Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K10C2_4
(1233 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17568861|ref|NP_509082.1| aspartic proteinase family member (... 782 0.0
gi|39585844|emb|CAE61258.1| Hypothetical protein CBG05064 [Caeno... 526 e-148
gi|32566657|ref|NP_872129.1| aspartic protease (46.6 kD) (asp-2)... 140 6e-32
gi|7507925|pir||T29692 hypothetical protein T18H9.2 - Caenorhabd... 140 6e-32
gi|32566655|ref|NP_505384.2| aspartic protease (asp-2) [Caenorha... 140 6e-32
gi|39590347|emb|CAE66086.1| Hypothetical protein CBG11303 [Caeno... 140 8e-32
gi|39590349|emb|CAE66088.1| Hypothetical protein CBG11305 [Caeno... 139 1e-31
gi|1507727|gb|AAB06576.1| aspartic protease 138 3e-31
gi|17557206|ref|NP_505135.1| aspartic protease (42.0 kD) (asp-5)... 136 9e-31
gi|17557208|ref|NP_505133.1| aspartic protease (41.5 kD) (asp-6)... 132 1e-29
gi|39588688|emb|CAE58212.1| Hypothetical protein CBG01307 [Caeno... 127 7e-28
gi|39588689|emb|CAE58213.1| Hypothetical protein CBG01308 [Caeno... 127 7e-28
gi|39594552|emb|CAE72130.1| Hypothetical protein CBG19226 [Caeno... 124 3e-27
gi|39590348|emb|CAE66087.1| Hypothetical protein CBG11304 [Caeno... 124 6e-27
gi|17560024|ref|NP_505134.1| aspartic protease precursor family ... 122 2e-26
gi|39581556|emb|CAE58341.1| Hypothetical protein CBG01462 [Caeno... 110 9e-23
gi|39580229|emb|CAE72985.1| Hypothetical protein CBG20329 [Caeno... 108 3e-22
gi|45752338|emb|CAE12199.1| aspartyl protease precursor [Haemonc... 106 1e-21
gi|17560290|ref|NP_505232.1| aspartic protease precursor family ... 100 5e-20
gi|25151802|ref|NP_741677.1| aspartic protease (42.7 kD) (asp-1)... 100 1e-19
gi|3413442|emb|CAA08899.1| aspartic protease [Caenorhabditis ele... 99 2e-19
gi|39584216|emb|CAE61591.1| Hypothetical protein CBG05505 [Caeno... 99 2e-19
gi|9581803|emb|CAC00542.1| necepsin I [Necator americanus] 97 8e-19
gi|46485798|gb|AAS98423.1| aspartic proteinase [Oryza sativa (ja... 97 8e-19
gi|1168537|sp|P42211|ASPR_ORYSA Aspartic proteinase precursor >g... 97 1e-18
gi|9798668|dbj|BAB11756.1| pepsinogen C [Oryctolagus cuniculus] 96 2e-18
gi|11359777|pir||T45034 hypothetical protein Y39B6B.h [imported]... 95 4e-18
gi|2499819|sp|Q42456|APR1_ORYSA Aspartic proteinase oryzasin 1 p... 94 7e-18
gi|4103749|gb|AAD09345.1| aspartic protease precursor [Strongylo... 94 9e-18
gi|17538662|ref|NP_500928.1| cathepsin e family member (4G953) [... 94 9e-18
gi|25151573|ref|NP_741673.1| aspartic protease precursor family ... 93 1e-17
gi|11359778|pir||T45036 hypothetical protein Y39B6B.j [imported]... 93 1e-17
gi|1322391|emb|CAA96571.1| parasite pepsinogen [Haemonchus conto... 93 1e-17
gi|34894316|ref|NP_908483.1| unnamed protein product [Oryza sati... 92 2e-17
gi|25155274|ref|NP_741674.1| aspartic protease precursor family ... 91 4e-17
gi|21616051|emb|CAC86003.1| aspartic proteinase [Theobroma cacao] 91 6e-17
