjct: 290  SWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL--- 346

Query: 936  IKSFNVGP-NPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +K+ N  P NP     ++ +E  W+ L+     RE  L  E  RQE+ ++L  +F K +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 759  AFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKAN-KGQLRQIEEKGAM---LERNLI 592
                +L    Q + +       Q+DA  +K + I A+   ++ +  +  AM   L+R
Sbjct: 407  LREGYLKEMIQVLSDP--RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENY 464

Query: 591  LDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARN---QSGVSEEALREFSMMFKH 421
                        +   W QL +L    + NL Q     N   +   + EA+RE    F
Sbjct: 465  HGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFAS 524

Query: 420  FD 415
             D
Sbjct: 525  ED 526


>gi|45552923|ref|NP_995988.1| CG12008-PB [Drosophila melanogaster]
 gi|45445784|gb|AAS64958.1| CG12008-PB [Drosophila melanogaster]
          Length = 4118

 Score =  756 bits (1952), Expect = 0.0
 Identities = 577/2347 (24%), Positives = 1044/2347 (43%), Gaps = 92/2347 (3%)
 Frame = -1

Query: 7128 KRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEA-------F 6970
            K+  L +    Q F R+AD+++        T   E F + +NL A + + EA       F
Sbjct: 1283 KQKWLLQCVDLQMFNREADKIDA------TTKSHEAFLEYNNLGASLDEVEAILKRHLDF 1336

Query: 6969 EAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQA 6790
            E  + A  K +       + +I ++H+ S++I  R  ++             +   LQ +
Sbjct: 1337 EKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQAS 1396

Query: 6789 LKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEI 6610
                 F  + D++  W+++K T +  ++   DL ++    +K   F +EL  ++ ++  +
Sbjct: 1397 KDFHKFAAEADDLKVWLQDK-TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNV 1455

Query: 6609 NQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETL 6430
             +    LV+ G+    ++  +  D+N  W  L TL+  +   L  A   +  NR  ++
Sbjct: 1456 TKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAK 1514

Query: 6429 AWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDR 6250
              + E D AL S D G DL + + L  K +  E ++   + K+ +L      +A
Sbjct: 1515 KKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFN 1574

Query: 6249 AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADE 6070
            A+ I     + +  +  L++  Q R+  LE S   H+F+ +      WI +      ++E
Sbjct: 1575 AQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNE 1634

Query: 6069 LAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHE 5890
            L +++  A++L + H++ + EI       N+   AGQ L+    PE  +V+   ++L+
Sbjct: 1635 LGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQA 1694

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L     ER    +  +  Q +  D  + E+W+ ++   L +T+ G   DS   L+ K
Sbjct: 1695 WQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTK 1754

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  L      +  +      ++   H  +  +A                   R
Sbjct: 1755 HKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGR 1814

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENR 5353
            L ES  +  +  + DE+  WI E+   A  + Y  D  +++    K  + +  ++   +R
Sbjct: 1815 LMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADR 1874

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +D      +++IDS    A+ +  R  Q+   W  L+   N++  KL  AG   +F+R++
Sbjct: 1875 VDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDV 1934

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
             +    + + +    S++ G+DL S   L +K    E+D  A   ++  + + + + Q +
Sbjct: 1935 AEALFRIQD-KNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAK 1993

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
               NA  I ++Q+ +   +N L++    R  +L  S        D+ D ++W
Sbjct: 1994 YPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAAL 2053

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQ 4633
             +     D  G   L  +  A+  EI   + +   ++  ++ M+Q GH+ A ++ +K A
Sbjct: 2054 QAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAA 2113

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEA 4453
            + D  + L +   K++  L+  +    +L DA + D   S ++  + S+D+G+  +  +
Sbjct: 2114 MLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQN 2173

Query: 4452 LLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPM-------------------- 4345
             ++KH    R + +  E      E  RK   Q  Y    +
Sbjct: 2174 KIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAV 2233

Query: 4344 -----------GQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQ 4198
                        +  RDC  A Y   EK  +     + D  +    +N D    ++   Q
Sbjct: 2234 RRYKLEDALLYAKFVRDCAEAKYWINEKQKK----LEADAASYAEVTNLDEKIKKLQKHQ 2289

Query: 4197 GFVPAAYVKRIEPGTAQQHAQQQVNSIG----GKQSE-----------IEDKYQRLMMLG 4063
             F             A Q   Q++   G     KQ E           + + +Q L+
Sbjct: 2290 AFQAEV--------AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAEL 2341

Query: 4062 ETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDL 3883
            E R R LEEA    +   + + +  WI+ +E +    + G DLE    L +K DD   D+
Sbjct: 2342 EQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDM 2401

Query: 3882 KANEVRLQEMNQIATALTSVGQTETAVR-IRQQIEDLNARWRALXXXXXXXXXQLGSAHE 3706
            + ++ R++ +NQ+A  L +  Q     + + ++ +D N  WR L          LG A+E
Sbjct: 2402 RVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANE 2461

Query: 3705 VQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDE 3526
            +  F+RDVD+T D I EK  A+ S D GRDL +V+AL R+ E +ERD++A+  KI   +
Sbjct: 2462 IHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHET 2521

Query: 3525 KANRLRQSHPE-AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
             A  L + +PE  A+ I     EL++ W  L + +  R+  L ++Y   +F+SD ++L
Sbjct: 2522 AAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELEL 2581

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAA 3169
            W+  M + +++ +  + +   E  LE HQE + EI+ R   F    Q G QL
Sbjct: 2582 WVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQ 2641

Query: 3168 GD-IENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED 2992
             D +   L  + E  + L +AW  R   L +  +LQLF    EQ + W++ +EAFL  +D
Sbjct: 2642 PDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDD 2701

Query: 2991 PSGDN---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILD 2821
              GD+   VE L+KKH++F+K ++   + +  L+ FA S+++    D+  +  K   IL
Sbjct: 2702 -LGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAYILR 2758

Query: 2820 RWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQK 2641
            R   L E   +++ +L +S  LQ+F R   EI+ W+ +K Q+A +ENYR+P+N+Q K QK
Sbjct: 2759 RKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQK 2818

Query: 2640 QQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
              AF+AEL +NS R+ ++I  G  LI        E A   +L  L   W  L   +  K
Sbjct: 2819 HAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL--LEGDWLKLKGASQTKK 2876

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             +L++A    +F  +V +   W+ EVE+ L SEDYGKDLA+V NLLKKH  LEAD+  H
Sbjct: 2877 DKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHG 2936

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
            +   ++ ++ +   + + F   +I ER  +   RY+ + +    RR+ L  +L++ QF R
Sbjct: 2937 ELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLR 2996

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D +DE  W+ EK+L+  S D G  L  VQ L++KH  ++ EL S EP +  +  +G++++
Sbjct: 2997 DAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMI 3056

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
            R   +     +Q++ + E L++   Q+RDL   R  RL ++   Q F  +  E +AWM E
Sbjct: 3057 R---DNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            K+ +L S ++G +   VQG  KK +  Q +L   K  +  +      LI   +  + +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
            ++  Q+     ++  +A+ R ++L +     +++ + + +  W+ ++     SED+G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
              V+ L+   E+F + LNA E   ++   E  D+L+   +    +I+ +     Q W+ L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEAR-VEACLERGDRLIQENNPYRSSIKSKRDETKQLWEEL 3292

Query: 1200 L----AHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLE 1033
                 A  +A               E + L   K AS  +   E+  +D         LE
Sbjct: 3293 KDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLIS---EDYGQD---------LE 3340

Query: 1032 EIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQR 853
             I+AL   H  F+  L   +     +     ++         +     D   + W +L+
Sbjct: 3341 SIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKE 3400

Query: 852  IIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVER 673
                R+ +L++  Q Q   D+ R   A + N   A +T        AG  L   L + +
Sbjct: 3401 KTAARKNKLSQAEQLQSYFDEYRDLIAWI-NEMLAKITAPELANSVAGAEL--LLASTKD 3457

Query: 672  KAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHST---VGIAQAWDQL---------- 532
               EI+       +    G    + LI +  +  H     + + QA  +L
Sbjct: 3458 HDTEIRTRDETFAKFAANG----QQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRRE 3513

Query: 531  -------DQLAMRMQHNLEQQIQAR----NQSGVSEEALREFSMMFKHFDKEKTGRLDHQ 385
                    QL ++    LEQ I +R      + + +   +   ++ +H D EKT     +
Sbjct: 3514 IYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEE 3573

Query: 384  QFKSCLR 364
            +F++  R
Sbjct: 3574 KFQAIKR 3580



 Score =  755 bits (1949), Expect = 0.0
 Identities = 547/2178 (25%), Positives = 1007/2178 (46%), Gaps = 67/2178 (3%)
 Frame = -1

Query: 6924 KTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILY 6745
            +T    I  N   ++ ++KR + ++  +         +   L+ ++ L  F R+CD+
Sbjct: 936  RTSTQSINEN---ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 6744 WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 6565
            W++EKE  + +++     E V+  +RKF+ F+ +L     R+ EI+ A D    +GHS+
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQL 1048

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            D+I  ++  ++  W RLN   A R++ L GA  V+ FNR  DE   W+ EK L L +
Sbjct: 1049 DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVI 1108

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
              DL  VQALQR+H+  ER+LA +E K+ ++    + +   +P   + ++ +  + +  W
Sbjct: 1109 TPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMW 1168

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
              ++++    ++ +E       F    + L++WI  +K  + ADE A+DV  A  LL+ H
Sbjct: 1169 QQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKH 1228

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
             +   +I A    F +    G++L + G P   E    +E+L  E+ ++   W E++
Sbjct: 1229 NDLGDDIRAHDTEFVEVIQLGKQLSD-GKPNMAETVAVIERLKAEQDAIHRGWAEKQKWL 1287

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
             QC+DLQ+F R+ ++ +      EAFL   +LG SLD VE ++K+H DFEKSL AQ++ +
Sbjct: 1288 LQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKIL 1347

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
                + A KLI   HY +  + +                  R   L+ S     F  + D
Sbjct: 1348 KGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEAD 1407

Query: 5484 EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 5305
            ++  W+ +K   A D++Y D +N+  KLQKH  FE+EL+ANE +L ++   G+ ++ +G+
Sbjct: 1408 DLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN 1467

Query: 5304 FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 5125
               + +  R+  +N  W +L+  +  KG KL +A ++++ NR++ED +  + EL+  + S
Sbjct: 1468 RVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRS 1526

Query: 5124 EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 4945
             D G DL S ++L  K  ++ES+    + +V  +           HFNA  I    + LQ
Sbjct: 1527 GDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQ 1586

Query: 4944 QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 4765
            QR+  LRDP ++R+ KL ES   ++   +++ E  WI E    A S   G++L   Q+L
Sbjct: 1587 QRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLH 1646

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 4585
            KK + L AEI  H   I     A   +I Q H    ++     QL   W+ L+    +R
Sbjct: 1647 KKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERS 1706

Query: 4584 TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 4405
              LD SL+A QYL DA E ++W+ E+  ++ ST+YG+D DSA  LL KH+ +  +L+ +
Sbjct: 1707 RKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYS 1766

Query: 4404 GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLT-------LL 4246
            G + ++    +       P  ++       +    +   +  S ++G ++         L
Sbjct: 1767 GIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFL 1826

Query: 4245 NASNRDWWKVEVNDR-------QGFVPAAYVK--------RIEPGT-----AQQHAQQQV 4126
             +   + W  E           Q F     ++        R+E G       +  A++ +
Sbjct: 1827 ESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLI 1886

Query: 4125 NS-------IGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREA 3967
            +S       +  +Q ++   ++ L+ L   R++KL  A + ++  R+  +    I+ + A
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNA 1946

Query: 3966 VAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ 3787
             A  QE+G DL     L +K + F+ DL A E +LQ + + +  L        A  I QQ
Sbjct: 1947 -ALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRL-QAKYPSNASAIAQQ 2004

Query: 3786 IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRS 3607
             + + A W  L         +L ++ ++Q F  DV +   W      AL +E+   D
Sbjct: 2005 QDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAG 2064

Query: 3606 VQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSK 3427
              AL+ +H+ +  ++ A  DK + L+E ++ + Q+   AA  + +    + ++  +L +
Sbjct: 2065 ATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAA 2124

Query: 3426 ANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTE 3247
             N +K  L    D   FL D + +    +S    +SS +    V   +  + +H E+
Sbjct: 2125 WNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERL 2184

Query: 3246 IDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLEL 3067
            I ++        + G +L+   HY + +I+  LQGV   R+ ++D    RR  L+  L
Sbjct: 2185 IQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLY 2244

Query: 3066 QLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL------IKKHEDFDKAINTQEEKIKG 2905
              F RDC +A  W++ ++  L  +  S   V +L      ++KH+ F   +   + +I+
Sbjct: 2245 AKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQE 2304

Query: 2904 LKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEI 2725
            ++     L+   H  SP + R  + +L+ W GL   L Q+   L E+Q   +F+   D+I
Sbjct: 2305 IQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKI 2364

Query: 2724 ENWMTEKFQIAQ-EENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKC 2548
            E W+ +K  + Q  +  RD  +     +K    ++++  +  R+  I Q  + LI  A+
Sbjct: 2365 EAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQV 2424

Query: 2547 GGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQ 2368
                 +V  R K  N  W  L          L  AN+   F   V D    + E  + +
Sbjct: 2425 PADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMS 2484

Query: 2367 SEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR-KL 2191
            S D G+DLA+VE L+++   LE D+ A + ++ +    A+ L++    +G Q  ER+ +
Sbjct: 2485 STDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEE 2544

Query: 2190 IADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQN 2011
            +   +  ++ ++  R+  L++A   H+F  D+ + E W+ +    +++      +   +
Sbjct: 2545 LHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCET 2604

Query: 2010 LRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDL 1831
                H+    E+   +   + +K +GE+L +   +     D ++K +  LE+    + +
Sbjct: 2605 QLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQ--QPDNVRKYLLVLEELHQTLNEA 2662

Query: 1830 TGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVD 1651
               R + L E+   Q F   VE+ E W+  K+  L +D+ G++   V+ LLKKHD F  +
Sbjct: 2663 WSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEF--E 2720

Query: 1650 LELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAY 1471
              LH   V  L    ++++      A  I+++   +  R  ++  ++E R  +L  +
Sbjct: 2721 KLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1470 LQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE 1291
             +F+     ++ W+ +K Q    E++ R+ S++Q  + K  AFDA L +     +Q +
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAELLS-NSPRVQSVIH 2838

Query: 1290 LKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY--LAF 1117
              ++L+  +H     I ++   +   W  L   S+ ++           ++++ Y  LAF
Sbjct: 2839 EGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKK----------DKLQQAYDALAF 2888

Query: 1116 AKKASTFNSWFENAEEDLT------DPVRCNSL----EEIRALRDAHGEFQRSLSSAEED 967
             +    FN+W +  E  L+      D    ++L    E + A    HGE    L   +E
Sbjct: 2889 NRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQ 2948

Query: 966  FRQLQDLDRR---------IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQEL--AR 820
            F Q +   R          I+ +N    P      + LED+  +LQ+ +++ E EL
Sbjct: 2949 FFQAEHFLRHEIHERATVSIRRYNTLHEP-LGIRRENLEDS-LSLQQFLRDAEDELQWLA 3006

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQL--DAVERKAKEIKANK 646
            E Q    +  L      +           +   +EA  T +E L    ++R  + I+ N
Sbjct: 3007 EKQLVAGSQDLGTSLLSVQG------LQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNH 3060

Query: 645  GQLRQIEEKGAMLERNLI 592
                Q++ K  +L++ L+
Sbjct: 3061 FASEQLQYKSELLQKQLV 3078



 Score =  637 bits (1643), Expect = e-180
 Identities = 404/1525 (26%), Positives = 749/1525 (48%), Gaps = 100/1525 (6%)
 Frame = -1

Query: 5472 WITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAAD 5293
            ++ E +    D  YL    +   L+KH     ++ A   R +D+ +  E++    +   +
Sbjct: 411  YLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKE 468

Query: 5292 HIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYG 5113
             +  R ++V   W +L++    +   L +  N     R I      + EL+ Q ASED G
Sbjct: 469  RVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVG 528

Query: 5112 KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYN 4933
              L+ V+ L +   L E   N + + +    + A  ++  EH +A ++ ++  +L++ Y+
Sbjct: 529  PHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYS 588

Query: 4932 ALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQ 4753
             L      R+ +L E+   +    D ++E +W+ +K+++  +    +DL  V +L +K +
Sbjct: 589  ELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHK 648

Query: 4752 ALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLD 4573
            AL  EI +   +   +S+A   +I + H  + EI+ ++  L ++W+ L++  E RR  L+
Sbjct: 649  ALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLE 708

Query: 4572 DSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIE 4393
            D+ +A+Q+ +DANEA++W++EK  +V S DYG DE SA+ALL++HR L  +L A+ G I
Sbjct: 709  DAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDIL 768

Query: 4392 DLRKQ------ASQCKYQ----EQPMGQLGRD---------------------------- 4327
            +L +Q      A  C  +    E  + ++ ++
Sbjct: 769  NLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVT 828

Query: 4326 ------CVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEV-NDRQGFVPAAYVKR 4168
                   V +L+ ++ +    + M KG+V+ L + +N DWW V   N  +GFVPA YV+
Sbjct: 829  ETKMLPHVKSLFPFEGQG---MKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVRE 885

Query: 4167 IEPG-----------------------------------------------TAQQHAQQQ 4129
            +EP                                                T+ Q   +
Sbjct: 886  VEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINEN 945

Query: 4128 VNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQE 3949
             +S+  +Q  I   Y  L  + + R   LE++   +   RE +D  +W+K +E +    E
Sbjct: 946  ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDE 1005

Query: 3948 IGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNA 3769
                 E V+  ++KF+ F  DL A   R++E++         G ++    I +Q   ++
Sbjct: 1006 G----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQ-RQIHQ 1060

Query: 3768 RWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQR 3589
             W+ L          L  A  V+ F+R  DE + W+ EK   LD+     DLR+VQALQR
Sbjct: 1061 IWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQR 1120

Query: 3588 KHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKE 3409
            +H+ +ER+LA + DK+  +    N ++ ++P   + +   Q+E+ + W ++  + ++ +
Sbjct: 1121 RHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRN 1180

Query: 3408 KLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAA 3229
            ++      Q F +  + L+ WI S+   +++ E A DV  A  LL++H +   +I +
Sbjct: 1181 RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDT 1240

Query: 3228 TFQAFDQFGNQLLNSHHYAAGDIE--NRLQGVNEARKGLEDAWVARRNILDQCLELQLFY 3055
             F    Q G QL +     A  +    RL+   +A   +   W  ++  L QC++LQ+F
Sbjct: 1241 EFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDA---IHRGWAEKQKWLLQCVDLQMFN 1297

Query: 3054 RDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESL 2881
            R+ ++ D    + EAFL   +   S D VE+++K+H DF+K++  Q++ +KG    A+ L
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 2880 IKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKF 2701
            I N+HYDS  +  +R+Q+L +   +K+   +++  L  S+   +F+ +AD+++ W+ +K
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            +IA +ENYRD +N+ +K QK QAFE EL AN  ++  + + G  L++    G     V +
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQ---AGNRVPEVES 1474

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            R+  LN +W  L+  + +K  +L++A  Q+    +++D +  + E++  L+S D G DL
Sbjct: 1475 RVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLR 1534

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            S ++L+ K  +LE++I     +V E+    D +     F  Q I    K +  R+  ++
Sbjct: 1535 SCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRD 1594

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
                RR KL ++LN H+F  ++D E  WI E      S++ G++L   Q+L +KH++++
Sbjct: 1595 PTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEA 1654

Query: 1980 ELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDE 1801
            E+  H+P ++   + G+ L+   ++     +Q++   + LEQ+W  +    G R ++LD
Sbjct: 1655 EIKGHQPMINKALVAGQSLI---SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDM 1711

Query: 1800 SEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVAD 1621
            S   Q +L D  E E+W+ E+  +L S  +G +      LL KH T +++L+ +   V +
Sbjct: 1712 SLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTE 1771

Query: 1620 LINKGDTLIHNGNHHAPHIKQRCDQLRARLIE-IESMAEGRLAKLRDNSAYLQFMWKCDV 1444
            + +    ++   NH    +     QL  ++++ +  +A  R  +L ++    ++  + D
Sbjct: 1772 MGHSCAAMV-AANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDE 1830

Query: 1443 VESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE---LKDQLV 1273
            VE WI E+EQ   SED+G+D   +Q+L   Q  FD  L      G  R+ +   L  +L+
Sbjct: 1831 VEQWIREQEQAASSEDYGQDFEHLQLL---QNKFD-DLKHRVEVGADRVDQCELLAKKLI 1886

Query: 1272 SSEHQQSPAIEKRHTNVIQRWQNLL 1198
             SE   +  +EKR   +   W+NLL
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLL 1911



 Score =  610 bits (1573), Expect = e-172
 Identities = 410/1364 (30%), Positives = 666/1364 (48%), Gaps = 44/1364 (3%)
 Frame = -1

Query: 7176 QEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEE--NFRDPSN 7003
            Q VL      KD    +R +LE+A  +  F RD  E   WI EK +  + +  ++ + +N
Sbjct: 2218 QGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTN 2277

Query: 7002 LQAKI---QKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
            L  KI   QKH+AF+AEV A+   I  +  TG  ++   H +S  IK+ +E +   W
Sbjct: 2278 LDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGL 2337

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  +G  L++A   L F  Q D+I  WIR+KE  V A D G DLEH   L RK DD
Sbjct: 2338 LAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDV 2397

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHD--QIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
              ++     R+  INQ ADKL+ +     D   + K+R D N  W +L       +  L
Sbjct: 2398 DSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLG 2457

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKML 6298
            GA+++  FNRD D+T   I EK LA+SS D GRDL  V+AL R+ E  ERD++A++ K+
Sbjct: 2458 GANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517

Query: 6297 QLEKEAHKLAETHPDR-AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
            Q E  A  L + +P+R A+ I +K ++   +W  L+  +  R+  L  ++  H+F++D +
Sbjct: 2518 QHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVK 2577

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +L  W+ DM   +   +    +   E  LE HQE K EI+ R ++F      G++L +
Sbjct: 2578 ELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRP 2637

Query: 5940 IPESPE-VQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              + P+ V++ L  L+    +L   W ER     +   LQLF    EQ E W+  +EAFL
Sbjct: 2638 QQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFL 2697

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
             N DLGDS  +VE L+KKH++FEK L A  + ++ L +FA  +++G+   AD + E
Sbjct: 2698 NNDDLGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAY 2755

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L +S++ Q F R   E+  W+ +KL  A D++Y +P+N++ K
Sbjct: 2756 ILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSK 2815

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            +QKH  F+ EL +N  R+  +   GE++I   HFA D I  +++ +   W +L  A+  K
Sbjct: 2816 IQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTK 2875

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL++A +   FNR++++   W+ E+E Q++SEDYGKDL +V NL KK   +E+D   H
Sbjct: 2876 KDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHH 2935

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             +  D +KQ  +QF + EHF    I  +     +RYN L +PL  R+  L +S    Q
Sbjct: 2936 GELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFL 2995

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD EDEL W+ EK+ VAGS + G  L+ VQ L KK  +L AE+ + +  I+++      M
Sbjct: 2996 RDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQM 3055

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+  HF + +++ K   L+     L+  A  RR  L D++++  +  +ANEADAWM EK
Sbjct: 3056 IRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKR 3115

Query: 4503 PIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQAS--------QCKYQEQP 4348
            P++ S+DYG+DE S +   KK   L  +L AFK +IE + K A+              +
Sbjct: 3116 PVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEK 3175

Query: 4347 MGQLGRDCVLALYDYQEKSPREVSMKK---------------GDVLTLLNASNRDWWKVE 4213
              Q+G++    L   +E+  R    KK               GD +  + AS      VE
Sbjct: 3176 NAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMA-VTASEDYGEDVE 3234

Query: 4212 VNDRQGFVPAAYVKRIEPGTAQ------------QHAQQQVNSIGGKQSEIEDKYQRLMM 4069
              ++      ++V  +    A+            Q      +SI  K+ E +  ++ L
Sbjct: 3235 HVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKD 3294

Query: 4068 LGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKG 3889
            L   R+  L  A + +   R A++  + I  ++A    ++ G DLE ++ L +K   F+
Sbjct: 3295 LVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFES 3354

Query: 3888 DLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAH 3709
            +L   + ++  +   A  L  +   +    I  + ++    W  L         +L  A
Sbjct: 3355 ELVGIQGQVDSVLAEAAKLGEI-YPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 3708 EVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLD 3529
            ++Q +  +  +   WI E    + + +    +   + L    +  + ++    +
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 3528 EKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
                +L +     A ++ D  + L  +   L    N R+E    + D Q FL D   L Q
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQA 3217
            WI+S    +   +L + +   E LL RH+++   + ++   FQA
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQA 3577



 Score =  544 bits (1401), Expect = e-152
 Identities = 479/2308 (20%), Positives = 974/2308 (41%), Gaps = 62/2308 (2%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRD 7012
            I  RR +VLG     KD +  ++  L+ ++ F  F  +AD+L VW+ +K + A +EN+RD
Sbjct: 1368 IGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRD 1427

Query: 7011 PSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
             SNL  K+QKH+AFE E++A+   + N+ K G A++Q  +   E ++ R+ +L+  W
Sbjct: 1428 LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDL 1486

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  KG KL+QA       R  ++    + E ++ + + D+G DL   + L  K
Sbjct: 1487 LTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQIL 1546

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGA 6472
              E+     ++ E+    D +   GH     I     ++   +  L      R+  L  +
Sbjct: 1547 ESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEES 1606

Query: 6471 HQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
                +F  + D    WI E   A  S++ G++L+  Q+L +KH+  E   A ++G    +
Sbjct: 1607 LNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLE---AEIKGHQPMI 1663

Query: 6291 EKEA----HKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
             K        +++ HP+R E +       + AW  L+     R   L+ S +  ++L D
Sbjct: 1664 NKALVAGQSLISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDA 1722

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEM 5944
             ++ SW+G+   V+ + E  +D   A  LL  H+  + E+D  +    +   +   +V
Sbjct: 1723 GEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAA 1782

Query: 5943 GIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              P+S  +  K + ++    SL  L  +R+    + +    ++ ++++ E W+ +QE
Sbjct: 1783 NHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAA 1842

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
            ++ D G   + ++ L  K +D +  +    ++++  +  A KLI  +   A++V +
Sbjct: 1843 SSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQ 1902

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L  + +   F RD  E +  I +K +    +   D  +
Sbjct: 1903 LRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALAL 1962

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            L+KH  FE +L A E +L  +     ++       A  I  +  +V   WN+L + +  +
Sbjct: 1963 LRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTAR 2022

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
            G +L  + + Q F  ++ D+ +W S L   + +E++  D      L+ +   I  +  A
Sbjct: 2023 GDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAR 2082

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             D+   + +L+    +  H+ A  +  K   +      L     K+K  L +
Sbjct: 2083 EDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFL 2142

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD +        ++    S++ G+ +  VQN I+K       I   + ++  +      +
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKL 2202

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+Q H+ +  I+  L  +    + +K     RR  L+D+L   +++ D  EA  W++EK+
Sbjct: 2203 IEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQ 2262

Query: 4503 PIV--GSTDYGKDEDSAEAL--LKKHRALLSDLEAFKGTIEDLRKQ-ASQCKYQEQPMGQ 4339
              +   +  Y +  +  E +  L+KH+A  +++ A +G I++++         Q +   +
Sbjct: 2263 KKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPE 2322