gi|15233518|ref|NP_192355.1| aspartyl protease family protein [A... 89 2e-16
gi|17557992|ref|NP_506185.1| pepsinogen precursor family member ... 88 5e-16
gi|18203304|sp|Q9N2D3|PEPC_CALJA Gastricsin precursor (Pepsinoge... 87 8e-16
gi|9798664|dbj|BAB11754.1| pepsinogen C [Sorex unguiculatus] 87 8e-16
gi|30685656|ref|NP_193936.2| aspartyl protease family protein [A... 87 8e-16
gi|5822248|pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin... 86 1e-15
gi|1168536|sp|P42210|ASPR_HORVU Phytepsin precursor (Aspartic pr... 86 1e-15
gi|17566864|ref|NP_507653.1| predicted CDS, aspartic protease fa... 86 2e-15
gi|29244579|ref|NP_080249.2| progastricsin (pepsinogen C); urina... 86 2e-15
gi|3288145|emb|CAA76563.1| preprocathepsin D [Dictyostelium disc... 86 2e-15
gi|39580231|emb|CAE72987.1| Hypothetical protein CBG20332 [Caeno... 86 2e-15
gi|33352213|emb|CAE18153.1| aspartic proteinase [Chlamydomonas r... 85 4e-15
gi|50543010|ref|XP_499671.1| hypothetical protein [Yarrowia lipo... 84 5e-15
gi|39583893|emb|CAE63983.1| Hypothetical protein CBG08575 [Caeno... 84 5e-15
gi|5081317|gb|AAD39344.1| pepsinogen [Haemonchus contortus] 84 7e-15
gi|12231172|dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata] 84 7e-15
gi|3551952|gb|AAC34854.1| senescence-associated protein 4 [Hemer... 84 9e-15
gi|9798658|dbj|BAB11751.1| pepsinogen A [Rhinolophus ferrumequinum] 84 9e-15
gi|129797|sp|P03955|PEPC_MACFU Gastricsin precursor (Pepsinogen ... 84 9e-15
gi|9798666|dbj|BAB11755.1| pepsinogen C [Rhinolophus ferrumequinum] 83 2e-14
gi|7435839|pir||S71591 aspartic proteinase precursor, wound-indu... 83 2e-14
gi|15186732|dbj|BAB62890.1| aspartic proteinase 1 [Glycine max] 82 3e-14
gi|7435838|pir||T07915 probable aspartic proteinase (EC 3.4.23.-... 82 3e-14
gi|12843350|dbj|BAB25952.1| unnamed protein product [Mus musculus] 82 3e-14
gi|4505757|ref|NP_002621.1| progastricsin (pepsinogen C); Prepro... 81 4e-14
gi|50550685|ref|XP_502815.1| hypothetical protein [Yarrowia lipo... 81 4e-14
gi|999902|pdb|1HTR|B Chain B, Progastricsin (Pepsinogen C) (E.C.... 81 4e-14
gi|31197675|ref|XP_307785.1| ENSANGP00000022754 [Anopheles gambi... 81 4e-14
gi|31197673|ref|XP_307784.1| ENSANGP00000013568 [Anopheles gambi... 81 4e-14
gi|12231174|dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata] 81 4e-14
gi|4582534|emb|CAB40349.1| preprocardosin B [Cynara cardunculus] 81 4e-14
gi|387014|gb|AAA60062.1| pepsinogen 81 4e-14
gi|1350571|sp|P08424|RENI_RAT Renin precursor (Angiotensinogenas... 81 6e-14
gi|4581209|emb|CAB40134.1| preprocardosin A [Cynara cardunculus] 80 7e-14
gi|206609|gb|AAA42030.1| preprorenin (EC 3.4.99.19) 80 7e-14
gi|39581226|emb|CAE70423.1| Hypothetical protein CBG16997 [Caeno... 80 7e-14
gi|11265728|pir||JC7272 aspartic proteinase (EC 3.4.23.-) - comm... 80 7e-14
gi|11265692|pir||T49112 aspartic proteinase like protein - Arabi... 80 1e-13