Query: 4338 LGRDCVLALYDYQ----EKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPA---- 4183
            + R   + L  +Q    E   R   +++       N S  D  +  + D++  V A
Sbjct: 2323 IKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFN-SQLDKIEAWIRDKEMMVQASDTG 2381

Query: 4182 -------AYVKRIEPGTAQQHAQQQ----VNSIGGKQSEIEDKYQRLMMLGETRK----- 4051
                   A +++++   +      Q    +N +  K             + + RK
Sbjct: 2382 RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYN 2441

Query: 4050 -RKLEEACKGYQLL-----------REANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKK 3907
             R+L+ A   Y+ L           R+ +D A+ I  +    +  + G DL  VE L ++
Sbjct: 2442 WRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRR 2501

Query: 3906 FDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXX 3727
             +  + D+ A + ++ +    A  L        A  I +++E+L+  W  L
Sbjct: 2502 EEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQS 2561

Query: 3726 QLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGD 3547
             L  A+   +F  DV E   W+ +    +++      +   +     H+  + ++    +
Sbjct: 2562 ILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQE 2621

Query: 3546 KIKSLDEKANRL----RQSHPEAAEQ----IYDLQRELNEQWNRLTSKANNRKEKLLDSY 3391
                L ++  +L    +Q  P+   +    + +L + LNE W       + R   L +++
Sbjct: 2622 AFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-------SERARDLTEAH 2674

Query: 3390 DYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFD 3211
              Q F +    +  W+A+    +++ +L +  T  E LL++H E+   +   A
Sbjct: 2675 QLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQ 2732

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
            +F N +L      A  I  +L  +   ++ L +    R+  L Q  +LQ F R   + D
Sbjct: 2733 KFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDR 2792

Query: 3030 WMSAR-EAFLAQEDPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSP 2854
            W+  + +  L +      N++S I+KH  FD  + +   +++ +    E LI+ +H+
Sbjct: 2793 WLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD 2852

Query: 2853 AVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENY 2677
             + ++   +   W  LK A   K+ KL ++     F+R  DE  NWM E + Q++ E+
Sbjct: 2853 EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYG 2912

Query: 2676 RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQ 2497
            +D   +    +K +  EA++  + +    + Q      +       E  +  R      +
Sbjct: 2913 KDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHE--IHERATVSIRR 2970

Query: 2496 WDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKK 2317
            ++ L +    +   L+++   + F+   +D   WL E +++  S+D G  L SV+ L KK
Sbjct: 2971 YNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKK 3030

Query: 2316 HSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDK 2137
            H+ LEA++ + +  +  + ++   ++ ++ F  +Q+  + +L+  +   ++ +A  RR +
Sbjct: 3031 HNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLR 3090

Query: 2136 LSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQ 1957
            L  A+    F+ + ++ ++W++EK+ ++SS DYGRD   VQ  ++K   +  EL + +P
Sbjct: 3091 LLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPS 3150

Query: 1956 VSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFL 1777
            +  V      L+            I ++   + Q +  +  L   R  RL E +    +L
Sbjct: 3151 IEKVAKLATGLIE---RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYL 3207

Query: 1776 GDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTL 1597
             + EE   W+ ++  +  S+++GE++  V+ L+   ++F  +L  ++ RV   + +GD L
Sbjct: 3208 RETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRL 3267

Query: 1596 IHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKE 1417
            I   N +   IK + D+ +    E++ +   R   L        +    D     I EK+
Sbjct: 3268 IQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD 3327

Query: 1416 QQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEK 1237
              + SED+G+DL S+Q L  K + F++ L   + + +  +     +L          IE
Sbjct: 3328 ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ-VDSVLAEAAKLGEIYPDAKEHIEV 3386

Query: 1236 RHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTD 1057
            +    ++ W +L   + AR+             +E     A        W       +T
Sbjct: 3387 KRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIA--------WINEMLAKITA 3438

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALE 877
            P   NS+     L  +  +    + + +E F +     +++            F    +E
Sbjct: 3439 PELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIK-------EKHFLAHEVE 3491

Query: 876  DTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEA--GGT 703
            D  + LQ   +  +  L +  +  E N   +  F K A     W+++   ++ +   G +
Sbjct: 3492 DKIKVLQARHELLKHTLNKRREIYELNLDTQL-FLKDAEILEQWISSREPQLKDTKLGDS 3550

Query: 702  LEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY---TEHSTVGIAQAWDQL 532
            + +  D + R     K    Q    EEK   ++R  +L+  +    E   +   Q  ++L
Sbjct: 3551 IPQVEDLLRRHEDFEKTVAAQ----EEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERL 3606

Query: 531  --DQLAMRMQHNLEQQIQARNQSGVSEE 454
              ++L    Q  L++    R ++    E
Sbjct: 3607 EKERLEQLKQRELQRLADERRRAEKQHE 3634



 Score =  511 bits (1316), Expect = e-142
 Identities = 471/2295 (20%), Positives = 948/2295 (40%), Gaps = 57/2295 (2%)
 Frame = -1

Query: 7212 ILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTA 7033
            I E AD + +R+Q +   Y   ++ +Q +   LE++     F R+ D+   W+ EK +
Sbjct: 942  INENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMI 1001

Query: 7032 QEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEEL 6853
            + +      N + K +K   F  ++ A +K +  +D   +   +  H   + I  R  ++
Sbjct: 1002 KSDEGEGVDNAKRKFEK---FITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQI 1058

Query: 6852 HALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEIL 6673
            H +W         +   L+ A  +  F R CDE   W+ EK   +    +  DL  V+ L
Sbjct: 1059 HQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQAL 1118

Query: 6672 QRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR 6493
            QR+  +  +EL   + ++N +    + +     +E D +  ++ +V D W ++    +
Sbjct: 1119 QRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDL 1178

Query: 6492 KEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAAL 6313
            +  +      Q FN  A   LAWI      L++D+  RD+     L +KH     D+ A
Sbjct: 1179 RNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAH 1238

Query: 6312 EGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + + +++ +   +L++  P+ AE +    +  KA  +A+      ++  L +   L  F
Sbjct: 1239 DTEFVEVIQLGKQLSDGKPNMAETV-AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFN 1297

Query: 6132 ADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKL 5953
             +   + +     +A +  + L   +   EA+L+ H + +  + A+       +    KL
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 5952 VEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQE 5773
            +     +S  + ++  ++  ++ ++     ER+ L +   D   F  + +  + W+  +
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 5772 AFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEX 5593
                + +  D L ++   ++KH+ FE+ L A E ++  + +    L+Q  +    +V
Sbjct: 1418 RIAGDENYRD-LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESR 1475

Query: 5592 XXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARD-DSYLDPTN 5416
                             +G  L+++  ++  +R  ++    + E  S  R  D   D  +
Sbjct: 1476 VADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRS 1535

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
             +  + K    E E+   + ++ ++ STG+ +   GHF A +I    +++   + +L D
Sbjct: 1536 CKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDP 1595

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T ++ AKL E+ N  +F   ++    W++E      S + G++L   Q+L KK   +E++
Sbjct: 1596 TQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAE 1655

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
               H   ++      Q    ++H     +    + L+Q +  L     +R RKL  S +
Sbjct: 1656 IKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKA 1715

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q   D  +  +W+ E+  V  ST  GRD      L+ K + +  E+  +   +  +  +
Sbjct: 1716 QQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHS 1775

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
               M+   H  +  +  K   +    + L   A +R+  L +SL  H+Y  +++E + W+
Sbjct: 1776 CAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWI 1835

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLK-----KHRA----------------LLSDLEAFKGT 4399
             E+E    S DYG+D +  + L       KHR                 L+     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 4398 IEDLRKQ--------ASQCKYQEQPMGQLG------RDCVLALYDYQEKSPREVSMKKGD 4261
            +E  ++Q              +EQ +   G      RD   AL+  Q+K+   +S + G
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGR 1954

Query: 4260 VLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQ 4081
             L    A  R     E ND         V   +    Q       ++I  +Q ++   +
Sbjct: 1955 DLNSALALLRKHEGFE-NDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWN 2013

Query: 4080 RLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFD 3901
             L      R  +L  +      L +  D+  W  +  A    +E  +D      L+ + D
Sbjct: 2014 DLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHD 2073

Query: 3900 DFKGDLKANEVRLQEMNQIATALTSVGQ------TETAVRIRQQIEDLNARWRALXXXXX 3739
               G+++A E + + +N+++ ++   G        E    +  + + L+A W
Sbjct: 2074 AIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWN------- 2126

Query: 3738 XXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLA 3559
                 L    ++  F RD  +  +    +  AL S DFG+ +  VQ   RKH+  ER +
Sbjct: 2127 KKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQ 2186

Query: 3558 ALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQR 3379
               +K+  L E   +L +     +  I  + + +  +  ++      R+ KL D+  Y +
Sbjct: 2187 TQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAK 2246

Query: 3378 FLSDYRDLMQWI-ASMNQLVSSQELANDVTGAE---ALLERHQEYRTEIDSRAATFQAFD 3211
            F+ D  +   WI     +L +      +VT  +     L++HQ ++ E+ +     Q
Sbjct: 2247 FVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
              G  LL+  H ++ +I+  ++ V EA +GL      R   L++  +   F    ++ +
Sbjct: 2307 DTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEA 2366

Query: 3030 WMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHY-- 2863
            W+  +E  +   D   D  +  +L++K +D D  +   ++++K +   A+ LI
Sbjct: 2367 WIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA 2426

Query: 2862 DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEK-FQIAQE 2686
            D+ +V ++R      W  L+ AL   R  LG +  +  F+RD D+  + + EK   ++
Sbjct: 2427 DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSST 2486

Query: 2685 ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKAL 2506
            +  RD   ++   ++++A E ++ A   +I     A   LI+     G +  +  +L+ L
Sbjct: 2487 DTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQ-HIERKLEEL 2545

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
            +  W  L   + ++   L EA     F++ VK+LE W+ ++   + +      +   E
Sbjct: 2546 HKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQ 2605

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR-YDGVKKMATD 2149
            L+ H   + +I   Q+    + +Q + L +  Q Q      +  L+ +  +  + +  ++
Sbjct: 2606 LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSE 2665

Query: 2148 RRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELAS 1969
            R   L++A  +  F   ++  E W+  K+  +++DD G     V+ L +KH   +  L
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL-- 2723

Query: 1968 HEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAF 1789
            H   V  ++     +L    +     D I++++  + +   ++ +L+  R QRL +S
Sbjct: 2724 HADHVDTLQKFANSILEGEPK---DADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1788 QAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINK 1609
            Q FL  + E + W+ +K Q+   +N+ E  + +Q  ++KH  F  +L  +  RV  +I++
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENYRE-PSNLQSKIQKHAAFDAELLSNSPRVQSVIHE 2839

Query: 1608 GDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWI 1429
            G+ LI   +     I Q+   L    ++++  ++ +  KL+     L F    D   +W+
Sbjct: 2840 GERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM 2899

Query: 1428 AEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSP 1249
             E E Q+ SED+G+DL++V  LL K E  +A + A   E   ++ +  +Q   +EH
Sbjct: 2900 DEVELQLSSEDYGKDLAAVSNLLKKHERLEADV-AHHGELADQLKQKDEQFFQAEHFLRH 2958

Query: 1248 AIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEE 1069
             I +R T  I+R+  L      RR                   F + A     W    +
Sbjct: 2959 EIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQ--------QFLRDAEDELQWLAEKQL 3010

Query: 1068 DLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTM 889
                     SL  ++ L+  H   +  L+S E   + L    +++   N   +    +
Sbjct: 3011 VAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS 3070

Query: 888  DALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAG 709
            + L+     L+ +   R   L    + Q         F   AN   AW+   R  +  +
Sbjct: 3071 ELLQKQLVQLRDLAAIRRLRLLDAVESQ--------LFYVEANEADAWMREKRPVLSSSD 3122

Query: 708  -GTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTE----HSTVGIAQA 544
             G  E  +   ++K + ++      +   EK A L   LI  N +           + Q
Sbjct: 3123 YGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQE 3182

Query: 543  WDQLDQLAMRMQHNL 499
            ++ L +LA   +  L
Sbjct: 3183 YEDLLRLAKERESRL 3197



 Score =  503 bits (1294), Expect = e-140
 Identities = 491/2306 (21%), Positives = 986/2306 (42%), Gaps = 133/2306 (5%)
 Frame = -1

Query: 7119 RLEEARQFQY-FKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAK 6943
            R E+  Q  Y F++ +     ++ E +Q   +  +     + A ++KHEA  A++ A  +
Sbjct: 390  RQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVE 447

Query: 6942 TIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQ 6763
               +L      + + N+   E +++R +E+ A W         + + L Q   L++ +R+
Sbjct: 448  RFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLRE 507

Query: 6762 CDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQY--RINEINQAADKL 6589
                   +RE +    +ED+G  L  VE L +     L+EL  + Y   +   N+ A
Sbjct: 508  IASTTEAVRELQQQFASEDVGPHLLGVEELLQAHS--LQELQVNTYGETLKRFNRQALPY 565

Query: 6588 VEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKD 6409
                H +   + ++  D+ +A+  L   +A R+  L  A     F  D D   +W+ +K
Sbjct: 566  KSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQ 625

Query: 6408 LALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAEAIHQ 6232
                +    +DL  V +LQ+KH+  E ++ + + K  Q+     +L  E HP R+  I
Sbjct: 626  RICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHP-RSSEIQS 684

Query: 6231 KNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVA 6052
            + D     W AL+   + R+  LE + + ++F  D  +  SW+ +  A++ + +   D
Sbjct: 685  RIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEP 744

Query: 6051 GAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGI---------PESPEVQEK---- 5911
             A+ALL+ H++ +GE++A +           KL++ GI         PE PEV+++
Sbjct: 745  SAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVN 804

Query: 5910 --------------LEKLDHEKSSLLGLWEERRILYE---QCMDLQ----LFYRDTEQAE 5794
                          +EKL+H+K +   +    + L+    Q M +     +  +     +
Sbjct: 805  ETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDD 864

Query: 5793 TWMNKQEAFLANTDLGDSLDSVE-----------HLIKKHEDFEKSLAAQE----EKINA 5659
             W  +++  +      + +  VE             +K  +  +K++  ++    ++I
Sbjct: 865  WWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKP 924

Query: 5658 LDEFATKLIQGQ------HYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFD 5497
            +      L+Q +      +  AD V +                  R   L++S     F
Sbjct: 925  VSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFY 984

Query: 5496 RDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQII 5317
            R+CD+   W+ EK    + D      N + K +K I    +L A   R+++I    +
Sbjct: 985  RECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFIT---DLSAASKRVEEIDGAVDTFR 1041

Query: 5316 DSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEG 5137
              GH   D I  R RQ++ +W  L +A  ++   L  A + + FNR  ++ + W+SE
Sbjct: 1042 RQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKML 1101

Query: 5136 QVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQ-----EEEHFNAPV 4972
            Q+ +     DL +VQ LQ++   +E +     D+V+ +  L    +     E+++ NA
Sbjct: 1102 QLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNA-- 1159

Query: 4971 IVRKQE------NLQQRYNALRDPLEKRKRKLGESHQGNQLFRD-IEDELAWIREKEQVA 4813
              R+QE       +QQR + LR+ +        ES  G Q+F +  +  LAWI   +
Sbjct: 1160 --RQQEVQDMWQQVQQRGSDLRNRI--------ESEVGQQVFNNSAKVLLAWIDSVKDQL 1209

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLA---PEIRDK 4642
             +    RD+    NL+KK   L  +I  HD++   V       IQ G  L+   P + +
Sbjct: 1210 NADESARDVETANNLLKKHNDLGDDIRAHDTEFVEV-------IQLGKQLSDGKPNMAET 1262

Query: 4641 LAQLR----DNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGK 4474
            +A +     +   I +  AEK++  L   +    +  +A++ DA     E  +   + G
Sbjct: 1263 VAVIERLKAEQDAIHRGWAEKQKW-LLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGA 1321

Query: 4473 DEDSAEALLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVL---- 4318
              D  EA+LK+H    ++L++  +  KG  ++  K  S   Y  + +G   R+ VL
Sbjct: 1322 SLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGD-RRNQVLGKRK 1380

Query: 4317 ALYDYQEKSPREVSMKKGDVLTLLNASNRDWW---KVEVNDRQGFVPAAYVKR------- 4168
            A+ D   +  R +   K        A +   W   K  +   + +   + + R
Sbjct: 1381 AVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQA 1440

Query: 4167 ---------------IEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
                            + G A   A  +V  +  + +++  +++ L+ L E + RKLE+A
Sbjct: 1441 FERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQA 1500

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
                +  R   D  + +   ++     ++G DL   + L  K    + ++   + ++ E+
Sbjct: 1501 ASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL 1560

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
                  +   G    A  I    ++L  R++ L         +L  +    +F  ++D
Sbjct: 1561 VSTGDDMAHGGHF-NAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSE 1619

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKI-KSLDEKANRLRQSHP 3496
              WI E   A  S + G++L   Q+L +KH+ +E ++      I K+L    + + Q HP
Sbjct: 1620 FQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP 1679

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
            E  EQ+  L ++L + W  L      R  KL  S   Q++L D  ++  W+   N ++ S
Sbjct: 1680 E-REQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRS 1738

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
             E   D   A  LL +H+    E+D+ +            ++ ++H  +  +  + Q +
Sbjct: 1739 TEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIE 1798

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
            +  K L      R+  L + L    ++ + ++ + W+  +E   + ED   D  +++ L
Sbjct: 1799 KMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQ 1858

Query: 2961 KKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKR 2782
             K +D    +    +++   +L A+ LI +    +  V ++++Q+   W  L + L Q+
Sbjct: 1859 NKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQRE 1918

Query: 2781 FKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSD 2602
             KL  +  + +F RD  E    + +K     +E  RD  +     +K + FE +L A
Sbjct: 1919 QKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 2601 RIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFM 2422
            ++  +++    L   AK     +A++ +   +   W+ L + +T +  RL  ++  ++F+
Sbjct: 1979 QLQVLVEDSVRL--QAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFL 2036

Query: 2421 AAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL 2242
              V+D+  W   +   LQ+E++  D A    L  +H  +  +I A +D+   +NE +DS+
Sbjct: 2037 TDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSM 2096

Query: 2241 LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKK 2062
            ++   +    + E+   + D    +      ++  L + +++  F RD    ++    ++
Sbjct: 2097 VQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQ 2156

Query: 2061 LLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQI 1882
              +SS D+G+ +  VQN  RKH   +  + + E +VSL++  G +L+    +       I
Sbjct: 2157 AALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIE---QRHYDSANI 2213

Query: 1881 KKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSD--NFG 1708
            +  ++ +     +++DL   R  +L+++  +  F+ D  E + W+NEKQ+ L +D  ++
Sbjct: 2214 QTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYA 2273

Query: 1707 E--NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQL--- 1543
            E  N+      L+KH  FQ ++  ++ R+ ++ + G  L+   +  +P IK+  + +
Sbjct: 2274 EVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEA 2333

Query: 1542 -RARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
             +  L E+E    G    L +    L+F  + D +E+WI +KE  V++ D GRDL
Sbjct: 2334 WQGLLAELEQRGRG----LEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNA 2389

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEH--QQSPAIEKRHTNVIQRWQNLLAH 1192
            L+ K +  D+ +   + + ++ I +L D+L++       + +++KR  +    W+ L
Sbjct: 2390 LMRKLDDVDSDMRV-DDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGA 2448

Query: 1191 SEARRX---XXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRA 1021
              A R               +++     A+K+   +S         TD  R   L  + A
Sbjct: 2449 LNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSS---------TDTGR--DLAAVEA 2497

Query: 1020 LRDAHGEFQRSLSSAEEDFRQLQD-LDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIK 844
            L       +R +S+ ++   Q +   +  IK +      +    ++ L  +W NLQ +
Sbjct: 2498 LIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSV 2557

Query: 843  EREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEM--MEAGGTL---EEQLDAV 679
            +R+  L   +        L  +F         W+ +  ++M   ++  T+   E QL+
Sbjct: 2558 KRQSILNEAY--------LAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELH 2609

Query: 678  ERKAKEIKANKGQLRQIEEKGAMLER 601
            + +  EI+  +     ++++G  L +
Sbjct: 2610 QERKVEIEGRQEAFAGLKQQGEQLSK 2635



 Score =  455 bits (1170), Expect = e-126
 Identities = 455/2234 (20%), Positives = 916/2234 (40%), Gaps = 59/2234 (2%)
 Frame = -1

Query: 7185 QRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQ----EENF 7018
            QR  ++   YS     S  +R RLEEAR F +F  D D    W+++K +  +     ++
Sbjct: 578  QRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDL 637

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            R   +LQ   QKH+A E E+++       +   G  +I   H  S  I+ R++ L   W
Sbjct: 638  RAVLSLQ---QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQ 694

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +  +L+ A +   F    +E   W+ EK   V + D G D    + L ++
Sbjct: 695  ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
            D   EL  +   I  +NQ ADKL++ G                    + TL  +  E
Sbjct: 755  DLQGELNAYSGDILNLNQQADKLIKAG--------------------ICTLELSAAEP-- 792

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLA---LSSDDYGRDLNNVQALQRKHEGTERDLAALEG 6307
                         E   W+ E  L    +  D++   L + +  + K     + L   EG
Sbjct: 793  --------ELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEG 844

Query: 6306 KMLQLEK-EAHKLAETHPDRAEAIHQKND-DTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + ++++K E   L     D    + + N  +     N ++E        +    +  + L
Sbjct: 845  QGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSL 904

Query: 6132 ADYRD--LISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
               +   L+  +  +K +       K +       +S  E+   ++ R    NQT
Sbjct: 905  QKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYD--- 961

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
                       E+QE  +K              R  L E  + L  FYR+ +  E WM +
Sbjct: 962  -----------ELQEMAQK--------------RHALLEDSIHLFGFYRECDDFEKWMKE 996

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            +E  +  +D G+ +D+ +   +K E F   L+A  +++  +D       +  H   D +
Sbjct: 997  KERMI-KSDEGEGVDNAK---RKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKII 1052

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDP- 5422
                               R  +L+ +   + F+R CDE   W++EK+    D + + P
Sbjct: 1053 ARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKM-LQLDTAVITPD 1111

Query: 5421 -TNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
               ++   ++H N E+EL   E++++ +   G  + ++     D++  R ++V ++W ++
Sbjct: 1112 LRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV 1171

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
                +    ++     +Q FN + + + AW+  ++ Q+ +++  +D+ +  NL KK   +
Sbjct: 1172 QQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDL 1231

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
              D  AH+     + QL +Q  + +  N    V   E L+   +A+     ++++ L +
Sbjct: 1232 GDDIRAHDTEFVEVIQLGKQLSDGKP-NMAETVAVIERLKAEQDAIHRGWAEKQKWLLQC 1290

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
                   R+ +   A  +  E      N G  L  V+ ++K+       +   D  ++
Sbjct: 1291 VDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGF 1350

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
            S  A+ +I   H+ +  I D+  Q+    + +K +A +R+  L  S   H++ ++A++
Sbjct: 1351 SDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLK 1410

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA---------- 4375
             W+ +K  I G  +Y +D  +    L+KH+A   +L A +G + ++ K
Sbjct: 1411 VWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV 1469

Query: 4374 --------------------SQCKYQEQPMGQLGRDCVLALYDYQEK-SPREVSMKKGDV 4258
                                S+ K ++       R+   +L D ++K    + +++ GDV
Sbjct: 1470 PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529

Query: 4257 LTLLNASNRDWWKVEVNDRQGFV-PAAYVKRIEPGTAQQHAQQ-QVNSIGGKQSEIEDKY 4084
               L +      K ++ + +  +      + +  G    H       +I     E++ ++
Sbjct: 1530 GNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRF 1589

Query: 4083 QRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKF 3904
            + L    + R+ KLEE+   ++ + E +   +WI      A   E+G +L Q + L KK
Sbjct: 1590 KDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKH 1649

Query: 3903 DDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQ 3724
               + ++K ++  + +      +L S    E   ++    + L   W+ L         +
Sbjct: 1650 KKLEAEIKGHQPMINKALVAGQSLISQQHPERE-QVESLCQQLEQAWQDLERHCGERSRK 1708

Query: 3723 LGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK 3544
            L  + + Q++  D  E   W+ E+++ L S ++GRD  S   L  KH+ +E +L
Sbjct: 1709 LDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGI 1768

Query: 3543 IKSLDEK-ANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSD 3367
            +  +    A  +  +HP+ ++ +   Q+ + +    L   A+ R+ +L++S     +  +
Sbjct: 1769 VTEMGHSCAAMVAANHPD-SKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLE 1827

Query: 3366 YRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLN 3187
              ++ QWI    Q  SS++   D    + L  +  + +  ++  A      +    +L++
Sbjct: 1828 SDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLID 1887

Query: 3186 SHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAF 3007
            S    A ++E R + +  + + L      R   L    E+  F+RD  +A   +  + A
Sbjct: 1888 SESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAA 1947

Query: 3006 LAQE-DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQ 2830
            L+QE     ++  +L++KHE F+  +   E +++ L   +  L      ++ A+ +++D+
Sbjct: 1948 LSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDK 2007

Query: 2829 ILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENYRDPTNIQQ 2653
            ++  WN LKE    +  +L  S  LQ F  D  +I +W +  +  +  EE+  D
Sbjct: 2008 VVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATA 2067

Query: 2652 KHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTT 2473
               +  A   E+ A  D+   + +  +++++        A V  +  A+ D+   L
Sbjct: 2068 LKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAA--ADVEEKCAAMLDERQKLHAAW 2125

Query: 2472 TEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADI 2293
             +K   L++      F+   K ++      +  L S D+G+ +  V+N ++KH   E  I
Sbjct: 2126 NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLI 2185

Query: 2292 VAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVH 2113
               +++V  + E    L+E   +    I    + +  R   VK +   RR KL  AL
Sbjct: 2186 QTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYA 2245

Query: 2112 QFFRDIDDEESWI--KEKKLLVSSDDYGRDLPGVQNLRR--KHRRIDTELASHEPQVSLV 1945
            +F RD  + + WI  K+KKL   +  Y       + +++  KH+    E+A+++ ++  +
Sbjct: 2246 KFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEI 2305

Query: 1944 KLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVE 1765
            +  G  LL    E+     +IK+ +E + ++W  +      R + L+E++    F   ++
Sbjct: 2306 QDTGVILLSKQHES---SPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLD 2362

Query: 1764 EEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            + EAW+ +K+ ++ + + G ++     L++K D    D+ +  QRV  +    D LI+
Sbjct: 2363 KIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQA 2422

Query: 1584 NHHA--PHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQ 1411
               A    + +R         +++       A L   +    F    D     IAEK
Sbjct: 2423 QVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLA 2482

Query: 1410 VRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRH 1231
            + S D GRDL++V+ L+ ++EA +  ++A + +  Q  T  +  +     + +  IE++
Sbjct: 2483 MSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKL 2542

Query: 1230 TNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA--FAKKASTFNSWFENAEEDLTD 1057
              + + W NL A S  R+            + E YLA  F         W  +  + + +
Sbjct: 2543 EELHKSWGNLQALSVKRQ----------SILNEAYLAHKFVSDVKELELWVNDMIKKMNN 2592