gi|22330379|ref|NP_176419.2| aspartyl protease family protein [A... 80 1e-13
gi|9798662|dbj|BAB11753.1| pepsinogen C [Suncus murinus] 80 1e-13
gi|15221141|ref|NP_172655.1| aspartyl protease family protein [A... 80 1e-13
gi|1354272|gb|AAC49730.1| aspartic proteinase [Arabidopsis thali... 80 1e-13
gi|45382405|ref|NP_990209.1| pepsinogen A [Gallus gallus] >gnl|B... 80 1e-13
gi|3024367|sp|Q64411|PEPC_CAVPO Gastricsin precursor (Pepsinogen... 80 1e-13
gi|11990128|emb|CAC19555.1| pepsin A [Camelus dromedarius] 80 1e-13
gi|21907889|dbj|BAC05689.1| aspartic protease BmAsp-2 [Brugia ma... 79 2e-13
gi|18959216|ref|NP_579818.1| progastricsin; progastricsin (pepsi... 79 2e-13
gi|24647681|ref|NP_650622.1| CG5860-PA [Drosophila melanogaster]... 79 2e-13
gi|5921649|gb|AAD56283.1| pepsinogen A form IIa [Pseudopleuronec... 79 2e-13
gi|7435837|pir||T11686 aspartic proteinase (EC 3.4.23.-) - cowpea 79 3e-13
gi|39590350|emb|CAE66089.1| Hypothetical protein CBG11306 [Caeno... 79 3e-13
gi|57046|emb|CAA30082.1| unnamed protein product [Rattus norvegi... 79 3e-13
gi|49019802|emb|CAD80095.2| pepsin A1 [Trematomus bernacchii] 79 3e-13
gi|20800441|gb|AAB03843.2| aspartic proteinase [Vigna unguiculat... 78 4e-13
gi|1705600|sp|P10977|CARV_CANAL Vacuolar aspartic protease precu... 78 4e-13
gi|25452827|sp|Q9DEX3|CATD_CLUHA Cathepsin D precursor >gnl|BL_O... 78 4e-13
gi|129791|sp|P00793|PEPA_CHICK Pepsin A precursor 78 4e-13
gi|1665867|emb|CAA70340.1| aspartic proteinase [Centaurea calcit... 78 4e-13
gi|40641523|emb|CAE52913.1| putative vacuaolar aspartic proteina... 78 5e-13
gi|13676837|ref|NP_112469.1| renin 1 structural [Mus musculus] >... 78 5e-13
gi|49019527|emb|CAD80096.1| pepsin A2 [Trematomus bernacchii] 78 5e-13
gi|25154798|ref|NP_741676.1| aspartic protease family member (5T... 77 6e-13
gi|50557048|ref|XP_505932.1| hypothetical protein [Yarrowia lipo... 77 6e-13
gi|50401196|sp|Q9TSZ1|RENI_CALJA Renin precursor (Angiotensinoge... 77 6e-13
gi|1076696|pir||S49349 cyprosin (EC 3.4.23.-) - cardoon >gnl|BL_... 77 8e-13
gi|49019530|emb|CAD80097.1| pepsin A3 [Trematomus bernacchii] 77 8e-13
gi|9798654|dbj|BAB11749.1| pepsinogen A [Suncus murinus] 77 8e-13
gi|4389326|pdb|1B5F|A Chain A, Native Cardosin A From Cynara Car... 77 8e-13
gi|34740274|dbj|BAC87742.1| pepsinogen [Paralichthys olivaceus] 77 8e-13
gi|46434627|gb|EAK94031.1| hypothetical protein CaO19.1891 [Cand... 77 1e-12
gi|25290004|pir||E96649 hypothetical protein F19K23.21 [imported... 77 1e-12
gi|12231176|dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata] 76 1e-12
gi|45185830|ref|NP_983546.1| ACR144Wp [Eremothecium gossypii] >g... 76 1e-12
gi|129777|sp|P28712|PEP1_RABIT Pepsin II-1 precursor (Pepsin A) ... 76 1e-12
gi|50548267|ref|XP_501603.1| hypothetical protein [Yarrowia lipo... 76 1e-12
gi|49091158|ref|XP_407040.1| hypothetical protein AN2903.2 [Aspe... 76 2e-12