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI--KSFNVGPNPYTWFTMDA 883
                +++ +     + H E +  +   +E F  L+    ++  +     P+    + +
Sbjct: 2593 TQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLL-V 2651

Query: 882  LEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGT 703
            LE+  + L     ER ++L   HQ Q         F         WL N  +E
Sbjct: 2652 LEELHQTLNEAWSERARDLTEAHQLQ--------LFKAQVEQVEIWLAN--KEAFLNNDD 2701

Query: 702  LEEQLDAVERKAKE 661
            L +   AVER  K+
Sbjct: 2702 LGDSYTAVERLLKK 2715



 Score =  328 bits (840), Expect = 2e-87
 Identities = 188/525 (35%), Positives = 297/525 (55%), Gaps = 2/525 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSI-FKDHSQTKRDRLEEARQFQYFKRDADELNVWILE 7048
            Q IR    A +  Q + E+L    +  +D +  +R RL +A + Q F  +A+E + W+ E
Sbjct: 3054 QMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 7047 KLQTAQEENF-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIK 6871
            K       ++ RD  ++Q   +K E  + E+ A   +I  + K    +I+ NHF S +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 6870 KRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDL 6691
            ++  ++   +         +  +L +  KL  ++R+ +E+  W+ ++     +ED G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 6690 EHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLN 6511
            EHVE L   F+ F+  L  ++ R+    +  D+L++E +     I  KRD+    W  L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELK 3293

Query: 6510 TLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTE 6331
             L   R++ L GA QV  ++R ADET+  I EKD +L S+DYG+DL ++QAL RKH+  E
Sbjct: 3294 DLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFE 3353

Query: 6330 RDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSF 6151
             +L  ++G++  +  EA KL E +PD  E I  K D+T  AW  LKEK   RK+ L ++
Sbjct: 3354 SELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 6150 QLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTA 5971
            QL  +  +YRDLI+WI +M A I A ELA  VAGAE LL S ++H  EI  R ++F + A
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 5970 SAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAET 5791
            + GQ+L++     + EV++K++ L      L     +RR +YE  +D QLF +D E  E
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 5790 WMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINAL 5656
            W++ +E  L +T LGDS+  VE L+++HEDFEK++AAQEEK  A+
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAI 3578



 Score =  313 bits (802), Expect = 4e-83
 Identities = 227/909 (24%), Positives = 428/909 (46%), Gaps = 5/909 (0%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            AD I ++   +L       + S+ ++ RL ++ Q Q F R   E++ W+++KLQ A +EN
Sbjct: 2746 ADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDEN 2805

Query: 7020 FRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
            +R+PSNLQ+KIQKH AF+AE+ +++  + ++   G  +I+ +HFA + I ++++ L   W
Sbjct: 2806 YREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDW 2865

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KLQQA   L F R  DE   W+ E E  +++ED G DL  V  L +K
Sbjct: 2866 LKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH 2925

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
            +    ++ +H    +++ Q  ++  +  H    +I+++       ++ L+     R+E L
Sbjct: 2926 ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENL 2985

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +  +Q+F RDA++ L W+ EK L   S D G  L +VQ LQ+KH   E +L + E  +
Sbjct: 2986 EDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLI 3045

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              L +   ++   +   +E +  K++  +     L++ A  R+  L  + +   F  +
Sbjct: 3046 QALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEAN 3105

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +W+ + + V+ + +  +D    +   +  +  + E+ A   S  + A     L+E
Sbjct: 3106 EADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERN 3165

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
              +S  + EK  ++  E   LL L +ER     +C  L  + R+TE+   W+  Q A  A
Sbjct: 3166 HFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTA 3225

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXX 5581
            + D G+ ++ VE LI   E F  +L A E ++ A  E   +LIQ  +     +
Sbjct: 3226 SEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDET 3285

Query: 5580 XXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK-LSTARDDSYLDPTNIRGK 5404
                         R +AL  + +   +DR  DE +  I EK  S   +D   D  +I+
Sbjct: 3286 KQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQAL 3345

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
             +KH  FE EL   + ++D + +   ++ +    A +HI  +  +    W +L + T  +
Sbjct: 3346 GRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAAR 3405

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL +A   Q +     D+ AW++E+  ++ + +    +   + L       +++
Sbjct: 3406 KNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTR 3465

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
            ++         QQ  +E+HF A  +  K + LQ R+  L+  L KR R++ E +   QLF
Sbjct: 3466 DETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKR-REIYELNLDTQLF 3524

Query: 4863 -RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAND 4687
             +D E    WI  +E     T  G  +  V++L+++ +     +A  + + +++
Sbjct: 3525 LKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT-- 3582

Query: 4686 MIQQGHFLAPEIRDKLAQLRDNWRILKSKAEK-RRTDLDDSLQAHQYLSDANE--ADAWM 4516
            M++Q  F     ++K+++L++  R+ K + E+ ++ +L       +     +E   +A
Sbjct: 3583 MLEQ-LFRHQLEQEKISKLQEKERLEKERLEQLKQRELQRLADERRRAEKQHEHRQNAAS 3641

Query: 4515 SEKEPIVGS 4489
             EK PI  S
Sbjct: 3642 QEKTPIFSS 3650



 Score =  219 bits (557), Expect = 1e-54
 Identities = 252/1272 (19%), Positives = 506/1272 (38%), Gaps = 86/1272 (6%)
 Frame = -1

Query: 3999 DLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQ-----IATA 3835
            +L  WI+ +     Q+++   LE ++     F +++   K  + + +   +     I T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQ--------RFHRDVD 3679
            L ++ Q     +  Q + D+   W+ L          L      Q        +F +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 3678 ETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSH 3499
                +++E    L      R LR V A  +KHE +  D+ A  ++   L   A  L + +
Sbjct: 407  LREGYLKEMIQVLSDP---RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDREN 463

Query: 3498 PEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVS 3319
                E++   ++E+  +W +L     N++  L    +    L +     + +  + Q  +
Sbjct: 464  YHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFA 523

Query: 3318 SQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGV 3139
            S+++   + G E LL+ H     ++++   T + F++      +S H  A  +  RL  +
Sbjct: 524  SEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADL 583

Query: 3138 NEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESL 2965
             EA   L     ARR  L++      F  D +  ++W+  ++        + D   V SL
Sbjct: 584  EEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSL 643

Query: 2964 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
             +KH+  +  I +++ K   +    + LI   H  S  +  + D + + W  L+  +  +
Sbjct: 644  QQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELR 703

Query: 2784 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHAN 2608
            R +L ++    QF  DA+E E+W+ EK  +    +Y  D  + Q   Q+ +  + EL+A
Sbjct: 704  RRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763

Query: 2607 SDRIAAIIQAGNNLIENAKCGGGEAAVSARL-----------------KALNDQW----- 2494
            S  I  + Q  + LI+   C    +A    L                 +   D+W
Sbjct: 764  SGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLE 823

Query: 2493 -------------------------------DLLVKTTTEKSYRLKEANKQKSFMAAVKD 2407
                                            LL   T +  + +++ N  + F+ A
Sbjct: 824  HKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYV 883

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLL-----------KKHSLLEADIVAHQDRVGEMN 2260
             E     V  ++   +  K L  V+  +           K  S+    +V  +     +N
Sbjct: 884  REVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSIN 943

Query: 2259 EQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEES 2080
            E ADS           + +R++ I   YD +++MA  R   L  ++++  F+R+ DD E
Sbjct: 944  ENADS-----------VEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 2079 WIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAG 1900
            W+KEK+ ++ SD+      GV N +RK  +  T+L++   +V  +    +   R
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQ- 1047

Query: 1899 VGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGS 1720
               D+I  R   + Q W ++ +    R + L+ + + + F    +E + WM+EK   L +
Sbjct: 1048 --LDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDT 1105

Query: 1719 DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLR 1540
                 ++  VQ L ++H   + +L   + +V  +   G+++ +       ++  R  +++
Sbjct: 1106 AVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQ 1165

Query: 1539 ARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL 1360
                +++        ++        F     V+ +WI   + Q+ +++  RD+ +   LL
Sbjct: 1166 DMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLL 1225

Query: 1359 TKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR 1180
             K       + A + E ++ + +L  QL   +   +  +      VI+R   L A  +A
Sbjct: 1226 KKHNDLGDDIRAHDTEFVE-VIQLGKQLSDGKPNMAETVA-----VIER---LKAEQDAI 1276

Query: 1179 RXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGE 1000
                        Q  +L + F ++A   ++  ++ E  L       SL+E+ A+   H +
Sbjct: 1277 HRGWAEKQKWLLQCVDLQM-FNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLD 1335

Query: 999  FQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAR 820
            F++SL + ++  +   D   ++ S +   + Y    +    +     ++ +K+R    A
Sbjct: 1336 FEKSLMAQDKILKGFSDNADKLISNDHYDSKY----IGDRRNQVLGKRKAVKDR----AF 1387

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTN-TR---QEMMEAGGTLEEQLDAVERKAKEIKA 652
            E +R  +  K   +FA  A+    WL + TR    E       L  +L   +   +E++A
Sbjct: 1388 ERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA 1447

Query: 651  NKGQLRQIEEKGAMLERNLILDNRY--TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQAR 478
            N+GQLR + + G  L +     NR    E     + + W  L  L+      LEQ    R
Sbjct: 1448 NEGQLRNVTKDGQALVQ---AGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQR 1504

Query: 477  NQSGVSEEALRE 442
              +   E+A ++
Sbjct: 1505 EHNRSLEDAKKK 1516



 Score =  145 bits (366), Expect = 1e-32
 Identities = 99/418 (23%), Positives = 192/418 (45%)
 Frame = -1

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNI 2659
            RD++L +     E L Q  +K  +   L+         E ++ E  Q+  +  Y    +
Sbjct: 385  RDELLRQ-----EKLEQLNYKFEKKSVLR---------EGYLKEMIQVLSDPRYLRQVDA 430

Query: 2658 QQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVK 2479
              K  K +A  A++ A  +R   +      L  + +   G+  V  R + +  +W  L++
Sbjct: 431  TLK--KHEAISADILARVERFNDLTAMAEEL--DRENYHGKERVRRREQEVMAKWRQLLE 486

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
                +   L + +   + +  +      + E++    SED G  L  VE LL+ HSL E
Sbjct: 487  LLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQEL 546

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
             +  + + +   N QA     ++      +A+R   + + Y  + + +  RR +L +A N
Sbjct: 547  QVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARN 606

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
             H F  D D+EESW+ +K+ +  +    +DL  V +L++KH+ ++ E+ S +P+   +
Sbjct: 607  FHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMST 666

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEE 1759
             G+ L+    E      +I+ R++ L + W  +  L   R ++L+++     F  D  E
Sbjct: 667  AGKRLI---GEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEA 723

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            E+W+NEK  ++ S ++G +    Q LL++H   Q +L  +   + +L  + D LI  G
Sbjct: 724  ESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAG 781



 Score =  137 bits (344), Expect = 5e-30
 Identities = 120/502 (23%), Positives = 222/502 (43%), Gaps = 20/502 (3%)
 Frame = -1

Query: 3360 DLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRT-----------EIDSRAATFQAF 3214
            +L+ WI      +  ++L N + G +  L   +EYRT           EI++   T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3213 DQFGNQLLNSHH--YAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQ 3040
             +  NQ   +        DIE   Q +  A    E A   R  +L Q    QL Y+  ++
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVA--LRDELLRQEKLEQLNYKFEKK 404

Query: 3039 ADTWMSAREAFLAQ-----EDPSG-DNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLI 2878
            +      RE +L +      DP     V++ +KKHE     I  + E+   L   AE L
Sbjct: 405  S----VLREGYLKEMIQVLSDPRYLRQVDATLKKHEAISADILARVERFNDLTAMAEELD 460

Query: 2877 KNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KF 2701
            + N++    V R+  +++ +W  L E L  +R  L +   L    R+       + E +
Sbjct: 461  RENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQ 520

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            Q A E+       +++  Q     E +++   + +    +    L   +      A ++
Sbjct: 521  QFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQA--LPYKSSEHKDAALLAQ 578

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            RL  L + +  L++ +  +  RL+EA     FM    + E WL + + + ++    KDL
Sbjct: 579  RLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLR 638

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            +V +L +KH  LE +I + + + G+M+     L+     +  +I  R   +A+ +  ++
Sbjct: 639  AVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEA 698

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
            +   RR +L  A   +QF+ D ++ ESW+ EK  LV+S DYG D P  Q L ++HR +
Sbjct: 699  LVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQG 758

Query: 1980 ELASHEPQVSLVKLKGEELLRS 1915
            EL ++   +  +  + ++L+++
Sbjct: 759  ELNAYSGDILNLNQQADKLIKA 780



 Score = 95.9 bits (237), Expect = 1e-17
 Identities = 92/499 (18%), Positives = 195/499 (38%), Gaps = 17/499 (3%)
 Frame = -1

Query: 6753 ILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF--------LKELGNHQYRINEINQAA 6598
            +L WIR+K   +   D+   LE ++     F ++         KE    +     IN
Sbjct: 288  LLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLL 347

Query: 6597 DKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR----KEGLFGAHQVQRFNRDADETL 6430
              L +  ++  D   +  +D+  AW  L      R    ++ L    ++++ N   ++
Sbjct: 348  KALNQPPYNPQDG--QLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKS 405

Query: 6429 A----WIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAET 6262
                 ++ E    LS   Y   L  V A  +KHE    D+ A   +   L   A +L
Sbjct: 406  VLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRE 462

Query: 6261 HPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVI 6082
            +    E + ++  +  A W  L E  ++++  L +   L   L +       + +++
Sbjct: 463  NYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQF 522

Query: 6081 GADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEK 5902
             ++++   + G E LL++H   + +++   ++  +              ++  + ++L
Sbjct: 523  ASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLAD 582

Query: 5901 LDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEH 5722
            L+   S LL     RR   E+  +   F  D +  E+W+  ++           L +V
Sbjct: 583  LEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLS 642

Query: 5721 LIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXX 5542
            L +KH+  E  + +++ K   +     +LI  QH  + ++
Sbjct: 643  LQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVEL 702

Query: 5541 RGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA 5365
            R   L+++ +   F  D +E  SW+ EK++      Y  D  + +  LQ+H + + EL A
Sbjct: 703  RRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762

Query: 5364 NENRLDDIRSTGEQIIDSG 5308
                + ++    +++I +G
Sbjct: 763  YSGDILNLNQQADKLIKAG 781



 Score = 38.9 bits (89), Expect = 1.9
 Identities = 57/242 (23%), Positives = 94/242 (38%), Gaps = 16/242 (6%)
 Frame = -1

Query: 1092 SWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQ--------RSLSSAEEDFRQLQDLDRR 937
            SW      +L      NSLE I+    A  E++        +  S  E  +  +  L
Sbjct: 290  SWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL--- 346

Query: 936  IKSFNVGP-NPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +K+ N  P NP     ++ +E  W+ L+     RE  L  E  RQE+ ++L  +F K +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 759  AFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKAN-KGQLRQIEEKGAM---LERNLI 592
                +L    Q + +       Q+DA  +K + I A+   ++ +  +  AM   L+R
Sbjct: 407  LREGYLKEMIQVLSDP--RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENY 464

Query: 591  LDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARN---QSGVSEEALREFSMMFKH 421
                        +   W QL +L    + NL Q     N   +   + EA+RE    F
Sbjct: 465  HGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFAS 524

Query: 420  FD 415
             D
Sbjct: 525  ED 526


>gi|24656802|ref|NP_523900.1| CG12008-PA [Drosophila melanogaster]
 gi|7292359|gb|AAF47766.1| CG12008-PA [Drosophila melanogaster]
          Length = 4097

 Score =  756 bits (1952), Expect = 0.0
 Identities = 577/2347 (24%), Positives = 1044/2347 (43%), Gaps = 92/2347 (3%)
 Frame = -1

Query: 7128 KRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEA-------F 6970
            K+  L +    Q F R+AD+++        T   E F + +NL A + + EA       F
Sbjct: 1283 KQKWLLQCVDLQMFNREADKIDA------TTKSHEAFLEYNNLGASLDEVEAILKRHLDF 1336

Query: 6969 EAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQA 6790
            E  + A  K +       + +I ++H+ S++I  R  ++             +   LQ +
Sbjct: 1337 EKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQAS 1396

Query: 6789 LKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEI 6610
                 F  + D++  W+++K T +  ++   DL ++    +K   F +EL  ++ ++  +
Sbjct: 1397 KDFHKFAAEADDLKVWLQDK-TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNV 1455

Query: 6609 NQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETL 6430
             +    LV+ G+    ++  +  D+N  W  L TL+  +   L  A   +  NR  ++
Sbjct: 1456 TKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAK 1514

Query: 6429 AWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDR 6250
              + E D AL S D G DL + + L  K +  E ++   + K+ +L      +A
Sbjct: 1515 KKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFN 1574

Query: 6249 AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADE 6070
            A+ I     + +  +  L++  Q R+  LE S   H+F+ +      WI +      ++E
Sbjct: 1575 AQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNE 1634

Query: 6069 LAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHE 5890
            L +++  A++L + H++ + EI       N+   AGQ L+    PE  +V+   ++L+
Sbjct: 1635 LGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQA 1694

Query: 5889 KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKK 5710
               L     ER    +  +  Q +  D  + E+W+ ++   L +T+ G   DS   L+ K
Sbjct: 1695 WQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTK 1754

Query: 5709 HEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNA 5530
            H+  E  L      +  +      ++   H  +  +A                   R
Sbjct: 1755 HKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGR 1814

Query: 5529 LKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKANENR 5353
            L ES  +  +  + DE+  WI E+   A  + Y  D  +++    K  + +  ++   +R
Sbjct: 1815 LMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADR 1874

Query: 5352 LDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNI 5173
            +D      +++IDS    A+ +  R  Q+   W  L+   N++  KL  AG   +F+R++
Sbjct: 1875 VDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDV 1934

Query: 5172 EDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEE 4993
             +    + + +    S++ G+DL S   L +K    E+D  A   ++  + + + + Q +
Sbjct: 1935 AEALFRIQD-KNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAK 1993

Query: 4992 EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVA 4813
               NA  I ++Q+ +   +N L++    R  +L  S        D+ D ++W
Sbjct: 1994 YPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAAL 2053

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQ 4633
             +     D  G   L  +  A+  EI   + +   ++  ++ M+Q GH+ A ++ +K A
Sbjct: 2054 QAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAA 2113

Query: 4632 LRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEA 4453
            + D  + L +   K++  L+  +    +L DA + D   S ++  + S+D+G+  +  +
Sbjct: 2114 MLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQN 2173

Query: 4452 LLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPM-------------------- 4345
             ++KH    R + +  E      E  RK   Q  Y    +
Sbjct: 2174 KIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAV 2233

Query: 4344 -----------GQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQ 4198
                        +  RDC  A Y   EK  +     + D  +    +N D    ++   Q
Sbjct: 2234 RRYKLEDALLYAKFVRDCAEAKYWINEKQKK----LEADAASYAEVTNLDEKIKKLQKHQ 2289

Query: 4197 GFVPAAYVKRIEPGTAQQHAQQQVNSIG----GKQSE-----------IEDKYQRLMMLG 4063
             F             A Q   Q++   G     KQ E           + + +Q L+
Sbjct: 2290 AFQAEV--------AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAEL 2341

Query: 4062 ETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDL 3883
            E R R LEEA    +   + + +  WI+ +E +    + G DLE    L +K DD   D+
Sbjct: 2342 EQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDM 2401

Query: 3882 KANEVRLQEMNQIATALTSVGQTETAVR-IRQQIEDLNARWRALXXXXXXXXXQLGSAHE 3706
            + ++ R++ +NQ+A  L +  Q     + + ++ +D N  WR L          LG A+E
Sbjct: 2402 RVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANE 2461

Query: 3705 VQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDE 3526
            +  F+RDVD+T D I EK  A+ S D GRDL +V+AL R+ E +ERD++A+  KI   +
Sbjct: 2462 IHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHET 2521

Query: 3525 KANRLRQSHPE-AAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
             A  L + +PE  A+ I     EL++ W  L + +  R+  L ++Y   +F+SD ++L
Sbjct: 2522 AAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELEL 2581

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAA 3169
            W+  M + +++ +  + +   E  LE HQE + EI+ R   F    Q G QL
Sbjct: 2582 WVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQ 2641

Query: 3168 GD-IENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQED 2992
             D +   L  + E  + L +AW  R   L +  +LQLF    EQ + W++ +EAFL  +D
Sbjct: 2642 PDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDD 2701

Query: 2991 PSGDN---VESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILD 2821
              GD+   VE L+KKH++F+K ++   + +  L+ FA S+++    D+  +  K   IL
Sbjct: 2702 -LGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAYILR 2758

Query: 2820 RWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQK 2641
            R   L E   +++ +L +S  LQ+F R   EI+ W+ +K Q+A +ENYR+P+N+Q K QK
Sbjct: 2759 RKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQK 2818

Query: 2640 QQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKS 2461
              AF+AEL +NS R+ ++I  G  LI        E A   +L  L   W  L   +  K
Sbjct: 2819 HAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL--LEGDWLKLKGASQTKK 2876

Query: 2460 YRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ 2281
             +L++A    +F  +V +   W+ EVE+ L SEDYGKDLA+V NLLKKH  LEAD+  H
Sbjct: 2877 DKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHG 2936

Query: 2280 DRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFR 2101
            +   ++ ++ +   + + F   +I ER  +   RY+ + +    RR+ L  +L++ QF R
Sbjct: 2937 ELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLR 2996

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
            D +DE  W+ EK+L+  S D G  L  VQ L++KH  ++ EL S EP +  +  +G++++
Sbjct: 2997 DAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMI 3056

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNE 1741
            R   +     +Q++ + E L++   Q+RDL   R  RL ++   Q F  +  E +AWM E
Sbjct: 3057 R---DNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 1740 KQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIK 1561
            K+ +L S ++G +   VQG  KK +  Q +L   K  +  +      LI   +  + +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 1560 QRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
            ++  Q+     ++  +A+ R ++L +     +++ + + +  W+ ++     SED+G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
              V+ L+   E+F + LNA E   ++   E  D+L+   +    +I+ +     Q W+ L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEAR-VEACLERGDRLIQENNPYRSSIKSKRDETKQLWEEL 3292

Query: 1200 L----AHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLE 1033
                 A  +A               E + L   K AS  +   E+  +D         LE
Sbjct: 3293 KDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLIS---EDYGQD---------LE 3340

Query: 1032 EIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQR 853
             I+AL   H  F+  L   +     +     ++         +     D   + W +L+
Sbjct: 3341 SIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKE 3400

Query: 852  IIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVER 673
                R+ +L++  Q Q   D+ R   A + N   A +T        AG  L   L + +
Sbjct: 3401 KTAARKNKLSQAEQLQSYFDEYRDLIAWI-NEMLAKITAPELANSVAGAEL--LLASTKD 3457

Query: 672  KAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHST---VGIAQAWDQL---------- 532
               EI+       +    G    + LI +  +  H     + + QA  +L
Sbjct: 3458 HDTEIRTRDETFAKFAANG----QQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRRE 3513

Query: 531  -------DQLAMRMQHNLEQQIQAR----NQSGVSEEALREFSMMFKHFDKEKTGRLDHQ 385
                    QL ++    LEQ I +R      + + +   +   ++ +H D EKT     +
Sbjct: 3514 IYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEE 3573

Query: 384  QFKSCLR 364
            +F++  R
Sbjct: 3574 KFQAIKR 3580



 Score =  755 bits (1949), Expect = 0.0
 Identities = 547/2178 (25%), Positives = 1007/2178 (46%), Gaps = 67/2178 (3%)
 Frame = -1

Query: 6924 KTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILY 6745
            +T    I  N   ++ ++KR + ++  +         +   L+ ++ L  F R+CD+
Sbjct: 936  RTSTQSINEN---ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 6744 WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH 6565
            W++EKE  + +++     E V+  +RKF+ F+ +L     R+ EI+ A D    +GHS+
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQL 1048

Query: 6564 DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY 6385
            D+I  ++  ++  W RLN   A R++ L GA  V+ FNR  DE   W+ EK L L +
Sbjct: 1049 DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVI 1108

Query: 6384 GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW 6205
              DL  VQALQR+H+  ER+LA +E K+ ++    + +   +P   + ++ +  + +  W
Sbjct: 1109 TPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMW 1168

Query: 6204 NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH 6025
              ++++    ++ +E       F    + L++WI  +K  + ADE A+DV  A  LL+ H
Sbjct: 1169 QQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKH 1228

Query: 6024 QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY 5845
             +   +I A    F +    G++L + G P   E    +E+L  E+ ++   W E++
Sbjct: 1229 NDLGDDIRAHDTEFVEVIQLGKQLSD-GKPNMAETVAVIERLKAEQDAIHRGWAEKQKWL 1287

Query: 5844 EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI 5665
             QC+DLQ+F R+ ++ +      EAFL   +LG SLD VE ++K+H DFEKSL AQ++ +
Sbjct: 1288 LQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKIL 1347

Query: 5664 NALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCD 5485
                + A KLI   HY +  + +                  R   L+ S     F  + D
Sbjct: 1348 KGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEAD 1407

Query: 5484 EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH 5305
            ++  W+ +K   A D++Y D +N+  KLQKH  FE+EL+ANE +L ++   G+ ++ +G+
Sbjct: 1408 DLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN 1467

Query: 5304 FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS 5125
               + +  R+  +N  W +L+  +  KG KL +A ++++ NR++ED +  + EL+  + S
Sbjct: 1468 RVPE-VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRS 1526

Query: 5124 EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ 4945
             D G DL S ++L  K  ++ES+    + +V  +           HFNA  I    + LQ
Sbjct: 1527 GDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQ 1586

Query: 4944 QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI 4765
            QR+  LRDP ++R+ KL ES   ++   +++ E  WI E    A S   G++L   Q+L
Sbjct: 1587 QRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLH 1646

Query: 4764 KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR 4585
            KK + L AEI  H   I     A   +I Q H    ++     QL   W+ L+    +R
Sbjct: 1647 KKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERS 1706

Query: 4584 TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK 4405
              LD SL+A QYL DA E ++W+ E+  ++ ST+YG+D DSA  LL KH+ +  +L+ +
Sbjct: 1707 RKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYS 1766

Query: 4404 GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLT-------LL 4246
            G + ++    +       P  ++       +    +   +  S ++G ++         L
Sbjct: 1767 GIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFL 1826

Query: 4245 NASNRDWWKVEVNDR-------QGFVPAAYVK--------RIEPGT-----AQQHAQQQV 4126
             +   + W  E           Q F     ++        R+E G       +  A++ +
Sbjct: 1827 ESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLI 1886

Query: 4125 NS-------IGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREA 3967
            +S       +  +Q ++   ++ L+ L   R++KL  A + ++  R+  +    I+ + A
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNA 1946

Query: 3966 VAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQ 3787
             A  QE+G DL     L +K + F+ DL A E +LQ + + +  L        A  I QQ
Sbjct: 1947 -ALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRL-QAKYPSNASAIAQQ 2004

Query: 3786 IEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRS 3607
             + + A W  L         +L ++ ++Q F  DV +   W      AL +E+   D
Sbjct: 2005 QDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAG 2064

Query: 3606 VQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSK 3427
              AL+ +H+ +  ++ A  DK + L+E ++ + Q+   AA  + +    + ++  +L +
Sbjct: 2065 ATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAA 2124

Query: 3426 ANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTE 3247
             N +K  L    D   FL D + +    +S    +SS +    V   +  + +H E+
Sbjct: 2125 WNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERL 2184