gi|1246038|gb|AAB35842.1| pepsinogen A [turtles, Peptide, 361 aa] 76 2e-12
gi|39583181|emb|CAE61399.1| Hypothetical protein CBG05258 [Caeno... 75 2e-12
gi|50346961|gb|AAT75162.1| renin [Macaca fascicularis] 75 2e-12
gi|50058380|gb|AAT68959.1| preprorenin [Canis familiaris] 75 2e-12
gi|543860|sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease precu... 75 2e-12
gi|22218078|dbj|BAC07516.1| pepsinogen III [Oryctolagus cuniculus] 75 2e-12
gi|19921120|ref|NP_609458.1| CG17134-PA [Drosophila melanogaster... 75 2e-12
gi|17549909|ref|NP_510191.1| aspartic protease (49.3 kD) (asp-4)... 75 3e-12
gi|7489316|pir||T12049 cyprosin (EC 3.4.23.-) - cardoon (fragmen... 75 3e-12
gi|530795|gb|AAA20876.1| pepsinogen 75 3e-12
gi|20129385|ref|NP_609235.1| CG13095-PA [Drosophila melanogaster... 75 3e-12
gi|24583545|ref|NP_609457.1| CG6508-PA [Drosophila melanogaster]... 75 3e-12
gi|1169175|sp|P40782|CYP1_CYNCA Cyprosin precursor >gnl|BL_ORD_I... 75 3e-12
gi|129783|sp|P27822|PEP3_RABIT Pepsin III precursor (Pepsin A) >... 75 3e-12
gi|21392388|dbj|BAC00850.1| pepsinogen [Aspergillus oryzae] 75 3e-12
gi|629757|pir||S47096 cynarase (EC 3.4.23.-) - cardoon 75 3e-12
gi|28849951|ref|NP_788787.1| pregnancy-associated glycoprotein 2... 75 3e-12
gi|3392909|emb|CAA20104.1| EG:EG0001.1 [Drosophila melanogaster] 75 4e-12
gi|17986011|ref|NP_525030.1| CG13374-PA [Drosophila melanogaster... 75 4e-12
gi|6981472|ref|NP_036774.1| renin 1; Renin [Rattus norvegicus] >... 75 4e-12
gi|48675385|ref|NP_001001600.1| pepsinogen A [Bos taurus] >gnl|B... 75 4e-12
gi|223468|prf||0807285A renin precursor 75 4e-12
gi|2118133|pir||JC4870 pepsin A (EC 3.4.23.1) precursor - soft-s... 75 4e-12
gi|4506475|ref|NP_000528.1| renin precursor; angiotensin-forming... 75 4e-12
gi|50345843|gb|AAT74864.1| prorenin [Macaca mulatta] 75 4e-12
gi|1778026|gb|AAB63442.1| aspartic proteinase [Schistosoma mansoni] 75 4e-12
gi|443239|pdb|1RNE| Renin (Activated, Glycosylated, Inhibited) ... 75 4e-12
gi|37790800|gb|AAR03502.1| renin [Homo sapiens] 75 4e-12
gi|12231180|dbj|BAB20973.1| aspartic proteinase 5 [Nepenthes alata] 75 4e-12
gi|337347|gb|AAA60364.1| renin 75 4e-12
gi|871442|emb|CAA25391.1| renin [Mus musculus] 75 4e-12
gi|200688|gb|AAA40043.1| renin (Ren-1-d) 75 4e-12
gi|38073842|ref|XP_110285.2| similar to renin (Ren-1-d) [Mus mus... 75 4e-12
gi|1065326|pdb|1HRN|A Chain A, Renin Complexed With Polyhydroxym... 75 4e-12
gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata] 75 4e-12
gi|16974928|pdb|1FLH|A Chain A, Crystal Structure Of Human Urope... 74 5e-12
gi|48103318|ref|XP_392857.1| similar to aspartic protease [Apis ... 74 5e-12
gi|34912092|ref|NP_917393.1| putative aspartic protease [Oryza s... 74 5e-12
gi|18152941|gb|AAB68519.2| proteinase A [Pichia angusta] 74 5e-12
gi|34912970|ref|NP_917832.1| putative aspartic protease [Oryza s... 74 7e-12