Query: 3246 IDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLEL 3067
            I ++        + G +L+   HY + +I+  LQGV   R+ ++D    RR  L+  L
Sbjct: 2185 IQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLY 2244

Query: 3066 QLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL------IKKHEDFDKAINTQEEKIKG 2905
              F RDC +A  W++ ++  L  +  S   V +L      ++KH+ F   +   + +I+
Sbjct: 2245 AKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQE 2304

Query: 2904 LKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEI 2725
            ++     L+   H  SP + R  + +L+ W GL   L Q+   L E+Q   +F+   D+I
Sbjct: 2305 IQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKI 2364

Query: 2724 ENWMTEKFQIAQ-EENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKC 2548
            E W+ +K  + Q  +  RD  +     +K    ++++  +  R+  I Q  + LI  A+
Sbjct: 2365 EAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQV 2424

Query: 2547 GGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQ 2368
                 +V  R K  N  W  L          L  AN+   F   V D    + E  + +
Sbjct: 2425 PADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMS 2484

Query: 2367 SEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERR-KL 2191
            S D G+DLA+VE L+++   LE D+ A + ++ +    A+ L++    +G Q  ER+ +
Sbjct: 2485 STDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEE 2544

Query: 2190 IADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQN 2011
            +   +  ++ ++  R+  L++A   H+F  D+ + E W+ +    +++      +   +
Sbjct: 2545 LHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCET 2604

Query: 2010 LRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDL 1831
                H+    E+   +   + +K +GE+L +   +     D ++K +  LE+    + +
Sbjct: 2605 QLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQ--QPDNVRKYLLVLEELHQTLNEA 2662

Query: 1830 TGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVD 1651
               R + L E+   Q F   VE+ E W+  K+  L +D+ G++   V+ LLKKHD F  +
Sbjct: 2663 WSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEF--E 2720

Query: 1650 LELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAY 1471
              LH   V  L    ++++      A  I+++   +  R  ++  ++E R  +L  +
Sbjct: 2721 KLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1470 LQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE 1291
             +F+     ++ W+ +K Q    E++ R+ S++Q  + K  AFDA L +     +Q +
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAELLS-NSPRVQSVIH 2838

Query: 1290 LKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELY--LAF 1117
              ++L+  +H     I ++   +   W  L   S+ ++           ++++ Y  LAF
Sbjct: 2839 EGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKK----------DKLQQAYDALAF 2888

Query: 1116 AKKASTFNSWFENAEEDLT------DPVRCNSL----EEIRALRDAHGEFQRSLSSAEED 967
             +    FN+W +  E  L+      D    ++L    E + A    HGE    L   +E
Sbjct: 2889 NRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQ 2948

Query: 966  FRQLQDLDRR---------IKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQEL--AR 820
            F Q +   R          I+ +N    P      + LED+  +LQ+ +++ E EL
Sbjct: 2949 FFQAEHFLRHEIHERATVSIRRYNTLHEP-LGIRRENLEDS-LSLQQFLRDAEDELQWLA 3006

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQL--DAVERKAKEIKANK 646
            E Q    +  L      +           +   +EA  T +E L    ++R  + I+ N
Sbjct: 3007 EKQLVAGSQDLGTSLLSVQG------LQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNH 3060

Query: 645  GQLRQIEEKGAMLERNLI 592
                Q++ K  +L++ L+
Sbjct: 3061 FASEQLQYKSELLQKQLV 3078



 Score =  637 bits (1643), Expect = e-180
 Identities = 404/1525 (26%), Positives = 749/1525 (48%), Gaps = 100/1525 (6%)
 Frame = -1

Query: 5472 WITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAAD 5293
            ++ E +    D  YL    +   L+KH     ++ A   R +D+ +  E++    +   +
Sbjct: 411  YLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKE 468

Query: 5292 HIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYG 5113
             +  R ++V   W +L++    +   L +  N     R I      + EL+ Q ASED G
Sbjct: 469  RVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVG 528

Query: 5112 KDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYN 4933
              L+ V+ L +   L E   N + + +    + A  ++  EH +A ++ ++  +L++ Y+
Sbjct: 529  PHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYS 588

Query: 4932 ALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQ 4753
             L      R+ +L E+   +    D ++E +W+ +K+++  +    +DL  V +L +K +
Sbjct: 589  ELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHK 648

Query: 4752 ALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLD 4573
            AL  EI +   +   +S+A   +I + H  + EI+ ++  L ++W+ L++  E RR  L+
Sbjct: 649  ALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLE 708

Query: 4572 DSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIE 4393
            D+ +A+Q+ +DANEA++W++EK  +V S DYG DE SA+ALL++HR L  +L A+ G I
Sbjct: 709  DAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDIL 768

Query: 4392 DLRKQ------ASQCKYQ----EQPMGQLGRD---------------------------- 4327
            +L +Q      A  C  +    E  + ++ ++
Sbjct: 769  NLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVT 828

Query: 4326 ------CVLALYDYQEKSPREVSMKKGDVLTLLNASNRDWWKVEV-NDRQGFVPAAYVKR 4168
                   V +L+ ++ +    + M KG+V+ L + +N DWW V   N  +GFVPA YV+
Sbjct: 829  ETKMLPHVKSLFPFEGQG---MKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVRE 885

Query: 4167 IEPG-----------------------------------------------TAQQHAQQQ 4129
            +EP                                                T+ Q   +
Sbjct: 886  VEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINEN 945

Query: 4128 VNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQE 3949
             +S+  +Q  I   Y  L  + + R   LE++   +   RE +D  +W+K +E +    E
Sbjct: 946  ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDE 1005

Query: 3948 IGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNA 3769
                 E V+  ++KF+ F  DL A   R++E++         G ++    I +Q   ++
Sbjct: 1006 G----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQ-RQIHQ 1060

Query: 3768 RWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQR 3589
             W+ L          L  A  V+ F+R  DE + W+ EK   LD+     DLR+VQALQR
Sbjct: 1061 IWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQR 1120

Query: 3588 KHEGVERDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKE 3409
            +H+ +ER+LA + DK+  +    N ++ ++P   + +   Q+E+ + W ++  + ++ +
Sbjct: 1121 RHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRN 1180

Query: 3408 KLLDSYDYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAA 3229
            ++      Q F +  + L+ WI S+   +++ E A DV  A  LL++H +   +I +
Sbjct: 1181 RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDT 1240

Query: 3228 TFQAFDQFGNQLLNSHHYAAGDIE--NRLQGVNEARKGLEDAWVARRNILDQCLELQLFY 3055
             F    Q G QL +     A  +    RL+   +A   +   W  ++  L QC++LQ+F
Sbjct: 1241 EFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDA---IHRGWAEKQKWLLQCVDLQMFN 1297

Query: 3054 RDCEQADTWMSAREAFLAQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESL 2881
            R+ ++ D    + EAFL   +   S D VE+++K+H DF+K++  Q++ +KG    A+ L
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 2880 IKNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKF 2701
            I N+HYDS  +  +R+Q+L +   +K+   +++  L  S+   +F+ +AD+++ W+ +K
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            +IA +ENYRD +N+ +K QK QAFE EL AN  ++  + + G  L++    G     V +
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQ---AGNRVPEVES 1474

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            R+  LN +W  L+  + +K  +L++A  Q+    +++D +  + E++  L+S D G DL
Sbjct: 1475 RVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLR 1534

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            S ++L+ K  +LE++I     +V E+    D +     F  Q I    K +  R+  ++
Sbjct: 1535 SCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRD 1594

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
                RR KL ++LN H+F  ++D E  WI E      S++ G++L   Q+L +KH++++
Sbjct: 1595 PTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEA 1654

Query: 1980 ELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDE 1801
            E+  H+P ++   + G+ L+   ++     +Q++   + LEQ+W  +    G R ++LD
Sbjct: 1655 EIKGHQPMINKALVAGQSLI---SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDM 1711

Query: 1800 SEAFQAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVAD 1621
            S   Q +L D  E E+W+ E+  +L S  +G +      LL KH T +++L+ +   V +
Sbjct: 1712 SLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTE 1771

Query: 1620 LINKGDTLIHNGNHHAPHIKQRCDQLRARLIE-IESMAEGRLAKLRDNSAYLQFMWKCDV 1444
            + +    ++   NH    +     QL  ++++ +  +A  R  +L ++    ++  + D
Sbjct: 1772 MGHSCAAMV-AANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDE 1830

Query: 1443 VESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITE---LKDQLV 1273
            VE WI E+EQ   SED+G+D   +Q+L   Q  FD  L      G  R+ +   L  +L+
Sbjct: 1831 VEQWIREQEQAASSEDYGQDFEHLQLL---QNKFD-DLKHRVEVGADRVDQCELLAKKLI 1886

Query: 1272 SSEHQQSPAIEKRHTNVIQRWQNLL 1198
             SE   +  +EKR   +   W+NLL
Sbjct: 1887 DSESPYANEVEKRQEQLRTSWENLL 1911



 Score =  610 bits (1573), Expect = e-172
 Identities = 410/1364 (30%), Positives = 666/1364 (48%), Gaps = 44/1364 (3%)
 Frame = -1

Query: 7176 QEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEE--NFRDPSN 7003
            Q VL      KD    +R +LE+A  +  F RD  E   WI EK +  + +  ++ + +N
Sbjct: 2218 QGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTN 2277

Query: 7002 LQAKI---QKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
            L  KI   QKH+AF+AEV A+   I  +  TG  ++   H +S  IK+ +E +   W
Sbjct: 2278 LDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGL 2337

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  +G  L++A   L F  Q D+I  WIR+KE  V A D G DLEH   L RK DD
Sbjct: 2338 LAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDV 2397

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHD--QIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
              ++     R+  INQ ADKL+ +     D   + K+R D N  W +L       +  L
Sbjct: 2398 DSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLG 2457

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKML 6298
            GA+++  FNRD D+T   I EK LA+SS D GRDL  V+AL R+ E  ERD++A++ K+
Sbjct: 2458 GANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517

Query: 6297 QLEKEAHKLAETHPDR-AEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
            Q E  A  L + +P+R A+ I +K ++   +W  L+  +  R+  L  ++  H+F++D +
Sbjct: 2518 QHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVK 2577

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +L  W+ DM   +   +    +   E  LE HQE K EI+ R ++F      G++L +
Sbjct: 2578 ELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRP 2637

Query: 5940 IPESPE-VQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              + P+ V++ L  L+    +L   W ER     +   LQLF    EQ E W+  +EAFL
Sbjct: 2638 QQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFL 2697

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
             N DLGDS  +VE L+KKH++FEK L A  + ++ L +FA  +++G+   AD + E
Sbjct: 2698 NNDDLGDSYTAVERLLKKHDEFEKLLHA--DHVDTLQKFANSILEGEPKDADLIREKLAY 2755

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L +S++ Q F R   E+  W+ +KL  A D++Y +P+N++ K
Sbjct: 2756 ILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSK 2815

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            +QKH  F+ EL +N  R+  +   GE++I   HFA D I  +++ +   W +L  A+  K
Sbjct: 2816 IQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTK 2875

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL++A +   FNR++++   W+ E+E Q++SEDYGKDL +V NL KK   +E+D   H
Sbjct: 2876 KDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHH 2935

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             +  D +KQ  +QF + EHF    I  +     +RYN L +PL  R+  L +S    Q
Sbjct: 2936 GELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFL 2995

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD EDEL W+ EK+ VAGS + G  L+ VQ L KK  +L AE+ + +  I+++      M
Sbjct: 2996 RDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQM 3055

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+  HF + +++ K   L+     L+  A  RR  L D++++  +  +ANEADAWM EK
Sbjct: 3056 IRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKR 3115

Query: 4503 PIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQAS--------QCKYQEQP 4348
            P++ S+DYG+DE S +   KK   L  +L AFK +IE + K A+              +
Sbjct: 3116 PVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEK 3175

Query: 4347 MGQLGRDCVLALYDYQEKSPREVSMKK---------------GDVLTLLNASNRDWWKVE 4213
              Q+G++    L   +E+  R    KK               GD +  + AS      VE
Sbjct: 3176 NAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMA-VTASEDYGEDVE 3234

Query: 4212 VNDRQGFVPAAYVKRIEPGTAQ------------QHAQQQVNSIGGKQSEIEDKYQRLMM 4069
              ++      ++V  +    A+            Q      +SI  K+ E +  ++ L
Sbjct: 3235 HVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKD 3294

Query: 4068 LGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKG 3889
            L   R+  L  A + +   R A++  + I  ++A    ++ G DLE ++ L +K   F+
Sbjct: 3295 LVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFES 3354

Query: 3888 DLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAH 3709
            +L   + ++  +   A  L  +   +    I  + ++    W  L         +L  A
Sbjct: 3355 ELVGIQGQVDSVLAEAAKLGEI-YPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 3708 EVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLD 3529
            ++Q +  +  +   WI E    + + +    +   + L    +  + ++    +
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 3528 EKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQ 3349
                +L +     A ++ D  + L  +   L    N R+E    + D Q FL D   L Q
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQA 3217
            WI+S    +   +L + +   E LL RH+++   + ++   FQA
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQA 3577



 Score =  544 bits (1401), Expect = e-152
 Identities = 479/2308 (20%), Positives = 974/2308 (41%), Gaps = 62/2308 (2%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRD 7012
            I  RR +VLG     KD +  ++  L+ ++ F  F  +AD+L VW+ +K + A +EN+RD
Sbjct: 1368 IGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRD 1427

Query: 7011 PSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXX 6832
             SNL  K+QKH+AFE E++A+   + N+ K G A++Q  +   E ++ R+ +L+  W
Sbjct: 1428 LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE-VESRVADLNKRWKDL 1486

Query: 6831 XXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF 6652
                  KG KL+QA       R  ++    + E ++ + + D+G DL   + L  K
Sbjct: 1487 LTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQIL 1546

Query: 6651 LKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGA 6472
              E+     ++ E+    D +   GH     I     ++   +  L      R+  L  +
Sbjct: 1547 ESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEES 1606

Query: 6471 HQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
                +F  + D    WI E   A  S++ G++L+  Q+L +KH+  E   A ++G    +
Sbjct: 1607 LNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLE---AEIKGHQPMI 1663

Query: 6291 EKEA----HKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY 6124
             K        +++ HP+R E +       + AW  L+     R   L+ S +  ++L D
Sbjct: 1664 NKALVAGQSLISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDA 1722

Query: 6123 RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEM 5944
             ++ SW+G+   V+ + E  +D   A  LL  H+  + E+D  +    +   +   +V
Sbjct: 1723 GEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAA 1782

Query: 5943 GIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFL 5764
              P+S  +  K + ++    SL  L  +R+    + +    ++ ++++ E W+ +QE
Sbjct: 1783 NHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAA 1842

Query: 5763 ANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXX 5584
            ++ D G   + ++ L  K +D +  +    ++++  +  A KLI  +   A++V +
Sbjct: 1843 SSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQ 1902

Query: 5583 XXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGK 5404
                          R   L  + +   F RD  E +  I +K +    +   D  +
Sbjct: 1903 LRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALAL 1962

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            L+KH  FE +L A E +L  +     ++       A  I  +  +V   WN+L + +  +
Sbjct: 1963 LRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTAR 2022

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
            G +L  + + Q F  ++ D+ +W S L   + +E++  D      L+ +   I  +  A
Sbjct: 2023 GDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAR 2082

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
             D+   + +L+    +  H+ A  +  K   +      L     K+K  L +
Sbjct: 2083 EDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFL 2142

Query: 4863 RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDM 4684
            RD +        ++    S++ G+ +  VQN I+K       I   + ++  +      +
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKL 2202

Query: 4683 IQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKE 4504
            I+Q H+ +  I+  L  +    + +K     RR  L+D+L   +++ D  EA  W++EK+
Sbjct: 2203 IEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQ 2262

Query: 4503 PIV--GSTDYGKDEDSAEAL--LKKHRALLSDLEAFKGTIEDLRKQ-ASQCKYQEQPMGQ 4339
              +   +  Y +  +  E +  L+KH+A  +++ A +G I++++         Q +   +
Sbjct: 2263 KKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPE 2322

Query: 4338 LGRDCVLALYDYQ----EKSPREVSMKKGDVLTLLNASNRDWWKVEVNDRQGFVPA---- 4183
            + R   + L  +Q    E   R   +++       N S  D  +  + D++  V A
Sbjct: 2323 IKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFN-SQLDKIEAWIRDKEMMVQASDTG 2381

Query: 4182 -------AYVKRIEPGTAQQHAQQQ----VNSIGGKQSEIEDKYQRLMMLGETRK----- 4051
                   A +++++   +      Q    +N +  K             + + RK
Sbjct: 2382 RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYN 2441

Query: 4050 -RKLEEACKGYQLL-----------REANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKK 3907
             R+L+ A   Y+ L           R+ +D A+ I  +    +  + G DL  VE L ++
Sbjct: 2442 WRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRR 2501

Query: 3906 FDDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXX 3727
             +  + D+ A + ++ +    A  L        A  I +++E+L+  W  L
Sbjct: 2502 EEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQS 2561

Query: 3726 QLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGD 3547
             L  A+   +F  DV E   W+ +    +++      +   +     H+  + ++    +
Sbjct: 2562 ILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQE 2621

Query: 3546 KIKSLDEKANRL----RQSHPEAAEQ----IYDLQRELNEQWNRLTSKANNRKEKLLDSY 3391
                L ++  +L    +Q  P+   +    + +L + LNE W       + R   L +++
Sbjct: 2622 AFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-------SERARDLTEAH 2674

Query: 3390 DYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFD 3211
              Q F +    +  W+A+    +++ +L +  T  E LL++H E+   +   A
Sbjct: 2675 QLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQ 2732

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
            +F N +L      A  I  +L  +   ++ L +    R+  L Q  +LQ F R   + D
Sbjct: 2733 KFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDR 2792

Query: 3030 WMSAR-EAFLAQEDPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSP 2854
            W+  + +  L +      N++S I+KH  FD  + +   +++ +    E LI+ +H+
Sbjct: 2793 WLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD 2852

Query: 2853 AVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENY 2677
             + ++   +   W  LK A   K+ KL ++     F+R  DE  NWM E + Q++ E+
Sbjct: 2853 EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYG 2912

Query: 2676 RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQ 2497
            +D   +    +K +  EA++  + +    + Q      +       E  +  R      +
Sbjct: 2913 KDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHE--IHERATVSIRR 2970

Query: 2496 WDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKK 2317
            ++ L +    +   L+++   + F+   +D   WL E +++  S+D G  L SV+ L KK
Sbjct: 2971 YNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKK 3030

Query: 2316 HSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDK 2137
            H+ LEA++ + +  +  + ++   ++ ++ F  +Q+  + +L+  +   ++ +A  RR +
Sbjct: 3031 HNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLR 3090

Query: 2136 LSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQ 1957
            L  A+    F+ + ++ ++W++EK+ ++SS DYGRD   VQ  ++K   +  EL + +P
Sbjct: 3091 LLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPS 3150

Query: 1956 VSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFL 1777
            +  V      L+            I ++   + Q +  +  L   R  RL E +    +L
Sbjct: 3151 IEKVAKLATGLIE---RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYL 3207

Query: 1776 GDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTL 1597
             + EE   W+ ++  +  S+++GE++  V+ L+   ++F  +L  ++ RV   + +GD L
Sbjct: 3208 RETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRL 3267

Query: 1596 IHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKE 1417
            I   N +   IK + D+ +    E++ +   R   L        +    D     I EK+
Sbjct: 3268 IQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD 3327

Query: 1416 QQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEK 1237
              + SED+G+DL S+Q L  K + F++ L   + + +  +     +L          IE
Sbjct: 3328 ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ-VDSVLAEAAKLGEIYPDAKEHIEV 3386

Query: 1236 RHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTD 1057
            +    ++ W +L   + AR+             +E     A        W       +T
Sbjct: 3387 KRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIA--------WINEMLAKITA 3438

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALE 877
            P   NS+     L  +  +    + + +E F +     +++            F    +E
Sbjct: 3439 PELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIK-------EKHFLAHEVE 3491

Query: 876  DTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEA--GGT 703
            D  + LQ   +  +  L +  +  E N   +  F K A     W+++   ++ +   G +
Sbjct: 3492 DKIKVLQARHELLKHTLNKRREIYELNLDTQL-FLKDAEILEQWISSREPQLKDTKLGDS 3550

Query: 702  LEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRY---TEHSTVGIAQAWDQL 532
            + +  D + R     K    Q    EEK   ++R  +L+  +    E   +   Q  ++L
Sbjct: 3551 IPQVEDLLRRHEDFEKTVAAQ----EEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERL 3606

Query: 531  --DQLAMRMQHNLEQQIQARNQSGVSEE 454
              ++L    Q  L++    R ++    E
Sbjct: 3607 EKERLEQLKQRELQRLADERRRAEKQHE 3634



 Score =  511 bits (1316), Expect = e-142
 Identities = 471/2295 (20%), Positives = 948/2295 (40%), Gaps = 57/2295 (2%)
 Frame = -1

Query: 7212 ILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTA 7033
            I E AD + +R+Q +   Y   ++ +Q +   LE++     F R+ D+   W+ EK +
Sbjct: 942  INENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMI 1001

Query: 7032 QEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEEL 6853
            + +      N + K +K   F  ++ A +K +  +D   +   +  H   + I  R  ++
Sbjct: 1002 KSDEGEGVDNAKRKFEK---FITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQI 1058

Query: 6852 HALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEIL 6673
            H +W         +   L+ A  +  F R CDE   W+ EK   +    +  DL  V+ L
Sbjct: 1059 HQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQAL 1118

Query: 6672 QRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR 6493
            QR+  +  +EL   + ++N +    + +     +E D +  ++ +V D W ++    +
Sbjct: 1119 QRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDL 1178

Query: 6492 KEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAAL 6313
            +  +      Q FN  A   LAWI      L++D+  RD+     L +KH     D+ A
Sbjct: 1179 RNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAH 1238

Query: 6312 EGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + + +++ +   +L++  P+ AE +    +  KA  +A+      ++  L +   L  F
Sbjct: 1239 DTEFVEVIQLGKQLSDGKPNMAETV-AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFN 1297

Query: 6132 ADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKL 5953
             +   + +     +A +  + L   +   EA+L+ H + +  + A+       +    KL
Sbjct: 1298 READKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKL 1357

Query: 5952 VEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQE 5773
            +     +S  + ++  ++  ++ ++     ER+ L +   D   F  + +  + W+  +
Sbjct: 1358 ISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKT 1417

Query: 5772 AFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEX 5593
                + +  D L ++   ++KH+ FE+ L A E ++  + +    L+Q  +    +V
Sbjct: 1418 RIAGDENYRD-LSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESR 1475

Query: 5592 XXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARD-DSYLDPTN 5416
                             +G  L+++  ++  +R  ++    + E  S  R  D   D  +
Sbjct: 1476 VADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRS 1535

Query: 5415 IRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDA 5236
             +  + K    E E+   + ++ ++ STG+ +   GHF A +I    +++   + +L D
Sbjct: 1536 CKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDP 1595

Query: 5235 TNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESD 5056
            T ++ AKL E+ N  +F   ++    W++E      S + G++L   Q+L KK   +E++
Sbjct: 1596 TQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAE 1655

Query: 5055 FNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQG 4876
               H   ++      Q    ++H     +    + L+Q +  L     +R RKL  S +
Sbjct: 1656 IKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKA 1715

Query: 4875 NQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSA 4696
             Q   D  +  +W+ E+  V  ST  GRD      L+ K + +  E+  +   +  +  +
Sbjct: 1716 QQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHS 1775

Query: 4695 ANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWM 4516
               M+   H  +  +  K   +    + L   A +R+  L +SL  H+Y  +++E + W+
Sbjct: 1776 CAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWI 1835

Query: 4515 SEKEPIVGSTDYGKDEDSAEALLK-----KHRA----------------LLSDLEAFKGT 4399
             E+E    S DYG+D +  + L       KHR                 L+     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 4398 IEDLRKQ--------ASQCKYQEQPMGQLG------RDCVLALYDYQEKSPREVSMKKGD 4261
            +E  ++Q              +EQ +   G      RD   AL+  Q+K+   +S + G
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGR 1954

Query: 4260 VLTLLNASNRDWWKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQ 4081
             L    A  R     E ND         V   +    Q       ++I  +Q ++   +
Sbjct: 1955 DLNSALALLRKHEGFE-NDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWN 2013

Query: 4080 RLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFD 3901
             L      R  +L  +      L +  D+  W  +  A    +E  +D      L+ + D
Sbjct: 2014 DLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHD 2073

Query: 3900 DFKGDLKANEVRLQEMNQIATALTSVGQ------TETAVRIRQQIEDLNARWRALXXXXX 3739
               G+++A E + + +N+++ ++   G        E    +  + + L+A W
Sbjct: 2074 AIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWN------- 2126

Query: 3738 XXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLA 3559
                 L    ++  F RD  +  +    +  AL S DFG+ +  VQ   RKH+  ER +
Sbjct: 2127 KKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQ 2186

Query: 3558 ALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQR 3379
               +K+  L E   +L +     +  I  + + +  +  ++      R+ KL D+  Y +
Sbjct: 2187 TQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAK 2246

Query: 3378 FLSDYRDLMQWI-ASMNQLVSSQELANDVTGAE---ALLERHQEYRTEIDSRAATFQAFD 3211
            F+ D  +   WI     +L +      +VT  +     L++HQ ++ E+ +     Q
Sbjct: 2247 FVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
              G  LL+  H ++ +I+  ++ V EA +GL      R   L++  +   F    ++ +
Sbjct: 2307 DTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEA 2366

Query: 3030 WMSAREAFLAQEDPSGD--NVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHY-- 2863
            W+  +E  +   D   D  +  +L++K +D D  +   ++++K +   A+ LI
Sbjct: 2367 WIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA 2426

Query: 2862 DSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEK-FQIAQE 2686
            D+ +V ++R      W  L+ AL   R  LG +  +  F+RD D+  + + EK   ++
Sbjct: 2427 DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSST 2486

Query: 2685 ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKAL 2506
            +  RD   ++   ++++A E ++ A   +I     A   LI+     G +  +  +L+ L
Sbjct: 2487 DTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQ-HIERKLEEL 2545

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
            +  W  L   + ++   L EA     F++ VK+LE W+ ++   + +      +   E
Sbjct: 2546 HKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQ 2605

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADR-YDGVKKMATD 2149
            L+ H   + +I   Q+    + +Q + L +  Q Q      +  L+ +  +  + +  ++
Sbjct: 2606 LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSE 2665

Query: 2148 RRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELAS 1969
            R   L++A  +  F   ++  E W+  K+  +++DD G     V+ L +KH   +  L
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL-- 2723

Query: 1968 HEPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAF 1789
            H   V  ++     +L    +     D I++++  + +   ++ +L+  R QRL +S
Sbjct: 2724 HADHVDTLQKFANSILEGEPK---DADLIREKLAYILRRKQKLLELSEERKQRLTQSHQL 2780

Query: 1788 QAFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINK 1609
            Q FL  + E + W+ +K Q+   +N+ E  + +Q  ++KH  F  +L  +  RV  +I++
Sbjct: 2781 QEFLRSLYEIDRWLVQKLQVALDENYRE-PSNLQSKIQKHAAFDAELLSNSPRVQSVIHE 2839

Query: 1608 GDTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWI 1429
            G+ LI   +     I Q+   L    ++++  ++ +  KL+     L F    D   +W+
Sbjct: 2840 GERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM 2899