gi|12082176|dbj|BAB20798.1| pepsinogen A [Xenopus laevis] 74 7e-12
gi|129792|sp|P00790|PEPA_HUMAN Pepsin A precursor >gnl|BL_ORD_ID... 74 7e-12
gi|25290000|pir||JC7574 pepsinogen A - African clawed frog 74 7e-12
gi|13654253|ref|NP_112470.1| renin 2 tandem duplication of Ren1 ... 74 7e-12
gi|6978973|dbj|BAA90785.1| aspartic proteinase family member sim... 74 7e-12
gi|8896140|gb|AAF81255.1| pregnancy-associated glycoprotein 6 [S... 74 7e-12
gi|1065258|pdb|1PSN| Pepsin 3a (E.C.3.4.23.1) >gnl|BL_ORD_ID|25... 74 7e-12
gi|223891|prf||1004236A renin 74 9e-12
gi|21629629|gb|AAM61957.1| synthetic renin 2/1d [Mus musculus] 74 9e-12
gi|34576991|gb|AAQ75735.1| pregnancy-associated glycoprotein 8 [... 74 9e-12
gi|13897888|gb|AAK48494.1| putative aspartic protease [Ipomoea b... 74 9e-12
gi|48374065|ref|NP_001001536.1| pregnancy-associated glycoprotei... 74 9e-12
gi|9798660|dbj|BAB11752.1| pepsinogen A [Canis familiaris] 74 9e-12
gi|21616053|emb|CAC86004.1| aspartic proteinase [Theobroma cacao] 74 9e-12
gi|46397366|sp|P14091|CATE_HUMAN Cathepsin E precursor 73 1e-11
gi|132329|sp|P00796|RENS_MOUSE Renin 2 precursor (Angiotensinoge... 73 1e-11
gi|23943854|ref|NP_055039.1| pepsinogen 5, group I (pepsinogen A... 73 1e-11
gi|18203305|sp|Q9N2D4|PEPA_CALJA Pepsin A precursor >gnl|BL_ORD_... 73 1e-11
gi|129780|sp|P27677|PEP2_MACFU Pepsin A-2/A-3 precursor (Pepsin ... 73 2e-11
gi|101979|pir||S03433 candidapepsin (EC 3.4.23.24) precursor - y... 73 2e-11
gi|6680552|ref|NP_032463.1| napsin A aspartic peptidase; kidney-... 73 2e-11
gi|12832561|dbj|BAB22158.1| unnamed protein product [Mus musculus] 73 2e-11
gi|494607|pdb|1SMR|A Chain A, Renin (E.C.3.4.23.15) Complex With... 73 2e-11
gi|1585064|prf||2124254A pepsin:ISOTYPE=3a >gnl|BL_ORD_ID|864601... 73 2e-11
gi|115721|sp|P25796|CATE_CAVPO Cathepsin E precursor >gnl|BL_ORD... 73 2e-11
gi|30575834|gb|AAP32823.1| aspartyl proteinase [Paracoccidioides... 72 2e-11
gi|21907887|dbj|BAC05688.1| aspartic protease BmAsp-1 [Brugia ma... 72 2e-11
gi|4503145|ref|NP_001901.1| cathepsin E isoform a preproprotein;... 72 2e-11
gi|41053329|ref|NP_956325.1| Unknown (protein for MGC:63831); wu... 72 2e-11
gi|9798656|dbj|BAB11750.1| pepsinogen A [Sorex unguiculatus] 72 3e-11
gi|129787|sp|P28713|PEP4_RABIT Pepsin II-4 precursor (Pepsin A) ... 72 3e-11
gi|1585066|prf||2124254C pepsin:ISOTYPE=3c 72 3e-11
gi|164604|gb|AAA31096.1| pepsinogen A precursor 72 3e-11
gi|5921651|gb|AAD56284.1| pepsinogen A form IIb precursor [Pseud... 72 3e-11
gi|15079273|gb|AAH11473.1| Renin 2 tandem duplication of Ren1 [M... 72 3e-11
gi|27803878|gb|AAO22152.1| cathepsin D-like aspartic protease [A... 72 3e-11
gi|231168|pdb|5PEP| Pepsin (E.C.3.4.23.1) 72 3e-11
gi|49522906|gb|AAH75134.1| Unknown (protein for IMAGE:7009273) [... 72 3e-11
gi|38195404|gb|AAR13364.1| aspartic proteinase precursor [Botryo... 71 5e-11