Query: 1428 AEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSP 1249
             E E Q+ SED+G+DL++V  LL K E  +A + A   E   ++ +  +Q   +EH
Sbjct: 2900 DEVELQLSSEDYGKDLAAVSNLLKKHERLEADV-AHHGELADQLKQKDEQFFQAEHFLRH 2958

Query: 1248 AIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEE 1069
             I +R T  I+R+  L      RR                   F + A     W    +
Sbjct: 2959 EIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQ--------QFLRDAEDELQWLAEKQL 3010

Query: 1068 DLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTM 889
                     SL  ++ L+  H   +  L+S E   + L    +++   N   +    +
Sbjct: 3011 VAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS 3070

Query: 888  DALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAG 709
            + L+     L+ +   R   L    + Q         F   AN   AW+   R  +  +
Sbjct: 3071 ELLQKQLVQLRDLAAIRRLRLLDAVESQ--------LFYVEANEADAWMREKRPVLSSSD 3122

Query: 708  -GTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTE----HSTVGIAQA 544
             G  E  +   ++K + ++      +   EK A L   LI  N +           + Q
Sbjct: 3123 YGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQE 3182

Query: 543  WDQLDQLAMRMQHNL 499
            ++ L +LA   +  L
Sbjct: 3183 YEDLLRLAKERESRL 3197



 Score =  503 bits (1294), Expect = e-140
 Identities = 491/2306 (21%), Positives = 986/2306 (42%), Gaps = 133/2306 (5%)
 Frame = -1

Query: 7119 RLEEARQFQY-FKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAK 6943
            R E+  Q  Y F++ +     ++ E +Q   +  +     + A ++KHEA  A++ A  +
Sbjct: 390  RQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYL--RQVDATLKKHEAISADILARVE 447

Query: 6942 TIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQ 6763
               +L      + + N+   E +++R +E+ A W         + + L Q   L++ +R+
Sbjct: 448  RFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLRE 507

Query: 6762 CDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQY--RINEINQAADKL 6589
                   +RE +    +ED+G  L  VE L +     L+EL  + Y   +   N+ A
Sbjct: 508  IASTTEAVRELQQQFASEDVGPHLLGVEELLQAHS--LQELQVNTYGETLKRFNRQALPY 565

Query: 6588 VEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKD 6409
                H +   + ++  D+ +A+  L   +A R+  L  A     F  D D   +W+ +K
Sbjct: 566  KSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQ 625

Query: 6408 LALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKL-AETHPDRAEAIHQ 6232
                +    +DL  V +LQ+KH+  E ++ + + K  Q+     +L  E HP R+  I
Sbjct: 626  RICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHP-RSSEIQS 684

Query: 6231 KNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVA 6052
            + D     W AL+   + R+  LE + + ++F  D  +  SW+ +  A++ + +   D
Sbjct: 685  RIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEP 744

Query: 6051 GAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGI---------PESPEVQEK---- 5911
             A+ALL+ H++ +GE++A +           KL++ GI         PE PEV+++
Sbjct: 745  SAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVN 804

Query: 5910 --------------LEKLDHEKSSLLGLWEERRILYE---QCMDLQ----LFYRDTEQAE 5794
                          +EKL+H+K +   +    + L+    Q M +     +  +     +
Sbjct: 805  ETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDD 864

Query: 5793 TWMNKQEAFLANTDLGDSLDSVE-----------HLIKKHEDFEKSLAAQE----EKINA 5659
             W  +++  +      + +  VE             +K  +  +K++  ++    ++I
Sbjct: 865  WWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKP 924

Query: 5658 LDEFATKLIQGQ------HYAADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFD 5497
            +      L+Q +      +  AD V +                  R   L++S     F
Sbjct: 925  VSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFY 984

Query: 5496 RDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQII 5317
            R+CD+   W+ EK    + D      N + K +K I    +L A   R+++I    +
Sbjct: 985  RECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFIT---DLSAASKRVEEIDGAVDTFR 1041

Query: 5316 DSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEG 5137
              GH   D I  R RQ++ +W  L +A  ++   L  A + + FNR  ++ + W+SE
Sbjct: 1042 RQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKML 1101

Query: 5136 QVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQ-----EEEHFNAPV 4972
            Q+ +     DL +VQ LQ++   +E +     D+V+ +  L    +     E+++ NA
Sbjct: 1102 QLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNA-- 1159

Query: 4971 IVRKQE------NLQQRYNALRDPLEKRKRKLGESHQGNQLFRD-IEDELAWIREKEQVA 4813
              R+QE       +QQR + LR+ +        ES  G Q+F +  +  LAWI   +
Sbjct: 1160 --RQQEVQDMWQQVQQRGSDLRNRI--------ESEVGQQVFNNSAKVLLAWIDSVKDQL 1209

Query: 4812 GSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLA---PEIRDK 4642
             +    RD+    NL+KK   L  +I  HD++   V       IQ G  L+   P + +
Sbjct: 1210 NADESARDVETANNLLKKHNDLGDDIRAHDTEFVEV-------IQLGKQLSDGKPNMAET 1262

Query: 4641 LAQLR----DNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGK 4474
            +A +     +   I +  AEK++  L   +    +  +A++ DA     E  +   + G
Sbjct: 1263 VAVIERLKAEQDAIHRGWAEKQKW-LLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGA 1321

Query: 4473 DEDSAEALLKKH----RALLSDLEAFKGTIEDLRKQASQCKYQEQPMGQLGRDCVL---- 4318
              D  EA+LK+H    ++L++  +  KG  ++  K  S   Y  + +G   R+ VL
Sbjct: 1322 SLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGD-RRNQVLGKRK 1380

Query: 4317 ALYDYQEKSPREVSMKKGDVLTLLNASNRDWW---KVEVNDRQGFVPAAYVKR------- 4168
            A+ D   +  R +   K        A +   W   K  +   + +   + + R
Sbjct: 1381 AVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQA 1440

Query: 4167 ---------------IEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
                            + G A   A  +V  +  + +++  +++ L+ L E + RKLE+A
Sbjct: 1441 FERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQA 1500

Query: 4032 CKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEM 3853
                +  R   D  + +   ++     ++G DL   + L  K    + ++   + ++ E+
Sbjct: 1501 ASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL 1560

Query: 3852 NQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDET 3673
                  +   G    A  I    ++L  R++ L         +L  +    +F  ++D
Sbjct: 1561 VSTGDDMAHGGHF-NAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSE 1619

Query: 3672 RDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKI-KSLDEKANRLRQSHP 3496
              WI E   A  S + G++L   Q+L +KH+ +E ++      I K+L    + + Q HP
Sbjct: 1620 FQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP 1679

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
            E  EQ+  L ++L + W  L      R  KL  S   Q++L D  ++  W+   N ++ S
Sbjct: 1680 E-REQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRS 1738

Query: 3315 QELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGVN 3136
             E   D   A  LL +H+    E+D+ +            ++ ++H  +  +  + Q +
Sbjct: 1739 TEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIE 1798

Query: 3135 EARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESLI 2962
            +  K L      R+  L + L    ++ + ++ + W+  +E   + ED   D  +++ L
Sbjct: 1799 KMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQ 1858

Query: 2961 KKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQKR 2782
             K +D    +    +++   +L A+ LI +    +  V ++++Q+   W  L + L Q+
Sbjct: 1859 NKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQRE 1918

Query: 2781 FKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANSD 2602
             KL  +  + +F RD  E    + +K     +E  RD  +     +K + FE +L A
Sbjct: 1919 QKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEA 1978

Query: 2601 RIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFM 2422
            ++  +++    L   AK     +A++ +   +   W+ L + +T +  RL  ++  ++F+
Sbjct: 1979 QLQVLVEDSVRL--QAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFL 2036

Query: 2421 AAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADSL 2242
              V+D+  W   +   LQ+E++  D A    L  +H  +  +I A +D+   +NE +DS+
Sbjct: 2037 TDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSM 2096

Query: 2241 LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEKK 2062
            ++   +    + E+   + D    +      ++  L + +++  F RD    ++    ++
Sbjct: 2097 VQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQ 2156

Query: 2061 LLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQI 1882
              +SS D+G+ +  VQN  RKH   +  + + E +VSL++  G +L+    +       I
Sbjct: 2157 AALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIE---QRHYDSANI 2213

Query: 1881 KKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSD--NFG 1708
            +  ++ +     +++DL   R  +L+++  +  F+ D  E + W+NEKQ+ L +D  ++
Sbjct: 2214 QTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYA 2273

Query: 1707 E--NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQL--- 1543
            E  N+      L+KH  FQ ++  ++ R+ ++ + G  L+   +  +P IK+  + +
Sbjct: 2274 EVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEA 2333

Query: 1542 -RARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
             +  L E+E    G    L +    L+F  + D +E+WI +KE  V++ D GRDL
Sbjct: 2334 WQGLLAELEQRGRG----LEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNA 2389

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEH--QQSPAIEKRHTNVIQRWQNLLAH 1192
            L+ K +  D+ +   + + ++ I +L D+L++       + +++KR  +    W+ L
Sbjct: 2390 LMRKLDDVDSDMRV-DDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGA 2448

Query: 1191 SEARRX---XXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRA 1021
              A R               +++     A+K+   +S         TD  R   L  + A
Sbjct: 2449 LNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSS---------TDTGR--DLAAVEA 2497

Query: 1020 LRDAHGEFQRSLSSAEEDFRQLQD-LDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIK 844
            L       +R +S+ ++   Q +   +  IK +      +    ++ L  +W NLQ +
Sbjct: 2498 LIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSV 2557

Query: 843  EREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEM--MEAGGTL---EEQLDAV 679
            +R+  L   +        L  +F         W+ +  ++M   ++  T+   E QL+
Sbjct: 2558 KRQSILNEAY--------LAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELH 2609

Query: 678  ERKAKEIKANKGQLRQIEEKGAMLER 601
            + +  EI+  +     ++++G  L +
Sbjct: 2610 QERKVEIEGRQEAFAGLKQQGEQLSK 2635



 Score =  455 bits (1170), Expect = e-126
 Identities = 455/2234 (20%), Positives = 916/2234 (40%), Gaps = 59/2234 (2%)
 Frame = -1

Query: 7185 QRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQ----EENF 7018
            QR  ++   YS     S  +R RLEEAR F +F  D D    W+++K +  +     ++
Sbjct: 578  QRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDL 637

Query: 7017 RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWX 6838
            R   +LQ   QKH+A E E+++       +   G  +I   H  S  I+ R++ L   W
Sbjct: 638  RAVLSLQ---QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQ 694

Query: 6837 XXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFD 6658
                    +  +L+ A +   F    +E   W+ EK   V + D G D    + L ++
Sbjct: 695  ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
            D   EL  +   I  +NQ ADKL++ G                    + TL  +  E
Sbjct: 755  DLQGELNAYSGDILNLNQQADKLIKAG--------------------ICTLELSAAEP-- 792

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLA---LSSDDYGRDLNNVQALQRKHEGTERDLAALEG 6307
                         E   W+ E  L    +  D++   L + +  + K     + L   EG
Sbjct: 793  --------ELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEG 844

Query: 6306 KMLQLEK-EAHKLAETHPDRAEAIHQKND-DTKAAWNALKEKAQHRKDGLERSFQLHRFL 6133
            + ++++K E   L     D    + + N  +     N ++E        +    +  + L
Sbjct: 845  QGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSL 904

Query: 6132 ADYRD--LISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQ 5959
               +   L+  +  +K +       K +       +S  E+   ++ R    NQT
Sbjct: 905  QKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYD--- 961

Query: 5958 KLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNK 5779
                       E+QE  +K              R  L E  + L  FYR+ +  E WM +
Sbjct: 962  -----------ELQEMAQK--------------RHALLEDSIHLFGFYRECDDFEKWMKE 996

Query: 5778 QEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVA 5599
            +E  +  +D G+ +D+ +   +K E F   L+A  +++  +D       +  H   D +
Sbjct: 997  KERMI-KSDEGEGVDNAK---RKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKII 1052

Query: 5598 EXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDP- 5422
                               R  +L+ +   + F+R CDE   W++EK+    D + + P
Sbjct: 1053 ARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKM-LQLDTAVITPD 1111

Query: 5421 -TNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNEL 5245
               ++   ++H N E+EL   E++++ +   G  + ++     D++  R ++V ++W ++
Sbjct: 1112 LRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV 1171

Query: 5244 VDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLI 5065
                +    ++     +Q FN + + + AW+  ++ Q+ +++  +D+ +  NL KK   +
Sbjct: 1172 QQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDL 1231

Query: 5064 ESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGES 4885
              D  AH+     + QL +Q  + +  N    V   E L+   +A+     ++++ L +
Sbjct: 1232 GDDIRAHDTEFVEVIQLGKQLSDGKP-NMAETVAVIERLKAEQDAIHRGWAEKQKWLLQC 1290

Query: 4884 HQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESV 4705
                   R+ +   A  +  E      N G  L  V+ ++K+       +   D  ++
Sbjct: 1291 VDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGF 1350

Query: 4704 SSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEAD 4525
            S  A+ +I   H+ +  I D+  Q+    + +K +A +R+  L  S   H++ ++A++
Sbjct: 1351 SDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLK 1410

Query: 4524 AWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQA---------- 4375
             W+ +K  I G  +Y +D  +    L+KH+A   +L A +G + ++ K
Sbjct: 1411 VWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV 1469

Query: 4374 --------------------SQCKYQEQPMGQLGRDCVLALYDYQEK-SPREVSMKKGDV 4258
                                S+ K ++       R+   +L D ++K    + +++ GDV
Sbjct: 1470 PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529

Query: 4257 LTLLNASNRDWWKVEVNDRQGFV-PAAYVKRIEPGTAQQHAQQ-QVNSIGGKQSEIEDKY 4084
               L +      K ++ + +  +      + +  G    H       +I     E++ ++
Sbjct: 1530 GNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRF 1589

Query: 4083 QRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKF 3904
            + L    + R+ KLEE+   ++ + E +   +WI      A   E+G +L Q + L KK
Sbjct: 1590 KDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKH 1649

Query: 3903 DDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQ 3724
               + ++K ++  + +      +L S    E   ++    + L   W+ L         +
Sbjct: 1650 KKLEAEIKGHQPMINKALVAGQSLISQQHPERE-QVESLCQQLEQAWQDLERHCGERSRK 1708

Query: 3723 LGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK 3544
            L  + + Q++  D  E   W+ E+++ L S ++GRD  S   L  KH+ +E +L
Sbjct: 1709 LDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGI 1768

Query: 3543 IKSLDEK-ANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSD 3367
            +  +    A  +  +HP+ ++ +   Q+ + +    L   A+ R+ +L++S     +  +
Sbjct: 1769 VTEMGHSCAAMVAANHPD-SKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLE 1827

Query: 3366 YRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLN 3187
              ++ QWI    Q  SS++   D    + L  +  + +  ++  A      +    +L++
Sbjct: 1828 SDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLID 1887

Query: 3186 SHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAF 3007
            S    A ++E R + +  + + L      R   L    E+  F+RD  +A   +  + A
Sbjct: 1888 SESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAA 1947

Query: 3006 LAQE-DPSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQ 2830
            L+QE     ++  +L++KHE F+  +   E +++ L   +  L      ++ A+ +++D+
Sbjct: 1948 LSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDK 2007

Query: 2829 ILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KFQIAQEENYRDPTNIQQ 2653
            ++  WN LKE    +  +L  S  LQ F  D  +I +W +  +  +  EE+  D
Sbjct: 2008 VVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATA 2067

Query: 2652 KHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTT 2473
               +  A   E+ A  D+   + +  +++++        A V  +  A+ D+   L
Sbjct: 2068 LKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAA--ADVEEKCAAMLDERQKLHAAW 2125

Query: 2472 TEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADI 2293
             +K   L++      F+   K ++      +  L S D+G+ +  V+N ++KH   E  I
Sbjct: 2126 NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLI 2185

Query: 2292 VAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVH 2113
               +++V  + E    L+E   +    I    + +  R   VK +   RR KL  AL
Sbjct: 2186 QTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYA 2245

Query: 2112 QFFRDIDDEESWI--KEKKLLVSSDDYGRDLPGVQNLRR--KHRRIDTELASHEPQVSLV 1945
            +F RD  + + WI  K+KKL   +  Y       + +++  KH+    E+A+++ ++  +
Sbjct: 2246 KFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEI 2305

Query: 1944 KLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVE 1765
            +  G  LL    E+     +IK+ +E + ++W  +      R + L+E++    F   ++
Sbjct: 2306 QDTGVILLSKQHES---SPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLD 2362

Query: 1764 EEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            + EAW+ +K+ ++ + + G ++     L++K D    D+ +  QRV  +    D LI+
Sbjct: 2363 KIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQA 2422

Query: 1584 NHHA--PHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQ 1411
               A    + +R         +++       A L   +    F    D     IAEK
Sbjct: 2423 QVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLA 2482

Query: 1410 VRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRH 1231
            + S D GRDL++V+ L+ ++EA +  ++A + +  Q  T  +  +     + +  IE++
Sbjct: 2483 MSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKL 2542

Query: 1230 TNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLA--FAKKASTFNSWFENAEEDLTD 1057
              + + W NL A S  R+            + E YLA  F         W  +  + + +
Sbjct: 2543 EELHKSWGNLQALSVKRQ----------SILNEAYLAHKFVSDVKELELWVNDMIKKMNN 2592

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRI--KSFNVGPNPYTWFTMDA 883
                +++ +     + H E +  +   +E F  L+    ++  +     P+    + +
Sbjct: 2593 TQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLL-V 2651

Query: 882  LEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGT 703
            LE+  + L     ER ++L   HQ Q         F         WL N  +E
Sbjct: 2652 LEELHQTLNEAWSERARDLTEAHQLQ--------LFKAQVEQVEIWLAN--KEAFLNNDD 2701

Query: 702  LEEQLDAVERKAKE 661
            L +   AVER  K+
Sbjct: 2702 LGDSYTAVERLLKK 2715



 Score =  328 bits (840), Expect = 2e-87
 Identities = 188/525 (35%), Positives = 297/525 (55%), Gaps = 2/525 (0%)
 Frame = -1

Query: 7224 QEIRILETADDIHQRRQEVLGHYSI-FKDHSQTKRDRLEEARQFQYFKRDADELNVWILE 7048
            Q IR    A +  Q + E+L    +  +D +  +R RL +A + Q F  +A+E + W+ E
Sbjct: 3054 QMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMRE 3113

Query: 7047 KLQTAQEENF-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIK 6871
            K       ++ RD  ++Q   +K E  + E+ A   +I  + K    +I+ NHF S +I
Sbjct: 3114 KRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIA 3173

Query: 6870 KRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDL 6691
            ++  ++   +         +  +L +  KL  ++R+ +E+  W+ ++     +ED G D+
Sbjct: 3174 EKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDV 3233

Query: 6690 EHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLN 6511
            EHVE L   F+ F+  L  ++ R+    +  D+L++E +     I  KRD+    W  L
Sbjct: 3234 EHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELK 3293

Query: 6510 TLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTE 6331
             L   R++ L GA QV  ++R ADET+  I EKD +L S+DYG+DL ++QAL RKH+  E
Sbjct: 3294 DLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFE 3353

Query: 6330 RDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSF 6151
             +L  ++G++  +  EA KL E +PD  E I  K D+T  AW  LKEK   RK+ L ++
Sbjct: 3354 SELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAE 3413

Query: 6150 QLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTA 5971
            QL  +  +YRDLI+WI +M A I A ELA  VAGAE LL S ++H  EI  R ++F + A
Sbjct: 3414 QLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFA 3473

Query: 5970 SAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAET 5791
            + GQ+L++     + EV++K++ L      L     +RR +YE  +D QLF +D E  E
Sbjct: 3474 ANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQ 3533

Query: 5790 WMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINAL 5656
            W++ +E  L +T LGDS+  VE L+++HEDFEK++AAQEEK  A+
Sbjct: 3534 WISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAI 3578



 Score =  313 bits (802), Expect = 4e-83
 Identities = 227/909 (24%), Positives = 428/909 (46%), Gaps = 5/909 (0%)
 Frame = -1

Query: 7200 ADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEEN 7021
            AD I ++   +L       + S+ ++ RL ++ Q Q F R   E++ W+++KLQ A +EN
Sbjct: 2746 ADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDEN 2805

Query: 7020 FRDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALW 6841
            +R+PSNLQ+KIQKH AF+AE+ +++  + ++   G  +I+ +HFA + I ++++ L   W
Sbjct: 2806 YREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDW 2865

Query: 6840 XXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKF 6661
                     K  KLQQA   L F R  DE   W+ E E  +++ED G DL  V  L +K
Sbjct: 2866 LKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH 2925

Query: 6660 DDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGL 6481
            +    ++ +H    +++ Q  ++  +  H    +I+++       ++ L+     R+E L
Sbjct: 2926 ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENL 2985

Query: 6480 FGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKM 6301
              +  +Q+F RDA++ L W+ EK L   S D G  L +VQ LQ+KH   E +L + E  +
Sbjct: 2986 EDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLI 3045

Query: 6300 LQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
              L +   ++   +   +E +  K++  +     L++ A  R+  L  + +   F  +
Sbjct: 3046 QALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEAN 3105

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
            +  +W+ + + V+ + +  +D    +   +  +  + E+ A   S  + A     L+E
Sbjct: 3106 EADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERN 3165

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
              +S  + EK  ++  E   LL L +ER     +C  L  + R+TE+   W+  Q A  A
Sbjct: 3166 HFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTA 3225

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXX 5581
            + D G+ ++ VE LI   E F  +L A E ++ A  E   +LIQ  +     +
Sbjct: 3226 SEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDET 3285

Query: 5580 XXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEK-LSTARDDSYLDPTNIRGK 5404
                         R +AL  + +   +DR  DE +  I EK  S   +D   D  +I+
Sbjct: 3286 KQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQAL 3345

Query: 5403 LQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
             +KH  FE EL   + ++D + +   ++ +    A +HI  +  +    W +L + T  +
Sbjct: 3346 GRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAAR 3405

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
              KL +A   Q +     D+ AW++E+  ++ + +    +   + L       +++
Sbjct: 3406 KNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTR 3465

Query: 5043 NDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLF 4864
            ++         QQ  +E+HF A  +  K + LQ R+  L+  L KR R++ E +   QLF
Sbjct: 3466 DETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKR-REIYELNLDTQLF 3524

Query: 4863 -RDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAND 4687
             +D E    WI  +E     T  G  +  V++L+++ +     +A  + + +++
Sbjct: 3525 LKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRIT-- 3582

Query: 4686 MIQQGHFLAPEIRDKLAQLRDNWRILKSKAEK-RRTDLDDSLQAHQYLSDANE--ADAWM 4516
            M++Q  F     ++K+++L++  R+ K + E+ ++ +L       +     +E   +A
Sbjct: 3583 MLEQ-LFRHQLEQEKISKLQEKERLEKERLEQLKQRELQRLADERRRAEKQHEHRQNAAS 3641

Query: 4515 SEKEPIVGS 4489
             EK PI  S
Sbjct: 3642 QEKTPIFSS 3650



 Score =  219 bits (557), Expect = 1e-54
 Identities = 252/1272 (19%), Positives = 506/1272 (38%), Gaps = 86/1272 (6%)
 Frame = -1

Query: 3999 DLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQ-----IATA 3835
            +L  WI+ +     Q+++   LE ++     F +++   K  + + +   +     I T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3834 LTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQ--------RFHRDVD 3679
            L ++ Q     +  Q + D+   W+ L          L      Q        +F +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 3678 ETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSH 3499
                +++E    L      R LR V A  +KHE +  D+ A  ++   L   A  L + +
Sbjct: 407  LREGYLKEMIQVLSDP---RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDREN 463

Query: 3498 PEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVS 3319
                E++   ++E+  +W +L     N++  L    +    L +     + +  + Q  +
Sbjct: 464  YHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFA 523

Query: 3318 SQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQGV 3139
            S+++   + G E LL+ H     ++++   T + F++      +S H  A  +  RL  +
Sbjct: 524  SEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADL 583

Query: 3138 NEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGD--NVESL 2965
             EA   L     ARR  L++      F  D +  ++W+  ++        + D   V SL
Sbjct: 584  EEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSL 643

Query: 2964 IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK 2785
             +KH+  +  I +++ K   +    + LI   H  S  +  + D + + W  L+  +  +
Sbjct: 644  QQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELR 703

Query: 2784 RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHAN 2608
            R +L ++    QF  DA+E E+W+ EK  +    +Y  D  + Q   Q+ +  + EL+A
Sbjct: 704  RRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763

Query: 2607 SDRIAAIIQAGNNLIENAKCGGGEAAVSARL-----------------KALNDQW----- 2494
            S  I  + Q  + LI+   C    +A    L                 +   D+W
Sbjct: 764  SGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLE 823

Query: 2493 -------------------------------DLLVKTTTEKSYRLKEANKQKSFMAAVKD 2407
                                            LL   T +  + +++ N  + F+ A
Sbjct: 824  HKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYV 883

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLL-----------KKHSLLEADIVAHQDRVGEMN 2260
             E     V  ++   +  K L  V+  +           K  S+    +V  +     +N
Sbjct: 884  REVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSIN 943

Query: 2259 EQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEES 2080
            E ADS           + +R++ I   YD +++MA  R   L  ++++  F+R+ DD E
Sbjct: 944  ENADS-----------VEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEK 992

Query: 2079 WIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAG 1900
            W+KEK+ ++ SD+      GV N +RK  +  T+L++   +V  +    +   R
Sbjct: 993  WMKEKERMIKSDEG----EGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQ- 1047

Query: 1899 VGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGS 1720
               D+I  R   + Q W ++ +    R + L+ + + + F    +E + WM+EK   L +
Sbjct: 1048 --LDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDT 1105

Query: 1719 DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLR 1540
                 ++  VQ L ++H   + +L   + +V  +   G+++ +       ++  R  +++
Sbjct: 1106 AVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQ 1165

Query: 1539 ARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILL 1360
                +++        ++        F     V+ +WI   + Q+ +++  RD+ +   LL
Sbjct: 1166 DMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLL 1225

Query: 1359 TKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEAR 1180
             K       + A + E ++ + +L  QL   +   +  +      VI+R   L A  +A
Sbjct: 1226 KKHNDLGDDIRAHDTEFVE-VIQLGKQLSDGKPNMAETVA-----VIER---LKAEQDAI 1276

Query: 1179 RXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGE 1000
                        Q  +L + F ++A   ++  ++ E  L       SL+E+ A+   H +
Sbjct: 1277 HRGWAEKQKWLLQCVDLQM-FNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLD 1335

Query: 999  FQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAR 820
            F++SL + ++  +   D   ++ S +   + Y    +    +     ++ +K+R    A
Sbjct: 1336 FEKSLMAQDKILKGFSDNADKLISNDHYDSKY----IGDRRNQVLGKRKAVKDR----AF 1387

Query: 819  EHQRQEENDKLRREFAKLANAFHAWLTN-TR---QEMMEAGGTLEEQLDAVERKAKEIKA 652
            E +R  +  K   +FA  A+    WL + TR    E       L  +L   +   +E++A
Sbjct: 1388 ERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA 1447

Query: 651  NKGQLRQIEEKGAMLERNLILDNRY--TEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQAR 478
            N+GQLR + + G  L +     NR    E     + + W  L  L+      LEQ    R
Sbjct: 1448 NEGQLRNVTKDGQALVQ---AGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQR 1504