gi|6224883|gb|AAF05996.1| pregnancy-associated glycoprotein-13 [... 71 5e-11
gi|39588731|emb|CAE58255.1| Hypothetical protein CBG01356 [Caeno... 71 5e-11
gi|19911571|dbj|BAB86888.1| pepsinogen B [Canis familiaris] 71 5e-11
gi|625423|pir||A30142 pepsin A (EC 3.4.23.1) 5 precursor - human 71 5e-11
gi|6978719|ref|NP_037070.1| cathepsin E [Rattus norvegicus] >gnl... 71 5e-11
gi|387013|gb|AAA60061.1| pepsinogen A 71 5e-11
gi|2499826|sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein ... 71 5e-11
gi|6760077|gb|AAF28186.1| aspartyl proteinase [Coccidioides immi... 71 5e-11
gi|24647683|ref|NP_650623.1| CG5863-PA [Drosophila melanogaster]... 71 5e-11
gi|2136603|pir||I46617 pregnancy-associated glycoprotein - pig >... 71 5e-11
gi|494476|pdb|1PSA|A Chain A, Pepsin Hydrolase (Acid Proteinase)... 71 5e-11
gi|46309251|dbj|BAD15111.1| cathepsin D [Todarodes pacificus] 71 5e-11
gi|49019533|emb|CAD80098.1| gastricsin [Trematomus bernacchii] 71 5e-11
gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum] 71 5e-11
gi|230676|pdb|2PSG| Pepsinogen >gnl|BL_ORD_ID|1163236 gi|230912... 71 6e-11
gi|15425751|dbj|BAB64296.1| aspartic proteinase 2 [Glycine max] 71 6e-11
gi|30024582|dbj|BAC75704.1| proteinase A [Candida boidinii] 71 6e-11
gi|230907|pdb|3PEP| Pepsin (E.C.3.4.23.1) >gnl|BL_ORD_ID|165015... 71 6e-11
gi|13096225|pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pep... 71 6e-11
gi|38303893|gb|AAH62002.1| Ctse protein [Rattus norvegicus] 71 6e-11
gi|2851407|sp|P16228|CATE_RAT Cathepsin E precursor >gnl|BL_ORD_... 71 6e-11
gi|17560028|ref|NP_505132.1| predicted CDS, aspartic protease fa... 70 8e-11
gi|48734644|gb|AAH72252.1| Unknown (protein for MGC:82347) [Xeno... 70 8e-11
gi|625424|pir||B30142 pepsin A (EC 3.4.23.1) 4 precursor - human 70 8e-11
gi|2510|emb|CAA31962.1| pre-aspartyl proteinase [Candida albicans] 70 8e-11
gi|6325103|ref|NP_015171.1| vacuolar proteinase A; Pep4p [Saccha... 70 8e-11
gi|22651403|gb|AAL61540.1| cathepsin D precursor [Danio rerio] 70 1e-10
gi|27503926|gb|AAH42316.1| Ctsd protein [Danio rerio] >gnl|BL_OR... 70 1e-10
gi|21392384|dbj|BAC00849.1| secreted aspartic protease [Aspergil... 70 1e-10
gi|109340|pir||C38302 pepsin (EC 3.4.23.-) II-2/3 precursor - ra... 70 1e-10
gi|129781|sp|P27821|PEP2_RABIT Pepsin II-2/3 precursor (Pepsin A... 70 1e-10
gi|6180001|gb|AAF05747.1| pregnancy-associated glycoprotein-8 [C... 70 1e-10
gi|21063965|gb|AAM29212.1| AT05209p [Drosophila melanogaster] 70 1e-10
gi|24653643|ref|NP_610961.1| CG10104-PA [Drosophila melanogaster... 70 1e-10
gi|50260546|gb|EAL23201.1| hypothetical protein CNBA5450 [Crypto... 70 1e-10
gi|1858020|gb|AAC60301.1| cathepsin D [Oncorhynchus mykiss] 70 1e-10
gi|23509298|ref|NP_701965.1| plasmepsin 2 precursor [Plasmodium ... 70 1e-10
gi|104296|pir||A39314 gastricsin (EC 3.4.23.3) precursor - bullf... 70 1e-10
gi|50547309|ref|XP_501124.1| hypothetical protein [Yarrowia lipo... 70 1e-10