Query: 477  NQSGVSEEALRE 442
              +   E+A ++
Sbjct: 1505 EHNRSLEDAKKK 1516



 Score =  145 bits (366), Expect = 1e-32
 Identities = 99/418 (23%), Positives = 192/418 (45%)
 Frame = -1

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNI 2659
            RD++L +     E L Q  +K  +   L+         E ++ E  Q+  +  Y    +
Sbjct: 385  RDELLRQ-----EKLEQLNYKFEKKSVLR---------EGYLKEMIQVLSDPRYLRQVDA 430

Query: 2658 QQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVK 2479
              K  K +A  A++ A  +R   +      L  + +   G+  V  R + +  +W  L++
Sbjct: 431  TLK--KHEAISADILARVERFNDLTAMAEEL--DRENYHGKERVRRREQEVMAKWRQLLE 486

Query: 2478 TTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEA 2299
                +   L + +   + +  +      + E++    SED G  L  VE LL+ HSL E
Sbjct: 487  LLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQEL 546

Query: 2298 DIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALN 2119
             +  + + +   N QA     ++      +A+R   + + Y  + + +  RR +L +A N
Sbjct: 547  QVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARN 606

Query: 2118 VHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKL 1939
             H F  D D+EESW+ +K+ +  +    +DL  V +L++KH+ ++ E+ S +P+   +
Sbjct: 607  FHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMST 666

Query: 1938 KGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEE 1759
             G+ L+    E      +I+ R++ L + W  +  L   R ++L+++     F  D  E
Sbjct: 667  AGKRLI---GEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEA 723

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            E+W+NEK  ++ S ++G +    Q LL++H   Q +L  +   + +L  + D LI  G
Sbjct: 724  ESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAG 781



 Score =  137 bits (344), Expect = 5e-30
 Identities = 120/502 (23%), Positives = 222/502 (43%), Gaps = 20/502 (3%)
 Frame = -1

Query: 3360 DLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRT-----------EIDSRAATFQAF 3214
            +L+ WI      +  ++L N + G +  L   +EYRT           EI++   T
Sbjct: 287  NLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL 346

Query: 3213 DQFGNQLLNSHH--YAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQ 3040
             +  NQ   +        DIE   Q +  A    E A   R  +L Q    QL Y+  ++
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVA--LRDELLRQEKLEQLNYKFEKK 404

Query: 3039 ADTWMSAREAFLAQ-----EDPSG-DNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLI 2878
            +      RE +L +      DP     V++ +KKHE     I  + E+   L   AE L
Sbjct: 405  S----VLREGYLKEMIQVLSDPRYLRQVDATLKKHEAISADILARVERFNDLTAMAEELD 460

Query: 2877 KNNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTE-KF 2701
            + N++    V R+  +++ +W  L E L  +R  L +   L    R+       + E +
Sbjct: 461  RENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQ 520

Query: 2700 QIAQEENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSA 2521
            Q A E+       +++  Q     E +++   + +    +    L   +      A ++
Sbjct: 521  QFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQA--LPYKSSEHKDAALLAQ 578

Query: 2520 RLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLA 2341
            RL  L + +  L++ +  +  RL+EA     FM    + E WL + + + ++    KDL
Sbjct: 579  RLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLR 638

Query: 2340 SVENLLKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKK 2161
            +V +L +KH  LE +I + + + G+M+     L+     +  +I  R   +A+ +  ++
Sbjct: 639  AVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEA 698

Query: 2160 MATDRRDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDT 1981
            +   RR +L  A   +QF+ D ++ ESW+ EK  LV+S DYG D P  Q L ++HR +
Sbjct: 699  LVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQG 758

Query: 1980 ELASHEPQVSLVKLKGEELLRS 1915
            EL ++   +  +  + ++L+++
Sbjct: 759  ELNAYSGDILNLNQQADKLIKA 780



 Score = 95.9 bits (237), Expect = 1e-17
 Identities = 92/499 (18%), Positives = 195/499 (38%), Gaps = 17/499 (3%)
 Frame = -1

Query: 6753 ILYWIREKETYVTAEDMGMDLEHVEILQRKFDDF--------LKELGNHQYRINEINQAA 6598
            +L WIR+K   +   D+   LE ++     F ++         KE    +     IN
Sbjct: 288  LLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLL 347

Query: 6597 DKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATR----KEGLFGAHQVQRFNRDADETL 6430
              L +  ++  D   +  +D+  AW  L      R    ++ L    ++++ N   ++
Sbjct: 348  KALNQPPYNPQDG--QLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKS 405

Query: 6429 A----WIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAET 6262
                 ++ E    LS   Y   L  V A  +KHE    D+ A   +   L   A +L
Sbjct: 406  VLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRE 462

Query: 6261 HPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVI 6082
            +    E + ++  +  A W  L E  ++++  L +   L   L +       + +++
Sbjct: 463  NYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQF 522

Query: 6081 GADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEK 5902
             ++++   + G E LL++H   + +++   ++  +              ++  + ++L
Sbjct: 523  ASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLAD 582

Query: 5901 LDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEH 5722
            L+   S LL     RR   E+  +   F  D +  E+W+  ++           L +V
Sbjct: 583  LEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLS 642

Query: 5721 LIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXXX 5542
            L +KH+  E  + +++ K   +     +LI  QH  + ++
Sbjct: 643  LQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVEL 702

Query: 5541 RGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA 5365
            R   L+++ +   F  D +E  SW+ EK++      Y  D  + +  LQ+H + + EL A
Sbjct: 703  RRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762

Query: 5364 NENRLDDIRSTGEQIIDSG 5308
                + ++    +++I +G
Sbjct: 763  YSGDILNLNQQADKLIKAG 781



 Score = 38.9 bits (89), Expect = 1.9
 Identities = 57/242 (23%), Positives = 94/242 (38%), Gaps = 16/242 (6%)
 Frame = -1

Query: 1092 SWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQ--------RSLSSAEEDFRQLQDLDRR 937
            SW      +L      NSLE I+    A  E++        +  S  E  +  +  L
Sbjct: 290  SWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTL--- 346

Query: 936  IKSFNVGP-NPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLAN 760
            +K+ N  P NP     ++ +E  W+ L+     RE  L  E  RQE+ ++L  +F K +
Sbjct: 347  LKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSV 406

Query: 759  AFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKAN-KGQLRQIEEKGAM---LERNLI 592
                +L    Q + +       Q+DA  +K + I A+   ++ +  +  AM   L+R
Sbjct: 407  LREGYLKEMIQVLSDP--RYLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENY 464

Query: 591  LDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARN---QSGVSEEALREFSMMFKH 421
                        +   W QL +L    + NL Q     N   +   + EA+RE    F
Sbjct: 465  HGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFAS 524

Query: 420  FD 415
             D
Sbjct: 525  ED 526


>gi|38075498|ref|XP_359378.1| similar to Spectrin alpha chain, brain
            (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin)
            (Fodrin alpha chain) [Mus musculus]
          Length = 563

 Score =  709 bits (1830), Expect = 0.0
 Identities = 344/525 (65%), Positives = 423/525 (80%)
 Frame = -1

Query: 1584 NHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVR 1405
            NHH  +I  +   L  ++ ++E  A  R AKL +NSA+LQF WK DVVESWI EKE  ++
Sbjct: 38   NHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLK 97

Query: 1404 SEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTN 1225
            ++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++++H QS AIE RH +
Sbjct: 98   TDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHAS 157

Query: 1224 VIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRC 1045
            +++RW  LLA+S  R+           ++E+L+L FAKKAS FNSWFENAEEDLTDPVRC
Sbjct: 158  LMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRC 217

Query: 1044 NSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWR 865
            NSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  NPYTWFTM+ALE+TWR
Sbjct: 218  NSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWR 277

Query: 864  NLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLD 685
            NLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR  M+E  GTLE QL+
Sbjct: 278  NLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESGTLESQLE 337

Query: 684  AVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQH 505
            A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEHSTVG+AQ WDQLDQL MRMQH
Sbjct: 338  ATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQH 397

Query: 504  NLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQ 325
            NLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GRL+HQ+FKSCLR+LGYDLPMV+EG+
Sbjct: 398  NLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGE 457

Query: 324  PEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTA 145
            P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN++SSEEIE AFRALS E +PYVT
Sbjct: 458  PDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTK 517

Query: 144  EELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQFVHALF 10
            EELY NLT EQA++C+  MKPY+D   GR +    DY +F  +LF
Sbjct: 518  EELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFDYVEFTRSLF 561



 Score = 94.7 bits (234), Expect = 3e-17
 Identities = 81/393 (20%), Positives = 165/393 (41%), Gaps = 13/393 (3%)
 Frame = -1

Query: 1893 EDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDN 1714
            E+ I  +M+ L      +      R  +LDE+ AF  F    +  E+W+ EK+  L +D+
Sbjct: 41   EENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDD 100

Query: 1713 FGENMAGVQGLLKKHDTFQVDLELHKQR-VADLINKGDTLIHNGNHHAPHIKQRCDQLRA 1537
            +G +++ VQ LL K +TF   L+  +Q  +A++    D L+   +  +  I+ R   L
Sbjct: 101  YGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMK 160

Query: 1536 RLIEIESMAEGRLAKLRD--------NSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDL 1381
            R  ++ + +  R  KL +           +L F  K     SW    E+ +        L
Sbjct: 161  RWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSL 220

Query: 1380 SSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNL 1201
              ++ L    +AF + L++ + +   ++ EL  Q+ S     +P        + + W+NL
Sbjct: 221  EEIKALREAHDAFRSSLSSAQAD-FNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNL 279

Query: 1200 LAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLE-EIR 1024
                + R            + ++L   FA+ A+ F+ W +     + +     +LE ++
Sbjct: 280  QKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVE--ESGTLESQLE 337

Query: 1023 ALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIK 844
            A +  H E    + +     ++++DL   ++   +  N YT  +   L   W  L ++
Sbjct: 338  ATKRKHQE----IRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGM 393

Query: 843  EREQELAREHQRQEE---NDKLRREFAKLANAF 754
              +  L ++ Q +      ++  +EF+ +   F
Sbjct: 394  RMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF 426



 Score = 82.8 bits (203), Expect = 1e-13
 Identities = 86/337 (25%), Positives = 141/337 (41%), Gaps = 34/337 (10%)
 Frame = -1

Query: 5295 DHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDY 5116
            ++I  +++ +N   ++L  A  ++ AKL E     QFN   + VE+W+ E E  + ++DY
Sbjct: 42   ENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDY 101

Query: 5115 GKDLVSVQNLQKKIGLIESDFNA-HNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQR 4939
            G+DL SVQ L  K    ++   A   + +  I  L  Q    +H  +  I  +  +L +R
Sbjct: 102  GRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKR 161

Query: 4938 YNALRDPLEKRKRKLGESHQGNQLFRDIEDEL-----------AWIREKEQVAGSTNRGR 4792
            +  L      RK+KL E+      FR +ED             +W    E+      R
Sbjct: 162  WTQLLANSATRKKKLLEAQSH---FRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCN 218

Query: 4791 DLIGVQNL----------IKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDK 4642
             L  ++ L          +   QA   ++A  D QI+S   A+N          P
Sbjct: 219  SLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASN----------PYTWFT 268

Query: 4641 LAQLRDNWRILKS---------KAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGS 4489
            +  L + WR L+          + E+RR + +D L+  ++   AN    W+ E    +
Sbjct: 269  MEALEETWRNLQKIIKERELELQKEQRRQEENDKLR-QEFAQHANAFHQWIQETRSCM-V 326

Query: 4488 TDYGKDEDSAEALLKKH---RALLSDLEAFKGTIEDL 4387
             + G  E   EA  +KH   RA+ S L+     IEDL
Sbjct: 327  EESGTLESQLEATKRKHQEIRAMRSQLK----KIEDL 359



 Score = 79.7 bits (195), Expect = 1e-12
 Identities = 89/389 (22%), Positives = 166/389 (41%), Gaps = 37/389 (9%)
 Frame = -1

Query: 3798 IRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGR 3619
            I  +++ LN +   L         +L       +F+   D    WI EK+++L ++D+GR
Sbjct: 44   ISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGR 103

Query: 3618 DLRSVQALQRKHEGVERDLAALGDK-IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWN 3442
            DL SVQ L  K E  +  L A   + I ++    ++L  +    ++ I      L ++W
Sbjct: 104  DLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWT 163

Query: 3441 RLTSKANNRKEKLLDSYDYQRFLSDY--------RDLMQWIASMNQLVSSQELANDVTGA 3286
            +L + +  RK+KLL++  + R + D              W  +  + ++     N +
Sbjct: 164  QLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEI 223

Query: 3285 EALLERHQEYRTEIDSRAATFQAFDQFGNQL----LNSHHYAAGDIENRLQGVNEARKGL 3118
            +AL E H  +R+ + S  A F    +   Q+    + S+ Y    +E            L
Sbjct: 224  KALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTME-----------AL 272

Query: 3117 EDAWVARRNIL-DQCLELQLFYRDCEQAD--------------TWMSAREAFLAQEDPSG 2983
            E+ W   + I+ ++ LELQ   R  E+ D               W+    + + +E  +
Sbjct: 273  EETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESGTL 332

Query: 2982 DN-VESLIKKHEDFDKAINTQEEKIKGL-KLFAESLIKNNHYDSPAVT------RKRDQI 2827
            ++ +E+  +KH++  +A+ +Q +KI+ L     E+LI +N Y   +         + DQ+
Sbjct: 333  ESQLEATKRKHQEI-RAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQL 391

Query: 2826 LDRWNGLKEALIQKRFKLG-ESQTLQQFS 2743
              R     E  IQ R   G   + L++FS
Sbjct: 392  GMRMQHNLEQQIQARNTTGVTEEALKEFS 420



 Score = 75.1 bits (183), Expect = 2e-11
 Identities = 78/357 (21%), Positives = 148/357 (40%), Gaps = 25/357 (7%)
 Frame = -1

Query: 2538 EAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSED 2359
            E  +S+++K LN +   L K   ++  +L E +    F      +E W+GE E  L+++D
Sbjct: 41   EENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDD 100

Query: 2358 YGKDLASVENLLKKHSLLEADIVA-HQDRVGEMNEQADSLLENDQFQGQQIAERRKLIAD 2182
            YG+DL+SV+ LL K    +A + A  Q+ +  +    D LL     Q + I  R   +
Sbjct: 101  YGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMK 160

Query: 2181 RYDGVKKMATDRRDKLSKALNVHQFFRDIDD-----------EESWIKEKKLLVSSDDYG 2035
            R+  +   +  R+ KL   L     FR ++D             SW +  +  ++
Sbjct: 161  RWTQLLANSATRKKKL---LEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRC 217

Query: 2034 RDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQIK-KRMEDLE 1858
              L  ++ LR  H    + L+S +   + +     EL R      V  +      ME LE
Sbjct: 218  NSLEEIKALREAHDAFRSSLSSAQADFNQL----AELDRQIKSFRVASNPYTWFTMEALE 273

Query: 1857 QSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEA--------WMNEKQQILGSDNFGEN 1702
            ++W  ++ +   R   L + +  Q     + +E A        W+ E +  +  ++ G
Sbjct: 274  ETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEES-GTL 332

Query: 1701 MAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPH----IKQRCDQL 1543
             + ++   +KH   +  +    +++ DL    +  +   N +  H    + Q+ DQL
Sbjct: 333  ESQLEATKRKHQEIRA-MRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQL 388



 Score = 72.8 bits (177), Expect = 1e-10
 Identities = 77/358 (21%), Positives = 143/358 (39%), Gaps = 17/358 (4%)
 Frame = -1

Query: 6678 ILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAA 6499
            ++  + +  L+  G++   ++ +           H E + I  K   +N     L   AA
Sbjct: 5    LVANESEKLLQTRGDYVVMLSALPCTNSPSFTNNHHE-ENISSKMKGLNGKVSDLEKAAA 63

Query: 6498 TRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLA 6319
             RK  L       +FN  AD   +WIGEK+ +L +DDYGRDL++VQ L  K E  +  L
Sbjct: 64   QRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQ 123

Query: 6318 ALEGK-MLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLH 6142
            A + + +  +     +L      +++AI  ++      W  L   +  RK  L  +
Sbjct: 124  AFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHF 183

Query: 6141 RFLADY--------RDLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADS 5986
            R + D             SW  + +  +        +   +AL E+H   +  + +
Sbjct: 184  RKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQAD 243

Query: 5985 FNQTASAGQKLVEMGIPESPEVQEKLEKLDHE--------KSSLLGLWEERRILYEQCMD 5830
            FNQ A   +++    +  +P     +E L+          K   L L +E+R   E
Sbjct: 244  FNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKL 303

Query: 5829 LQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINAL 5656
             Q F +       W+ +  + +   + G     +E   +KH++  +++ +Q +KI  L
Sbjct: 304  RQEFAQHANAFHQWIQETRSCMVE-ESGTLESQLEATKRKHQEI-RAMRSQLKKIEDL 359



 Score = 64.3 bits (155), Expect = 4e-08
 Identities = 86/388 (22%), Positives = 163/388 (41%), Gaps = 30/388 (7%)
 Frame = -1

Query: 2874 NNHYDSPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQI 2695
            NNH++   ++ K   +  + + L++A  Q++ KL E+    QF+  AD +E+W+ EK
Sbjct: 37   NNHHEEN-ISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENS 95

Query: 2694 AQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSAR 2518
             + ++Y RD +++Q    KQ+ F+A L A      A I A  + +  AK    + A+ AR
Sbjct: 96   LKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSK-AIEAR 154

Query: 2517 LKALNDQWDLLVKTTTEKSYRLKEANKQ--------KSFMAAVKDLEFWLGEVEILLQSE 2362
              +L  +W  L+  +  +  +L EA            +F         W    E  L
Sbjct: 155  HASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDP 214

Query: 2361 DYGKDLASVENLLKKHSLLEADIVAHQ---DRVGEMNEQADSL--------------LEN 2233
                 L  ++ L + H    + + + Q   +++ E++ Q  S               LE
Sbjct: 215  VRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEE 274

Query: 2232 DQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSK--ALNVHQFFRDIDDEESWIKEKKL 2059
                 Q+I + R+L   +    ++   +  DKL +  A + + F + I +  S + E+
Sbjct: 275  TWRNLQKIIKERELELQK----EQRRQEENDKLRQEFAQHANAFHQWIQETRSCMVEESG 330

Query: 2058 LVSS--DDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ 1885
             + S  +   R    ++ +R + ++I+   A+ E  + L     E      A+     DQ
Sbjct: 331  TLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQ 390

Query: 1884 IKKRMEDLEQSWGQIRDLTGNRHQRLDE 1801
            +  RM+   +   Q R+ TG   + L E
Sbjct: 391  LGMRMQHNLEQQIQARNTTGVTEEALKE 418



 Score = 62.0 bits (149), Expect = 2e-07
 Identities = 71/325 (21%), Positives = 132/325 (39%), Gaps = 28/325 (8%)
 Frame = -1

Query: 3189 NSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREA 3010
            N+HH    +I ++++G+N     LE A   R+  LD+      F    +  ++W+  +E
Sbjct: 37   NNHHEE--NISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKEN 94

Query: 3009 FLAQEDPSGD--NVESLIKKHEDFDKAINT-QEEKIKGLKLFAESLIKNNHYDSPAVTRK 2839
             L  +D   D  +V++L+ K E FD  +   Q+E I  +    + L+   H  S A+  +
Sbjct: 95   SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEAR 154

Query: 2838 RDQILDRWNGLKEALIQKRFKLGESQT--------LQQFSRDADEIENWMTEKFQIAQEE 2683
               ++ RW  L      ++ KL E+Q+           F++ A    +W         EE
Sbjct: 155  HASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFEN-----AEE 209

Query: 2682 NYRDPT------NIQQKHQKQQAFEAEL---HANSDRIAAIIQAGNNLIENAKCGGGEAA 2530
            +  DP        I+   +   AF + L    A+ +++A +    +  I++ +
Sbjct: 210  DLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAEL----DRQIKSFRVASNPYT 265

Query: 2529 VSARLKALNDQWDLLVKTTTEKSYRL-KEANKQ-------KSFMAAVKDLEFWLGEVEIL 2374
                ++AL + W  L K   E+   L KE  +Q       + F         W+ E
Sbjct: 266  WFT-MEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRSC 324

Query: 2373 LQSEDYGKDLASVENLLKKHSLLEA 2299
            +  E+ G   + +E   +KH  + A
Sbjct: 325  M-VEESGTLESQLEATKRKHQEIRA 348



 Score = 57.0 bits (136), Expect = 7e-06
 Identities = 53/225 (23%), Positives = 89/225 (39%), Gaps = 9/225 (4%)
 Frame = -1

Query: 6939 IANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKGIKLQQALKLLHFIRQC 6760
            ++ L  T +    +NH   E+I  +++ L+            +  KL +    L F  +
Sbjct: 24   LSALPCTNSPSFTNNHH-EENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQFNWKA 82

Query: 6759 DEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYR-INEINQAADKLVE 6583
            D +  WI EKE  +  +D G DL  V+ L  K + F   L   Q   I  I    D+L+
Sbjct: 83   DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLA 142

Query: 6582 EGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQR--------FNRDADETLA 6427
              H +   I  +   +   W +L   +ATRK+ L  A    R        F + A    +
Sbjct: 143  AKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNS 202

Query: 6426 WIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
            W    +  L+       L  ++AL+  H+     L++ +    QL
Sbjct: 203  WFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL 247



 Score = 46.6 bits (109), Expect = 0.009
 Identities = 64/346 (18%), Positives = 134/346 (38%), Gaps = 21/346 (6%)
 Frame = -1

Query: 5502 FDRDCDEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA-NENRLDDIRSTG 5329
            F+   D + SWI EK ++ + D Y  D ++++  L K   F+  L+A  +  + +I +
Sbjct: 78   FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK 137

Query: 5328 EQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDV----- 5164
            +Q++ + H  +  I  R   +   W +L+  +  +  KL EA   Q   R +ED+
Sbjct: 138  DQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFA 194

Query: 5163 ------EAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQF 5002
                   +W    E  +        L  ++ L++      S  ++     + + +L +Q
Sbjct: 195  KKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQI 254

Query: 5001 QEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELA------ 4840
            +     + P      E L++ +  L+  +++R+ +L +  +  +    +  E A
Sbjct: 255  KSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAF 314

Query: 4839 --WIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHF 4666
              WI+E             L       K++   I  + +   +IE + +A  + +   +
Sbjct: 315  HQWIQETRSC--MVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNK 372

Query: 4665 LAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEA 4528
                    LAQ    W  L     + + +L+  +QA        EA
Sbjct: 373  YTEHSTVGLAQ---QWDQLDQLGMRMQHNLEQQIQARNTTGVTEEA 415


>gi|38051869|gb|AAH60504.1| Spna2 protein [Mus musculus]
          Length = 488

 Score =  665 bits (1715), Expect = 0.0
 Identities = 325/486 (66%), Positives = 396/486 (80%), Gaps = 6/486 (1%)
 Frame = -1

Query: 1449 DVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVS 1270
            DVVESWI EKE  ++++D+GRDLSSVQ LLTKQE FDAGL AF+ EGI  IT LKDQL++
Sbjct: 2    DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLA 61

Query: 1269 SEHQQSPAIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNS 1090
            ++H QS AIE RH ++++RW  LLA+S  R+           ++E+L+L FAKKAS FNS
Sbjct: 62   AKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNS 121

Query: 1089 WFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPN 910
            WFENAEEDLTDPVRCNSLEEI+ALR+AH  F+ SLSSA+ DF QL +LDR+IKSF V  N
Sbjct: 122  WFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASN 181

Query: 909  PYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTR 730
            PYTWFTM+ALE+TWRNLQ+IIKERE EL +E +RQEENDKLR+EFA+ ANAFH W+  TR
Sbjct: 182  PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETR 241

Query: 729  QE------MMEAGGTLEEQLDAVERKAKEIKANKGQLRQIEEKGAMLERNLILDNRYTEH 568
                    M+E  GTLE QL+A +RK +EI+A + QL++IE+ GA +E  LILDN+YTEH
Sbjct: 242  TYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEH 301

Query: 567  STVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALREFSMMFKHFDKEKTGRLDH 388
            STVG+AQ WDQLDQL MRMQHNLEQQIQARN +GV+EEAL+EFSMMFKHFDK+K+GRL+H
Sbjct: 302  STVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNH 361

Query: 387  QQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFMISKETENIQS 208
            Q+FKSCLR+LGYDLPMV+EG+P+PEF+ ILD VDPNRDG+V+LQEYMAFMIS+ETEN++S
Sbjct: 362  QEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKS 421

Query: 207  SEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMKPYMDAISGRSIQGGLDYEQ 28
            SEEIE AFRALS E +PYVT EELY NLT EQA++C+  MKPY+D   GR +    DY +
Sbjct: 422  SEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDG-KGRELPTAFDYVE 480

Query: 27   FVHALF 10
            F  +LF
Sbjct: 481  FTRSLF 486



 Score = 77.4 bits (189), Expect = 5e-12
 Identities = 72/352 (20%), Positives = 148/352 (41%), Gaps = 17/352 (4%)
 Frame = -1

Query: 1758 EAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQR-VADLINKGDTLIHNGN 1582
            E+W+ EK+  L +D++G +++ VQ LL K +TF   L+  +Q  +A++    D L+   +
Sbjct: 5    ESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKH 64

Query: 1581 HHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSA--------YLQFMWKCDVVESWIA 1426
              +  I+ R   L  R  ++ + +  R  KL +  +        +L F  K     SW
Sbjct: 65   IQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNSWFE 124

Query: 1425 EKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPA 1246
              E+ +        L  ++ L    +AF + L++ + +   ++ EL  Q+ S     +P
Sbjct: 125  NAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQAD-FNQLAELDRQIKSFRVASNPY 183

Query: 1245 IEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEED 1066
                   + + W+NL    + R            + ++L   FA+ A+ F+ W +
Sbjct: 184  TWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTY 243

Query: 1065 LTD----PVRCNSLE-EIRALRDAHGEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYT 901
            L D         +LE ++ A +  H E    + +     ++++DL   ++   +  N YT
Sbjct: 244  LLDGSCMVEESGTLESQLEATKRKHQE----IRAMRSQLKKIEDLGAAMEEALILDNKYT 299

Query: 900  WFTMDALEDTWRNLQRIIKEREQELAREHQRQEE---NDKLRREFAKLANAF 754
              +   L   W  L ++    +  L ++ Q +      ++  +EF+ +   F
Sbjct: 300  EHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF 351



 Score = 73.6 bits (179), Expect = 7e-11
 Identities = 85/356 (23%), Positives = 151/356 (41%), Gaps = 43/356 (12%)
 Frame = -1

Query: 3681 DETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK-IKSLDEKANRLRQ 3505
            D    WI EK+++L ++D+GRDL SVQ L  K E  +  L A   + I ++    ++L
Sbjct: 2    DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLA 61

Query: 3504 SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDY--------RDLMQ 3349
            +    ++ I      L ++W +L + +  RK+KLL++  + R + D
Sbjct: 62   AKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNS 121

Query: 3348 WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQL----LNSH 3181
            W  +  + ++     N +   +AL E H  +R+ + S  A F    +   Q+    + S+
Sbjct: 122  WFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASN 181

Query: 3180 HYAAGDIENRLQGVNEARKGLEDAWVARRNIL-DQCLELQLFYRDCEQAD---------- 3034
             Y    +E            LE+ W   + I+ ++ LELQ   R  E+ D
Sbjct: 182  PYTWFTME-----------ALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHA 230

Query: 3033 ----TWMSAREAFL----AQEDPSG---DNVESLIKKHEDFDKAINTQEEKIKGL-KLFA 2890
                 W+     +L       + SG     +E+  +KH++  +A+ +Q +KI+ L
Sbjct: 231  NAFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEI-RAMRSQLKKIEDLGAAME 289

Query: 2889 ESLIKNNHYDSPAVT------RKRDQILDRWNGLKEALIQKRFKLG-ESQTLQQFS 2743
            E+LI +N Y   +         + DQ+  R     E  IQ R   G   + L++FS
Sbjct: 290  EALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFS 345



 Score = 67.8 bits (164), Expect = 4e-09
 Identities = 78/323 (24%), Positives = 129/323 (39%), Gaps = 31/323 (9%)
 Frame = -1

Query: 5166 VEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNA-HNDRVDGIKQLAQQFQEEE 4990
            VE+W+ E E  + ++DYG+DL SVQ L  K    ++   A   + +  I  L  Q    +
Sbjct: 4    VESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAK 63

Query: 4989 HFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDEL----------- 4843
            H  +  I  +  +L +R+  L      RK+KL E+      FR +ED
Sbjct: 64   HIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSH---FRKVEDLFLTFAKKASAFN 120

Query: 4842 AWIREKEQVAGSTNRGRDLIGVQNL----------IKKQQALIAEIANHDSQIESVSSAA 4693
            +W    E+      R   L  ++ L          +   QA   ++A  D QI+S   A+
Sbjct: 121  SWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVAS 180

Query: 4692 NDMIQQGHFLAPEIRDKLAQLRDNWRILKS---------KAEKRRTDLDDSLQAHQYLSD 4540
            N          P     +  L + WR L+          + E+RR + +D L+  ++
Sbjct: 181  N----------PYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLR-QEFAQH 229

Query: 4539 ANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKY 4360
            AN    W+ E      +  Y  D      ++++   L S LEA K   +++R   SQ K
Sbjct: 230  ANAFHQWIQE------TRTYLLD---GSCMVEESGTLESQLEATKRKHQEIRAMRSQLKK 280

Query: 4359 QEQPMGQLGRDCVLALYDYQEKS 4291
             E  +G    + ++    Y E S
Sbjct: 281  IED-LGAAMEEALILDNKYTEHS 302



 Score = 64.3 bits (155), Expect = 4e-08
 Identities = 63/285 (22%), Positives = 116/285 (40%), Gaps = 22/285 (7%)
 Frame = -1

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGK-MLQLEKEAHKLA 6268
            AD   +WIGEK+ +L +DDYGRDL++VQ L  K E  +  L A + + +  +     +L
Sbjct: 1    ADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLL 60

Query: 6267 ETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADY--------RDLI 6112
                 +++AI  ++      W  L   +  RK  L  +    R + D
Sbjct: 61   AAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFN 120

Query: 6111 SWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPE 5932
            SW  + +  +        +   +AL E+H   +  + +    FNQ A   +++    +
Sbjct: 121  SWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVAS 180

Query: 5931 SPEVQEKLEKLDHE--------KSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQ 5776
            +P     +E L+          K   L L +E+R   E     Q F +       W+ +
Sbjct: 181  NPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQET 240

Query: 5775 EAFLAN-----TDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINAL 5656
              +L +      + G     +E   +KH++  +++ +Q +KI  L
Sbjct: 241  RTYLLDGSCMVEESGTLESQLEATKRKHQEI-RAMRSQLKKIEDL 284



 Score = 62.0 bits (149), Expect = 2e-07
 Identities = 71/318 (22%), Positives = 130/318 (40%), Gaps = 30/318 (9%)
 Frame = -1

Query: 2406 LEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVA-HQDRVGEMNEQADSLLEND 2230
            +E W+GE E  L+++DYG+DL+SV+ LL K    +A + A  Q+ +  +    D LL
Sbjct: 4    VESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAK 63

Query: 2229 QFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDD-----------EE 2083
              Q + I  R   +  R+  +   +  R+ KL   L     FR ++D
Sbjct: 64   HIQSKAIEARHASLMKRWTQLLANSATRKKKL---LEAQSHFRKVEDLFLTFAKKASAFN 120

Query: 2082 SWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEA 1903
            SW +  +  ++       L  ++ LR  H    + L+S +   + +     EL R
Sbjct: 121  SWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL----AELDRQIKSF 176

Query: 1902 GVGEDQIK-KRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEA--------W 1750
             V  +      ME LE++W  ++ +   R   L + +  Q     + +E A        W
Sbjct: 177  RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQW 236

Query: 1749 MNEKQQIL--GS---DNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNG 1585
            + E +  L  GS   +  G   + ++   +KH   +  +    +++ DL    +  +
Sbjct: 237  IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRA-MRSQLKKIEDLGAAMEEALILD 295

Query: 1584 NHHAPH----IKQRCDQL 1543
            N +  H    + Q+ DQL
Sbjct: 296  NKYTEHSTVGLAQQWDQL 313



 Score = 53.9 bits (128), Expect = 6e-05
 Identities = 41/159 (25%), Positives = 69/159 (42%), Gaps = 10/159 (6%)
 Frame = -1

Query: 2094 DDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQ--VSLVKLKGEELL 1921
            D  ESWI EK+  + +DDYGRDL  VQ L  K    D  L + + +   ++  LK + L
Sbjct: 2    DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLL- 60

Query: 1920 RSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEA--------FQAFLGDVE 1765
               A   +    I+ R   L + W Q+   +  R ++L E+++        F  F
Sbjct: 61   ---AAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKAS 117

Query: 1764 EEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDL 1648
               +W    ++ L       ++  ++ L + HD F+  L
Sbjct: 118  AFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSL 156



 Score = 48.9 bits (115), Expect = 0.002
 Identities = 42/165 (25%), Positives = 66/165 (39%), Gaps = 9/165 (5%)
 Frame = -1

Query: 6759 DEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYR-INEINQAADKLVE 6583
            D +  WI EKE  +  +D G DL  V+ L  K + F   L   Q   I  I    D+L+
Sbjct: 2    DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLA 61

Query: 6582 EGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQR--------FNRDADETLA 6427
              H +   I  +   +   W +L   +ATRK+ L  A    R        F + A    +
Sbjct: 62   AKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAFNS 121

Query: 6426 WIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQL 6292
            W    +  L+       L  ++AL+  H+     L++ +    QL
Sbjct: 122  WFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQL 166



 Score = 45.8 bits (107), Expect = 0.015
 Identities = 74/354 (20%), Positives = 144/354 (39%), Gaps = 29/354 (8%)
 Frame = -1

Query: 2736 ADEIENWMTEKFQIAQEENY-RDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIE 2560
            AD +E+W+ EK    + ++Y RD +++Q    KQ+ F+A L A      A I A  + +
Sbjct: 1    ADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLL 60

Query: 2559 NAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQ--------KSFMAAVKDL 2404
             AK    + A+ AR  +L  +W  L+  +  +  +L EA            +F
Sbjct: 61   AAKHIQSK-AIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKASAF 119

Query: 2403 EFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQ---DRVGEMNEQADSL--- 2242
              W    E  L        L  ++ L + H    + + + Q   +++ E++ Q  S
Sbjct: 120  NSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVA 179

Query: 2241 -----------LENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSK--ALNVHQFFR 2101
                       LE      Q+I + R+L   +    ++   +  DKL +  A + + F +
Sbjct: 180  SNPYTWFTMEALEETWRNLQKIIKERELELQK----EQRRQEENDKLRQEFAQHANAFHQ 235

Query: 2100 DIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELL 1921
             I +  +++ +   +V  ++ G     ++  +RKH+    E+ +   Q+     K E+L
Sbjct: 236  WIQETRTYLLDGSCMV--EESGTLESQLEATKRKHQ----EIRAMRSQLK----KIEDLG 285

Query: 1920 RSAAEAGVGEDQIKKRME-DLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEE 1762
             +  EA + +++  +     L Q W Q+  L       L++    +   G  EE
Sbjct: 286  AAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEE 339



 Score = 44.3 bits (103), Expect = 0.045
 Identities = 65/345 (18%), Positives = 135/345 (38%), Gaps = 25/345 (7%)
 Frame = -1

Query: 5487 DEMVSWITEKLSTARDDSY-LDPTNIRGKLQKHINFEQELKA-NENRLDDIRSTGEQIID 5314
            D + SWI EK ++ + D Y  D ++++  L K   F+  L+A  +  + +I +  +Q++
Sbjct: 2    DVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLA 61

Query: 5313 SGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDV---------- 5164
            + H  +  I  R   +   W +L+  +  +  KL EA   Q   R +ED+
Sbjct: 62   AKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEA---QSHFRKVEDLFLTFAKKASA 118

Query: 5163 -EAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEH 4987
              +W    E  +        L  ++ L++      S  ++     + + +L +Q +
Sbjct: 119  FNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRV 178

Query: 4986 FNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELA--------WIR 4831
             + P      E L++ +  L+  +++R+ +L +  +  +    +  E A        WI+
Sbjct: 179  ASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQ 238

Query: 4830 EKEQ--VAGS--TNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFL 4663
            E     + GS        L       K++   I  + +   +IE + +A  + +   +
Sbjct: 239  ETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKY 298

Query: 4662 APEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEA 4528
                   LAQ    W  L     + + +L+  +QA        EA
Sbjct: 299  TEHSTVGLAQ---QWDQLDQLGMRMQHNLEQQIQARNTTGVTEEA 340



 Score = 38.5 bits (88), Expect = 2.5
 Identities = 69/387 (17%), Positives = 141/387 (35%), Gaps = 19/387 (4%)
 Frame = -1

Query: 4539 ANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKY 4360
            A+  ++W+ EKE  + + DYG+D  S + LL K     + L+AF
Sbjct: 1    ADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAF---------------- 44

Query: 4359 QEQPMGQLG--RDCVLALYDYQEKS--PREVSMKKGDVLTLLNASNRDWWKVEVNDRQGF 4192
            Q++ +  +   +D +LA    Q K+   R  S+ K     L N++ R    +E
Sbjct: 45   QQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLE------- 97

Query: 4191 VPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRKLEEACKGYQLL 4012
                         AQ H +           ++ED +
Sbjct: 98   -------------AQSHFR-----------KVEDLF--------------------LTFA 113

Query: 4011 REANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQEMNQIATAL 3832
            ++A+    W ++ E           LE+++ L++  D F+  L + +    ++ ++   +
Sbjct: 114  KKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQI 173

Query: 3831 TSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGS---------------AHEVQR 3697
             S  +  +       +E L   WR L         +L                 A
Sbjct: 174  KSF-RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANA 232

Query: 3696 FHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKAN 3517
            FH+ + ETR ++   D +   E+ G     ++A +RKH+    ++ A+  ++K +++
Sbjct: 233  FHQWIQETRTYL--LDGSCMVEESGTLESQLEATKRKHQ----EIRAMRSQLKKIEDLGA 286

Query: 3516 RLRQSHPEAAEQIYDLQRELNEQWNRL 3436
             + ++     +        L +QW++L
Sbjct: 287  AMEEALILDNKYTEHSTVGLAQQWDQL 313


>gi|39592126|emb|CAE75346.1| Hypothetical protein CBG23326
            [Caenorhabditis briggsae]
          Length = 4061

 Score =  662 bits (1709), Expect = 0.0
 Identities = 525/2281 (23%), Positives = 1021/2281 (44%), Gaps = 58/2281 (2%)
 Frame = -1

Query: 7191 IHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQEENFRD 7012
            + ++ Q ++   +  +D  + +   L++    Q F R+++ ++          + +N  D
Sbjct: 1208 VEEQLQALVSEMAALRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGD 1267

Query: 7011 P-SNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXX 6835
               +++  +++H   EA++ A    +    +T + MI+  H  S +I++R  ++ A
Sbjct: 1268 SVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREA 1327

Query: 6834 XXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREKETYVTA-EDMGMDLEHVEILQRKFD 6658
                   +  +L+ +L+     R+ DE++ W+ EK   V + +D  +    +     K +
Sbjct: 1328 VRRAAAQRKKQLEASLEYQEMRREADEVMGWMHEKAKLVASGDDAALAPSAIPHRLLKHE 1387

Query: 6657 DFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLF 6478
             F  E+  ++ RI +IN+  D LV + H E   + K    VN  W  L      + + L
Sbjct: 1388 AFEAEIIANESRIQQINREGDNLVGKNHYESPNVEKVVRQVNAQWGDLKKQVYNKGQRLR 1447

Query: 6477 GAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKML 6298
             A   +  +R  ++  A + E + AL+S D G DL +V+ L +KH   E+++     K+
Sbjct: 1448 QAADQKGLDRILEDAHAKLDEMESALNSKDQGLDLRSVKDLLQKHTVLEQEMGLYGNKLA 1507

Query: 6297 QLEKEAHKLA-ETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYR 6121
             +E    K+A E H D A+ IH    D    + A+K  AQ RK  L+ S   H+ + D
Sbjct: 1508 DIENRGKKMAVEGHYD-ADKIHMTVGDLLKRYAAMKGPAQRRKGDLDESRLWHQLVFDVD 1566

Query: 6120 DLISWIGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMG 5941
              + WI + K +  + +  + +  A  +++  ++ + E++      ++      KLV+
Sbjct: 1567 CELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLGQASKLVKRH 1626

Query: 5940 IPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLA 5761
             P S +++ K  +L+   S L  L   RR + +  +  Q +  D  + E+WMN++   LA
Sbjct: 1627 HPASSQIKAKSGELESAWSELRRLLRSRRAIVDWGVKEQQYLFDAAEVESWMNEKRNALA 1686

Query: 5760 NTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXX 5581
            + D G+  D+   L+ KH    + +    + +  LD   ++L+Q      D   +
Sbjct: 1687 SEDYGNDEDAARKLLAKHRALCEDMTTYRQWLEKLDVKCSELVQSDRPHVDRFQKRQDEL 1746

Query: 5580 XXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKL 5401
                         R NAL+++     + R+  ++  WI E+L TA  + + +      +L
Sbjct: 1747 VHEFDSLSKLAEDRRNALEDAVCLYEYMRESADLEQWIGEQLQTALCEDFAEDYEHLKEL 1806

Query: 5400 Q-KHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKK 5224
            Q K   F+Q +K    R     +    I+      A  +  +  ++ + WN L +    +
Sbjct: 1807 QSKFDEFKQSVKTGSERFTSCETAANTILRRNPPFARDVVKKQEKLRSAWNLLCEYIETR 1866

Query: 5223 GAKLREAGNEQQFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAH 5044
             AKL  A    +F+R++++ E W+++    +   D G+D+  V +L ++   ++ + +
Sbjct: 1867 TAKLAVAEELHRFHRDVDEFEQWMADKMANMP-RDLGRDVKHVHSLWQQHEALDKETHNA 1925

Query: 5043 NDRVDGIKQLAQQFQEE-EHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQL 4867
              R+  + + A++ ++     NA  I  +Q+ L + +  LR+  + RK  L  +   +
Sbjct: 1926 QPRLTKLVEEAERLKKAYPGGNAEQIGGRQQTLVEEWEELRNATDDRKDMLRAAFDLHTF 1985

Query: 4866 FRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAAND 4687
               + D LAW         S  +  DL   + L  +   L  E+   + +   + S
Sbjct: 1986 NGKVRDLLAWTDLTISDIQSDLQINDLQQAEWLQTEHSRLSHEMDAREPEFTRLVSDGEK 2045

Query: 4686 MIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEK 4507
            M+   H+   EI++K   L+     L+S+   R   L  ++Q H +  +A +  A +  K
Sbjct: 2046 MVNAQHYATEEIKNKTRLLKTALERLRSEWTLRNGYLSQAVQWHAFQREAKQIIASIGSK 2105

Query: 4506 EPIVGSTDYG---KDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQP---- 4348
               + S   G    D +S +  L      LS L+    T++    +  + ++ E
Sbjct: 2106 RTTLRSLAVGGSVADVESQKKRLDTFEKALSTLDERTATLDHTANELVKSRHMESKNIAM 2165

Query: 4347 -MGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNA--SNRDWW---------KVEVND 4204
               ++  +  L   D +    R V +K    L    +  +  + W         K
Sbjct: 2166 WQSKVHEELKLLREDIEA---RHVMLKDAFALASFGSDVAQIEAWIDEKTNGIRKARDQS 2222

Query: 4203 RQGFVPAAYVKRIEPGTAQQ--------------HAQQQVNS------IGGKQSEIEDKY 4084
             +       +KR++   A +              H  QQ+ S      IG   +E+  K+
Sbjct: 2223 SESISIEEKMKRLQTHQALEAEVAANKTIVDQILHRGQQLKSLHRNSKIGDTCNELNVKW 2282

Query: 4083 QRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKF 3904
             +L    + + R LEEA    +  +   ++  WI  +E + +  ++G D+E   +L ++
Sbjct: 2283 SQLAGACDDQSRALEEARDLLRFKQLVENVLTWINEKEVLVSTADMGRDMEHCRMLLERL 2342

Query: 3903 DDFKGDLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQ 3724
            D  + D   +E  L E+N++   L   G+T    +++++ + LN +WR L         +
Sbjct: 2343 DGTRSDSTVDEQTLDEINRLGEKLVKQGRTSRD-QVQKEQQRLNEKWRLLLGQLSHYRTE 2401

Query: 3723 LGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDK 3544
            L +A EV  F+RDV++T + I EK  A+ S+DFG+D  SV+ L RK   +ERD++A+  K
Sbjct: 2402 LVAAMEVHTFNRDVEDTDERIHEKIAAMKSDDFGKDFASVELLVRKQSALERDMSAIHQK 2461

Query: 3543 IKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDY 3364
            + S D+ A ++ +  P   E I D  ++L E W +L+  A  R +KL  S+   ++L D
Sbjct: 2462 LISHDKDAQKILEKRPPLKESILDSLKKLEESWKKLSEAAELRNDKLNRSFKLYKYLDDV 2521

Query: 3363 RDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNS 3184
            +   QW   +   ++S +   D +GA  LLE+H E + EID RA   +   + G  L
Sbjct: 2522 KKTEQWANQVRNKMTSHQTPKDSSGARKLLEQHHERKAEIDGRADELRQLHEEGQALNQE 2581

Query: 3183 HHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFL 3004
                  +++   + V  +   L   W + +  L + LE  L+  +  Q + W++ +E  +
Sbjct: 2582 QPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLADKENQV 2641

Query: 3003 AQED--PSGDNVESLIKKHEDFDKAINTQEEKIKGLKLFAESLIK-NNHYDSPAVTRKRD 2833
            ++ +   + D VE LIK H  F++ +  Q EKI  L   A++L+   N+Y +  +TRK D
Sbjct: 2642 SRGELGDTSDAVEMLIKGHSAFEETVRKQSEKIDVLVKNADALVSGGNNYRADIITRK-D 2700

Query: 2832 QILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQ 2653
            ++  R + L +++ +++  L +S+   +F R   E+  W+T K Q+A +E++ D TN++
Sbjct: 2701 EVTARHDLLLKSMSKRKDMLEDSKRYHEFIRHCGELIIWITAKLQLAYDESFLDHTNLRS 2760

Query: 2652 KHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTT 2473
            K QK  AF++EL  N  R++ + + G  L+ +      +  V A+L  L   WD L   +
Sbjct: 2761 KLQKHMAFDSELVENEKRLSNVERQGEELVADNHFMSEQ--VKAQLVELRSGWDELRTKS 2818

Query: 2472 TEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADI 2293
              K+ RL+EA +  S    V+DLE WL +VE  L SED+G+D+ S E L+KK   L+ +I
Sbjct: 2819 ALKTQRLREAFELHSLQRKVEDLEKWLDKVEGELASEDHGRDMLSTELLIKKLDTLQTEI 2878

Query: 2292 VAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVH 2113
                D V EM ++A  L            ++ + +  RY G+ +    RR+ L  A
Sbjct: 2879 AGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFF 2938

Query: 2112 QFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKG 1933
            ++ +  +++  W+ +K  L SS + G  L    +L++KH  ++ EL + +  +   + +G
Sbjct: 2939 EWVKAAEEDLEWLSDKMPLASSGESGDSLQSALSLQKKHAALEKELETRQSAMDDTEKRG 2998

Query: 1932 EELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEA 1753
            ++++R   +       I+K ++ L  +   +++  G R   L E+     +  +  E E
Sbjct: 2999 KDMIR---QRHFASGHIQKILDRLSTAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQ 3055

Query: 1752 WMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHA 1573
            W+ E+  +  S   G + AG +  L++      ++EL K  +  L  + D L+   +H A
Sbjct: 3056 WLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDA 3115

Query: 1572 PHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDF 1393
              I  +  +L A   ++      R  ++ D S Y +F+ + D +  W+ EKE+   +ED+
Sbjct: 3116 MSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERTASAEDY 3175

Query: 1392 GRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQR 1213
            G+DL   Q ++ + E+    L A   E +  +   ++ L+ S H    +I  +  +V +
Sbjct: 3176 GQDLEDCQQIIEQFESTVREL-AAAGERVALVQRSQEDLLRSGHPYGASITAKGADVQRL 3234

Query: 1212 WQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAE--------EDLTD 1057
            W ++   +  R+                   F ++A    +W ++ E        EDL+
Sbjct: 3235 WTHVNEVANERKQALNGARQVH--------RFDQEADQTLNWLQDKEATGVAMEQEDLSR 3286

Query: 1056 PVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQL-QDLDRRIKSFNVGPNPYTWFTMDAL 880
                  L  ++A    H EF   + + E+   +L  + +R   SF     P T   ++
Sbjct: 3287 A----DLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF-----PDTRHHLEVR 3337

Query: 879  E-DTWRNLQRIIKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMMEAGGT 703
              D    L+ I++  ++ L R    Q      +     +    +   T T +++     +
Sbjct: 3338 RLDMEEQLKDILEAAKKHLERLRHMQSLQSYFQEYREMMQWMKNMQTTMTSEQLPRDVAS 3397

Query: 702  LEEQLDAVERKAKEIKANKGQLRQIEEKG-AMLERNLILDNRYTEHSTVGIAQAWDQLDQ 526
             E  +   +    E++  K  +     +G  M++ + +L     E   V + ++W+ L +
Sbjct: 3398 CESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVEV-LEKSWEMLCE 3456

Query: 525  L 523
            +
Sbjct: 3457 I 3457



 Score =  631 bits (1627), Expect = e-179
 Identities = 520/2136 (24%), Positives = 951/2136 (44%), Gaps = 74/2136 (3%)
 Frame = -1

Query: 6801 LQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELG-NHQY 6625
            L   +KLL F R+CD+   W   KE  V+  D     EHV   +RKFD    ++  N
Sbjct: 928  LSDNIKLLRFYRECDDFERW---KEIEVSLADEPSP-EHVTAFRRKFDKLEADMKTNGGT 983

Query: 6624 RINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRD 6445
            ++  IN  A+ L+ EGH +  QI  ++  +N  W  L  L   R   L    +V  F+
Sbjct: 984  QLKHINDIANDLISEGHGQSRQIENRQHKINAMWENLERLRKQRAVRLEATERVADFDTT 1043

Query: 6444 ADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAE 6265
             +    W+  K      +   R+ N+V++LQ      ERDL  LE K+  LEK A  + +
Sbjct: 1044 CESAREWMLGK-----FEQLDRNPNDVKSLQN----LERDLKPLEDKIAALEKLAAAVKK 1094

Query: 6264 THPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAV 6085
             HP+ A AI +K  + +     L  +AQ +    E+S     F +  RD++SWI   +
Sbjct: 1095 DHPEEAAAIERKIAELRTLHADLLRRAQEKMLLAEQSQGKEMFESALRDMMSWIEKTRKG 1154

Query: 6084 IGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLE 5905
            +  D    DVA AE LL+ H E   +I  +          G++L+E   P  P+V+E+L+
Sbjct: 1155 MMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERS-PRMPKVEEQLQ 1213

Query: 5904 KLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVE 5725
             L  E ++L  L+  R  + +Q +DLQLF R++E+ +      EAFL   +LGDS++SVE
Sbjct: 1214 ALVSEMAALRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVE 1273

Query: 5724 HLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXXX 5545
            +L+K+H D E  L AQE ++ A    A  +I+ QH  +  + +
Sbjct: 1274 NLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAA 1333

Query: 5544 XRGNALKESYKRQTFDRDCDEMVSWITEK--LSTARDDSYLDPTNIRGKLQKHINFEQEL 5371
             R   L+ S + Q   R+ DE++ W+ EK  L  + DD+ L P+ I  +L KH  FE E+
Sbjct: 1334 QRKKQLEASLEYQEMRREADEVMGWMHEKAKLVASGDDAALAPSAIPHRLLKHEAFEAEI 1393

Query: 5370 KANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQ 5191
             ANE+R+  I   G+ ++   H+ + ++   +RQVN  W +L      KG +LR+A +++
Sbjct: 1394 IANESRIQQINREGDNLVGKNHYESPNVEKVVRQVNAQWGDLKKQVYNKGQRLRQAADQK 1453

Query: 5190 QFNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLA 5011
              +R +ED  A L E+E  + S+D G DL SV++L +K  ++E +   + +++  I+
Sbjct: 1454 GLDRILEDAHAKLDEMESALNSKDQGLDLRSVKDLLQKHTVLEQEMGLYGNKLADIENRG 1513

Query: 5010 QQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIR 4831
            ++   E H++A  I     +L +RY A++ P ++RK  L ES   +QL  D++ EL WI
Sbjct: 1514 KKMAVEGHYDADKIHMTVGDLLKRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIA 1573

Query: 4830 EKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEI 4651
            EK+ +A S + GR L    N++KKQ+ L AE+  H  QI+ V   A+ ++++ H  + +I
Sbjct: 1574 EKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLGQASKLVKRHHPASSQI 1633

Query: 4650 RDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKD 4471
            + K  +L   W  L+     RR  +D  ++  QYL DA E ++WM+EK   + S DYG D
Sbjct: 1634 KAKSGELESAWSELRRLLRSRRAIVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGND 1693

Query: 4470 EDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCKYQEQP------------------M 4345
            ED+A  LL KHRAL  D+  ++  +E L  + S+    ++P                  +
Sbjct: 1694 EDAARKLLAKHRALCEDMTTYRQWLEKLDVKCSELVQSDRPHVDRFQKRQDELVHEFDSL 1753

Query: 4344 GQLGRD------CVLALYDYQEKSPREVSMKKGDVL--TLLNASNRDWWKV-EVNDRQGF 4192
             +L  D        + LY+Y  +S  ++    G+ L   L      D+  + E+  +
Sbjct: 1754 SKLAEDRRNALEDAVCLYEYMRES-ADLEQWIGEQLQTALCEDFAEDYEHLKELQSKFDE 1812

Query: 4191 VPAAYVKRIEPGTAQQHAQQQV--------NSIGGKQSEIEDKYQRLMMLGETRKRKLEE 4036
               +     E  T+ + A   +          +  KQ ++   +  L    ETR  KL
Sbjct: 1813 FKQSVKTGSERFTSCETAANTILRRNPPFARDVVKKQEKLRSAWNLLCEYIETRTAKLAV 1872

Query: 4035 ACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVRLQE 3856
            A + ++  R+ ++  +W+  + A    +++G D++ V  L ++ +    +    + RL +
Sbjct: 1873 AEELHRFHRDVDEFEQWMADKMA-NMPRDLGRDVKHVHSLWQQHEALDKETHNAQPRLTK 1931

Query: 3855 MNQIATALTSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHRDVDE 3676
            + + A  L        A +I  + + L   W  L          L +A ++  F+  V +
Sbjct: 1932 LVEEAERLKKAYPGGNAEQIGGRQQTLVEEWEELRNATDDRKDMLRAAFDLHTFNGKVRD 1991

Query: 3675 TRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQSHP 3496
               W       + S+    DL+  + LQ +H  +  ++ A   +   L     ++  +
Sbjct: 1992 LLAWTDLTISDIQSDLQINDLQQAEWLQTEHSRLSHEMDAREPEFTRLVSDGEKMVNAQH 2051

Query: 3495 EAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQLVSS 3316
             A E+I +  R L     RL S+   R   L  +  +  F  + + ++  I S    + S
Sbjct: 2052 YATEEIKNKTRLLKTALERLRSEWTLRNGYLSQAVQWHAFQREAKQIIASIGSKRTTLRS 2111

Query: 3315 QELANDVTGAEA---LLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ 3145
              +   V   E+    L+  ++  + +D R AT    D   N+L+ S H  + +I
Sbjct: 2112 LAVGGSVADVESQKKRLDTFEKALSTLDERTAT---LDHTANELVKSRHMESKNIAMWQS 2168

Query: 3144 GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAR-EAFLAQEDPSGDNVE- 2971
             V+E  K L +   AR  +L     L  F  D  Q + W+  +        D S +++
Sbjct: 2169 KVHEELKLLREDIEARHVMLKDAFALASFGSDVAQIEAWIDEKTNGIRKARDQSSESISI 2228

Query: 2970 ----SLIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLK 2803
                  ++ H+  +  +   +  +  + L     +K+ H +S  +    +++  +W+ L
Sbjct: 2229 EEKMKRLQTHQALEAEVAANKTIVDQI-LHRGQQLKSLHRNS-KIGDTCNELNVKWSQLA 2286

Query: 2802 EALIQKRFKLGESQTLQQFSRDADEIENWMTEK-FQIAQEENYRDPTNIQQKHQKQQAFE 2626
             A   +   L E++ L +F +  + +  W+ EK   ++  +  RD  + +   ++
Sbjct: 2287 GACDDQSRALEEARDLLRFKQLVENVLTWINEKEVLVSTADMGRDMEHCRMLLERLDGTR 2346

Query: 2625 AELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKE 2446
            ++   +   +  I + G  L++  +    +  V    + LN++W LL+   +     L
Sbjct: 2347 SDSTVDEQTLDEINRLGEKLVKQGRTSRDQ--VQKEQQRLNEKWRLLLGQLSHYRTELVA 2404

Query: 2445 ANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGE 2266
            A +  +F   V+D +  + E    ++S+D+GKD ASVE L++K S LE D+ A   ++
Sbjct: 2405 AMEVHTFNRDVEDTDERIHEKIAAMKSDDFGKDFASVELLVRKQSALERDMSAIHQKLIS 2464

Query: 2265 MNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDE 2086
             ++ A  +LE      + I +  K + + +  + + A  R DKL+++  ++++  D+
Sbjct: 2465 HDKDAQKILEKRPPLKESILDSLKKLEESWKKLSEAAELRNDKLNRSFKLYKYLDDVKKT 2524

Query: 2085 ESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAE 1906
            E W  + +  ++S    +D  G + L  +H     E+     ++  +  +G+ L +   E
Sbjct: 2525 EQWANQVRNKMTSHQTPKDSSGARKLLEQHHERKAEIDGRADELRQLHEEGQALNQEQPE 2584

Query: 1905 AGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQIL 1726
                  +  KR+++ E    Q+R    +    L +   +  +  +  + E W+ +K+  +
Sbjct: 2585 HKAEVQRAHKRVQNSEH---QLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLADKENQV 2641

Query: 1725 GSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQ 1546
                 G+    V+ L+K H  F+  +    +++  L+   D L+  GN++   I  R D+
Sbjct: 2642 SRGELGDTSDAVEMLIKGHSAFEETVRKQSEKIDVLVKNADALVSGGNNYRADIITRKDE 2701

Query: 1545 LRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQI 1366
            + AR   +      R   L D+  Y +F+  C  +  WI  K Q    E F  D ++++
Sbjct: 2702 VTARHDLLLKSMSKRKDMLEDSKRYHEFIRHCGELIIWITAKLQLAYDESF-LDHTNLRS 2760

Query: 1365 LLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSE 1186
             L K  AFD+ L   E + +  +    ++LV+  H  S  ++ +   +   W  L   S
Sbjct: 2761 KLQKHMAFDSELVENE-KRLSNVERQGEELVADNHFMSEQVKAQLVELRSGWDELRTKSA 2819

Query: 1185 ARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAH 1006
             +               EL+ +  +K      W +  E +L                + H
Sbjct: 2820 LKTQRLREAF-------ELH-SLQRKVEDLEKWLDKVEGELAS--------------EDH 2857

Query: 1005 GEFQRSLSSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRI-------- 850
            G   R + S E   ++L  L   I               DA+ +  +  + +
Sbjct: 2858 G---RDMLSTELLIKKLDTLQTEIAG-----------RSDAVVEMMKKARELRVQGSAAA 2903

Query: 849  ---IKEREQELAREHQRQEENDKLRREFAKLANAFHAWLTNTRQEMM------------E 715
               +K+ EQ  AR +   +E  ++RRE    A AF  W+    +++             E
Sbjct: 2904 DDCLKQAEQVEAR-YSGLDEPVQIRRENLVDAQAFFEWVKAAEEDLEWLSDKMPLASSGE 2962

Query: 714  AGGTLEEQLDAVERKA---KEIKANKGQLRQIEEKG 616
            +G +L+  L   ++ A   KE++  +  +   E++G
Sbjct: 2963 SGDSLQSALSLQKKHAALEKELETRQSAMDDTEKRG 2998



 Score =  559 bits (1441), Expect = e-157
 Identities = 418/1598 (26%), Positives = 727/1598 (45%), Gaps = 33/1598 (2%)
 Frame = -1

Query: 5478 VSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFA 5299
            V  + E++   R  S ++ T     L+K      ++ A E+R   + +   ++    +
Sbjct: 436  VQVVLEEMEHGRSASQVEKT-----LKKQQAISTDILAREDRFKMLTAMCNELCTEKYHE 490

Query: 5298 ADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVASED 5119
            ++ I    R++ + W +L+    ++   L    +     R+I+ +   L  LE  V + D
Sbjct: 491  SEKIRGMEREIIDRWTQLLALLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRD 550

Query: 5118 YGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQR 4939
             GK L+ V++L  K  L+++  NAH   +  + Q A  +   +     V+ RK + +  +
Sbjct: 551  VGKHLIGVEDLLGKHDLVDAQINAHGSLLSKLSQAANNYIRHKEEQFDVLQRKLDEVTSQ 610

Query: 4938 YNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKK 4759
            YN L +    R+  L  +    Q  +D E+E+AW+ EKE++  +     D+  V
Sbjct: 611  YNTLVELCRSRRLALERARSLFQFIQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLL 670

Query: 4758 QQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTD 4579
             + +  E+  H ++ + + +    ++Q G     +I+ +L Q+   W  L+   +
Sbjct: 671  YKNVEMEMQTHWARSKGMIAGGERLVQSGQS-KEDIQRRLTQMNQGWERLRVAVDALGNW 729

Query: 4578 LDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGT 4399
            L ++  A QY  D NEA++W+ EK P+V S D G+DE +AE+LL++H  L  ++ A+K
Sbjct: 730  LSEARHAQQYFQDVNEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKND 789

Query: 4398 I---EDLRKQASQCKYQEQPMGQLGRDC-------VLALYDYQEKSPREVSMKKGDVLTL 4249
            I   E+++ Q +   +      Q  ++        +   Y Y+    R   + KG+VL L
Sbjct: 790  ITRLEEMQSQLANSAFHTATTSQSVQETEEVTVPQIEMAYKYEGNGMR---VAKGEVLAL 846

Query: 4248 LNASNRDWWKVEVND-RQGFVPAAYVKRI--EPGTAQQHAQQQVNSIGG----------K 4108
            L  S  +WW+    D  +G+VPA Y K +  E  T  Q  Q+   ++ G          +
Sbjct: 847  LEKSTPEWWRALKRDGTEGYVPANYCKVVPGESVTVTQTTQKTTTTVEGNETKSSVVAER 906

Query: 4107 QSEIEDKYQRLMMLGETRKRKLEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQ 3928
            Q +I + Y+ L  L + R+R L +  K  +  RE +D   W +   ++A +       E
Sbjct: 907  QHKISNDYRELRRLADVRRRLLSDNIKLLRFYRECDDFERWKEIEVSLADEPSP----EH 962

Query: 3927 VEVLQKKFDDFKGDLKANE-VRLQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALX 3751
            V   ++KFD  + D+K N   +L+ +N IA  L S G  ++  +I  +   +NA W  L
Sbjct: 963  VTAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSR-QIENRQHKINAMWENLE 1021

Query: 3750 XXXXXXXXQLGSAHEVQRFHRDVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVE 3571
                    +L +   V  F    +  R+W+  K + LD      D++S+Q L       E
Sbjct: 1022 RLRKQRAVRLEATERVADFDTTCESAREWMLGKFEQLDRNP--NDVKSLQNL-------E 1072

Query: 3570 RDLAALGDKIKSLDEKANRLRQSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSY 3391
            RDL  L DKI +L++ A  +++ HPE A  I     EL      L  +A  +      S
Sbjct: 1073 RDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRTLHADLLRRAQEKMLLAEQSQ 1132

Query: 3390 DYQRFLSDYRDLMQWIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFD 3211
              + F S  RD+M WI    + +       DV  AE LL++H E   +I  +    +
Sbjct: 1133 GKEMFESALRDMMSWIEKTRKGMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQ 1192

Query: 3210 QFGNQLLNSHHYAAGDIENRLQGVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADT 3031
            + G +LL         +E +LQ +      L D +  R  IL Q L+LQLF R+ E+ D
Sbjct: 1193 ELGRRLLERSPRMP-KVEEQLQALVSEMAALRDLYRRRDTILKQQLDLQLFNRESERIDA 1251

Query: 3030 WMSAREAFLAQEDPSGDNVES---LIKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYD 2860
                 EAFL + D  GD+VES   L+K+H D +  ++ QE +++     A+ +IK  H D
Sbjct: 1252 ATKGHEAFL-EFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHAD 1310

Query: 2859 SPAVTRKRDQILDRWNGLKEALIQKRFKLGESQTLQQFSRDADEIENWMTEKFQIAQ--E 2686
            S  + ++R  +L R   ++ A  Q++ +L  S   Q+  R+ADE+  WM EK ++    +
Sbjct: 1311 SAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVMGWMHEKAKLVASGD 1370

Query: 2685 ENYRDPTNIQQKHQKQQAFEAELHANSDRIAAIIQAGNNLIENAKCGGGEAAVSARLKAL 2506
            +    P+ I  +  K +AFEAE+ AN  RI  I + G+NL+   K       V   ++ +
Sbjct: 1371 DAALAPSAIPHRLLKHEAFEAEIIANESRIQQINREGDNLV--GKNHYESPNVEKVVRQV 1428

Query: 2505 NDQWDLLVKTTTEKSYRLKEANKQKSFMAAVKDLEFWLGEVEILLQSEDYGKDLASVENL 2326
            N QW  L K    K  RL++A  QK     ++D    L E+E  L S+D G DL SV++L
Sbjct: 1429 NAQWGDLKKQVYNKGQRLRQAADQKGLDRILEDAHAKLDEMESALNSKDQGLDLRSVKDL 1488

Query: 2325 LKKHSLLEADIVAHQDRVGEMNEQADSLLENDQFQGQQIAERRKLIADRYDGVKKMATDR 2146
            L+KH++LE ++  + +++ ++  +   +     +   +I      +  RY  +K  A  R
Sbjct: 1489 LQKHTVLEQEMGLYGNKLADIENRGKKMAVEGHYDADKIHMTVGDLLKRYAAMKGPAQRR 1548

Query: 2145 RDKLSKALNVHQFFRDIDDEESWIKEKKLLVSSDDYGRDLPGVQNLRRKHRRIDTELASH 1966
            +  L ++   HQ   D+D E  WI EKK + SS D GR L    N+ +K  +++ E+  H
Sbjct: 1549 KGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQH 1608

Query: 1965 EPQVSLVKLKGEELLRSAAEAGVGEDQIKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQ 1786
              Q+  V  +  +L++    A     QIK +  +LE +W ++R L  +R   +D     Q
Sbjct: 1609 GGQIDKVLGQASKLVKRHHPAS---SQIKAKSGELESAWSELRRLLRSRRAIVDWGVKEQ 1665

Query: 1785 AFLGDVEEEEAWMNEKQQILGSDNFGENMAGVQGLLKKHDTFQVDLELHKQRVADLINKG 1606
             +L D  E E+WMNEK+  L S+++G +    + LL KH     D+  ++Q +  L  K
Sbjct: 1666 QYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLAKHRALCEDMTTYRQWLEKLDVKC 1725

Query: 1605 DTLIHNGNHHAPHIKQRCDQLRARLIEIESMAEGRLAKLRDNSAYLQFMWKCDVVESWIA 1426
              L+ +   H    ++R D+L      +  +AE R   L D     ++M +   +E WI
Sbjct: 1726 SELVQSDRPHVDRFQKRQDELVHEFDSLSKLAEDRRNALEDAVCLYEYMRESADLEQWIG 1785

Query: 1425 EKEQQVRSEDFGRDLSSVQILLTKQEAFDAGLNAFEHEGIQRITELKDQLVSSEHQQSP- 1249
            E+ Q    EDF  D   ++ L +K + F   +      G +R T  +    +   +  P
Sbjct: 1786 EQLQTALCEDFAEDYEHLKELQSKFDEFKQSVKT----GSERFTSCETAANTILRRNPPF 1841

Query: 1248 --AIEKRHTNVIQRWQNLLAHSEARRXXXXXXXXXXXQIEELYLAFAKKASTFNSWFENA 1075
               + K+   +   W  L  + E R              EEL+  F +    F  W  +
Sbjct: 1842 ARDVVKKQEKLRSAWNLLCEYIETR-------TAKLAVAEELH-RFHRDVDEFEQWMADK 1893

Query: 1074 EEDLTDPVRCNSLEEIRALRDAHGEFQRSLSSAEEDFRQL-QDLDRRIKSFNVGPNPYTW 898
              ++   +    ++ + +L   H    +   +A+    +L ++ +R  K++  G
Sbjct: 1894 MANMPRDLG-RDVKHVHSLWQQHEALDKETHNAQPRLTKLVEEAERLKKAYPGGNAEQIG 1952

Query: 897  FTMDALEDTWRNLQRIIKEREQELAREHQRQEENDKLR 784
                 L + W  L+    +R+  L         N K+R
Sbjct: 1953 GRQQTLVEEWEELRNATDDRKDMLRAAFDLHTFNGKVR 1990



 Score =  546 bits (1406), Expect = e-153
 Identities = 362/1352 (26%), Positives = 660/1352 (48%), Gaps = 46/1352 (3%)
 Frame = -1

Query: 7152 IFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEK---LQTAQEENFRDPS--NLQAKI 6988
            + ++  + +   L++A     F  D  ++  WI EK   ++ A++++    S      ++
Sbjct: 2176 LLREDIEARHVMLKDAFALASFGSDVAQIEAWIDEKTNGIRKARDQSSESISIEEKMKRL 2235

Query: 6987 QKHEAFEAEVQAHAKTIANLDKTGNAMIQHNHFASEHIKKRLEELHALWXXXXXXXXXKG 6808
            Q H+A EAEV A+ KTI +        ++  H  S+ I     EL+  W         +
Sbjct: 2236 QTHQALEAEVAAN-KTIVDQILHRGQQLKSLHRNSK-IGDTCNELNVKWSQLAGACDDQS 2293

Query: 6807 IKLQQALKLLHFIRQCDEILYWIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQ 6628
              L++A  LL F +  + +L WI EKE  V+  DMG D+EH  +L  + D    +    +
Sbjct: 2294 RALEEARDLLRFKQLVENVLTWINEKEVLVSTADMGRDMEHCRMLLERLDGTRSDSTVDE 2353

Query: 6627 YRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNR 6448
              ++EIN+  +KLV++G +  DQ+ K++  +N+ W  L    +  +  L  A +V  FNR
Sbjct: 2354 QTLDEINRLGEKLVKQGRTSRDQVQKEQQRLNEKWRLLLGQLSHYRTELVAAMEVHTFNR 2413

Query: 6447 DADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLA 6268
            D ++T   I EK  A+ SDD+G+D  +V+ L RK    ERD++A+  K++  +K+A K+
Sbjct: 2414 DVEDTDERIHEKIAAMKSDDFGKDFASVELLVRKQSALERDMSAIHQKLISHDKDAQKIL 2473

Query: 6267 ETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKA 6088
            E  P   E+I       + +W  L E A+ R D L RSF+L+++L D +    W   ++
Sbjct: 2474 EKRPPLKESILDSLKKLEESWKKLSEAAELRNDKLNRSFKLYKYLDDVKKTEQWANQVRN 2533

Query: 6087 VIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKL 5908
             + + +  KD +GA  LLE H E K EID RAD   Q    GQ L +       EVQ
Sbjct: 2534 KMTSHQTPKDSSGARKLLEQHHERKAEIDGRADELRQLHEEGQALNQEQPEHKAEVQRAH 2593

Query: 5907 EKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSV 5728
            +++ + +  L   WE  +   ++ ++  L+  +  Q E W+  +E  ++  +LGD+ D+V
Sbjct: 2594 KRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLADKENQVSRGELGDTSDAV 2653

Query: 5727 EHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHYAADDVAEXXXXXXXXXXXXXXXX 5548
            E LIK H  FE+++  Q EKI+ L + A  L+ G +    D+
Sbjct: 2654 EMLIKGHSAFEETVRKQSEKIDVLVKNADALVSGGNNYRADIITRKDEVTARHDLLLKSM 2713

Query: 5547 XXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELK 5368
              R + L++S +   F R C E++ WIT KL  A D+S+LD TN+R KLQKH+ F+ EL
Sbjct: 2714 SKRKDMLEDSKRYHEFIRHCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELV 2773

Query: 5367 ANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQ 5188
             NE RL ++   GE+++   HF ++ +  +L ++ + W+EL   +  K  +LREA
Sbjct: 2774 ENEKRLSNVERQGEELVADNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHS 2833

Query: 5187 FNRNIEDVEAWLSELEGQVASEDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQ 5008
              R +ED+E WL ++EG++ASED+G+D++S + L KK+  ++++    +D V  + + A+
Sbjct: 2834 LQRKVEDLEKWLDKVEGELASEDHGRDMLSTELLIKKLDTLQTEIAGRSDAVVEMMKKAR 2893

Query: 5007 QFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIRE 4828
            + + +    A   +++ E ++ RY+ L +P++ R+  L ++    +  +  E++L W+ +
Sbjct: 2894 ELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFEWVKAAEEDLEWLSD 2953

Query: 4827 KEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIR 4648
            K  +A S   G  L    +L KK  AL  E+    S ++       DMI+Q HF +  I+
Sbjct: 2954 KMPLASSGESGDSLQSALSLQKKHAALEKELETRQSAMDDTEKRGKDMIRQRHFASGHIQ 3013

Query: 4647 DKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDE 4468
              L +L      LK     RR  L +++ AH+Y ++  EA+ W+ E+ P+  S + G+D+
Sbjct: 3014 KILDRLSTAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQ 3073

Query: 4467 DSAEALLKKHRALLSDLEAFKGTIEDLRKQ---------------ASQCKYQEQPMGQLG 4333
              AE+ L++   L  ++E FK  I+ L+K+               A++ +  E   G L
Sbjct: 3074 AGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLC 3133

Query: 4332 RDCVLALYDYQEKSPREVSMKKGDVLT------LLNASNRDWWKVEVNDRQGFVP--AAY 4177
            R+C        + S     +++ D L+         AS  D+ + ++ D Q  +    +
Sbjct: 3134 RECARRRTQIVDASKYHKFVRQADDLSDWLREKERTASAEDYGQ-DLEDCQQIIEQFEST 3192

Query: 4176 VKRI----EPGTAQQHAQQQV--------NSIGGKQSEIEDKYQRLMMLGETRKRKLEEA 4033
            V+ +    E     Q +Q+ +         SI  K ++++  +  +  +   RK+ L  A
Sbjct: 3193 VRELAAAGERVALVQRSQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGA 3252

Query: 4032 CKGYQLLREANDLAEWIKSREA--VAAQQE--IGTDLEQVEVLQKKFDDFKGDLKANEVR 3865
             + ++  +EA+    W++ +EA  VA +QE     DL  V+   ++ D+F   +KA E +
Sbjct: 3253 RQVHRFDQEADQTLNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQ 3312

Query: 3864 LQEMNQIATAL-TSVGQTETAVRIRQQIEDLNARWRALXXXXXXXXXQLGSAHEVQRFHR 3688
            + E+   A  L  S   T   + +R+   D+  + + +         +L     +Q + +
Sbjct: 3313 VAELCHEAERLWNSFPDTRHHLEVRRL--DMEEQLKDILEAAKKHLERLRHMQSLQSYFQ 3370

Query: 3687 DVDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLR 3508
            +  E   W++     + SE   RD+ S ++L R+H+    ++      +     +  R+
Sbjct: 3371 EYREMMQWMKNMQTTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMI 3430

Query: 3507 QSHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQ 3328
            QS    +++I +    L + W  L     +R E   ++ D Q++  +   L  W+
Sbjct: 3431 QSSHVLSQEIQEKVEVLEKSWEMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAG 3490

Query: 3327 LVSSQ-ELANDVTGAEALLERHQEYRTEIDSR 3235
            L+     + + V  AE+ L    ++   ++++
Sbjct: 3491 LLGDDWRMVDSVEMAESHLRDFDDFLVTLEAQ 3522



 Score =  520 bits (1340), Expect = e-145
 Identities = 463/2074 (22%), Positives = 898/2074 (42%), Gaps = 64/2074 (3%)
 Frame = -1

Query: 7206 ETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEARQFQYFKRDADELNVWILEKLQTAQE 7027
            ++ +DI +R  ++   +   +       + L EAR  Q + +D +E   WI EK+   +
Sbjct: 700  QSKEDIQRRLTQMNQGWERLRVAVDALGNWLSEARHAQQYFQDVNEAESWIREKMPLVKS 759

Query: 7026 ENF-RDPSNLQAKIQKHEAFEAEVQAHAKTIANLDKTGNAMIQ---HNHFASEHIKKRLE 6859
            ++  RD    ++ +Q+H   E E++A+   I  L++  + +     H    S+ +++  E
Sbjct: 760  DDLGRDEGAAESLLQRHARLEEEIRAYKNDITRLEEMQSQLANSAFHTATTSQSVQE-TE 818

Query: 6858 ELHALWXXXXXXXXXKGIKLQQALKLLHFIRQCDEILYWIREK----ETYVTAEDMGMDL 6691
            E+              G+++ +   L    +   E  +W   K    E YV A
Sbjct: 819  EVTVPQIEMAYKYEGNGMRVAKGEVLALLEKSTPE--WWRALKRDGTEGYVPA------- 869

Query: 6690 EHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEHDQIYKKRDDVNDAWHRLN 6511
                       ++ K +      + +  Q     VE   ++   + +++  +++ +  L
Sbjct: 870  -----------NYCKVVPGESVTVTQTTQKTTTTVEGNETKSSVVAERQHKISNDYRELR 918

Query: 6510 TLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDYGRDLNNVQALQRKHEGTE 6331
             LA  R+  L    ++ RF R+ D+   W   K++ +S  D      +V A +RK +  E
Sbjct: 919  RLADVRRRLLSDNIKLLRFYRECDDFERW---KEIEVSLADEPSP-EHVTAFRRKFDKLE 974

Query: 6330 RDLAALEGKMLQ-LEKEAHKLAETHPDRAEAIHQKNDDTKAAWNALKEKAQHRKDGLERS 6154
             D+    G  L+ +   A+ L      ++  I  +     A W  L+   + R   LE +
Sbjct: 975  ADMKTNGGTQLKHINDIANDLISEGHGQSRQIENRQHKINAMWENLERLRKQRAVRLEAT 1034

Query: 6153 FQLHRFLADYRDLISW-IGDMKAVIGADELAKDVAGAEALLESHQEHKGEIDARADSFNQ 5977
             ++  F         W +G  + +   D    DV      L++ +     ++ +  +  +
Sbjct: 1035 ERVADFDTTCESAREWMLGKFEQL---DRNPNDVKS----LQNLERDLKPLEDKIAALEK 1087

Query: 5976 TASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILYEQCMDLQLFYRDTEQA 5797
             A+A +K       E+  ++ K+ +L    + LL   +E+ +L EQ    ++F
Sbjct: 1088 LAAAVKK---DHPEEAAAIERKIAELRTLHADLLRRAQEKMLLAEQSQGKEMFESALRDM 1144

Query: 5796 ETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKINALDEFATKLIQGQHY 5617
             +W+ K    +        +   E L+KKH +  + +  ++ ++    E   +L++ +
Sbjct: 1145 MSWIEKTRKGMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLE-RSP 1203

Query: 5616 AADDVAEXXXXXXXXXXXXXXXXXXRGNALKESYKRQTFDRDCDEMVSWITEKLSTARDD 5437
                V E                  R   LK+    Q F+R+ + + +      +    D
Sbjct: 1204 RMPKVEEQLQALVSEMAALRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFD 1263

Query: 5436 SYLDPT-NIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGHFAADHIGDRLRQVNN 5260
            +  D   ++   L++H + E +L A E RL+    T + +I + H  + +I  R R V
Sbjct: 1264 NLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLA 1323

Query: 5259 LWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS-EDYGKDLVSVQNLQ 5083
                +  A  ++  +L  +   Q+  R  ++V  W+ E    VAS +D      ++ +
Sbjct: 1324 RREAVRRAAAQRKKQLEASLEYQEMRREADEVMGWMHEKAKLVASGDDAALAPSAIPHRL 1383

Query: 5082 KKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQQRYNALRDPLEKRK 4903
             K    E++  A+  R+  I +       + H+ +P + +    +  ++  L+  +  +
Sbjct: 1384 LKHEAFEAEIIANESRIQQINREGDNLVGKNHYESPNVEKVVRQVNAQWGDLKKQVYNKG 1443

Query: 4902 RKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLIKKQQALIAEIANHD 4723
            ++L ++     L R +ED  A + E E    S ++G DL  V++L++K   L  E+  +
Sbjct: 1444 QRLRQAADQKGLDRILEDAHAKLDEMESALNSKDQGLDLRSVKDLLQKHTVLEQEMGLYG 1503

Query: 4722 SQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRRTDLDDSLQAHQYLS 4543
            +++  + +    M  +GH+ A +I   +  L   +  +K  A++R+ DLD+S   HQ +
Sbjct: 1504 NKLADIENRGKKMAVEGHYDADKIHMTVGDLLKRYAAMKGPAQRRKGDLDESRLWHQLVF 1563

Query: 4542 DANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFKGTIEDLRKQASQCK 4363
            D +    W++EK+PI  S D G+    A  ++KK   L +++    G I+ +  QAS+
Sbjct: 1564 DVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLGQASKLV 1623

Query: 4362 YQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDV-------LTLLNASNRDWWKVEV