gi|21552717|gb|AAM62283.1| cathepsin D preproprotein [Silurus as... 70 1e-10
gi|21355083|ref|NP_652013.1| CG1548-PA [Drosophila melanogaster]... 70 1e-10
gi|13928928|ref|NP_113858.1| kidney-derived aspartic protease-li... 69 2e-10
gi|28603726|ref|NP_788797.1| pregnancy-associated glycoprotein 1... 69 2e-10
gi|50547341|ref|XP_501140.1| hypothetical protein [Yarrowia lipo... 69 2e-10
gi|25290001|pir||JC7575 pepsinogen A - bullfrog >gnl|BL_ORD_ID|3... 69 2e-10
gi|2664292|emb|CAA75754.1| cellular aspartic protease [Aspergill... 69 2e-10
gi|1710090|sp|P52115|RENI_SHEEP Renin precursor (Angiotensinogen... 69 2e-10
gi|14278413|pdb|1G0V|A Chain A, The Structure Of Proteinase A Co... 69 2e-10
gi|5748654|emb|CAA08880.2| cathepsin E protein [Mus musculus] 69 2e-10
gi|2288908|emb|CAA71859.1| cathepsin E [Mus musculus] 69 2e-10
gi|129793|sp|P11489|PEPA_MACMU Pepsin A precursor >gnl|BL_ORD_ID... 69 3e-10
gi|129776|sp|P03954|PEP1_MACFU Pepsin A-1 precursor (Pepsin III-... 69 3e-10
gi|2624629|pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A >... 69 3e-10
gi|7766834|pdb|1DP5|A Chain A, The Structure Of Proteinase A Com... 69 3e-10
gi|18858489|ref|NP_571785.1| cathepsin D; etID16901.18 [Danio re... 69 3e-10
gi|22219360|pdb|1M43|A Chain A, Crystal Structure Of Pmii In Com... 69 3e-10
gi|40557501|gb|AAR88049.1| pregnancy-associated glycoprotein 7 [... 69 3e-10
gi|6561816|gb|AAF17080.1| aspartyl protease 3 [Homo sapiens] 69 3e-10
gi|2811025|sp|O04057|ASPR_CUCPE Aspartic proteinase precursor >g... 68 4e-10
gi|50255620|gb|EAL18353.1| hypothetical protein CNBJ2760 [Crypto... 68 4e-10
gi|31559113|gb|AAP50847.1| cathepsin D [Bombyx mori] 68 4e-10
gi|1942549|pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degra... 68 5e-10
gi|4389167|pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium ... 68 5e-10
gi|49077340|ref|XP_402541.1| hypothetical protein UM04926.1 [Ust... 68 5e-10
gi|19851890|gb|AAL99906.1| chymosin precursor [Bos taurus] 68 5e-10
gi|858754|gb|AAA68217.1| aspartic proteinase 68 5e-10
gi|50549149|ref|XP_502045.1| hypothetical protein [Yarrowia lipo... 68 5e-10
gi|24987569|pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin ... 68 5e-10
gi|162856|gb|AAA30446.1| chymosin 68 5e-10
gi|1172530|sp|P46925|PLM2_PLAFA Plasmepsin 2 precursor (Aspartic... 68 5e-10
gi|38102423|gb|EAA49264.1| hypothetical protein MG00922.4 [Magna... 67 7e-10
gi|510880|emb|CAA56373.1| putative aspartic protease [Brassica o... 67 7e-10
gi|1246039|gb|AAB35843.1| pepsinogen 2 [tuna, Peptide, 360 aa] 67 9e-10
gi|230825|pdb|3CMS| Chymosin B (Formerly Known As Rennin) (E.C.... 67 9e-10
gi|229748|pdb|1CMS| Chymosin B (Formerly Known As Rennin) (E.C.... 67 9e-10
gi|6739580|gb|AAF27315.1| prochymosin [Bubalus bubalis] 67 9e-10
gi|129786|sp|P27678|PEP4_MACFU Pepsin A-4 precursor (Pepsin I/II... 67 9e-10
gi|50760547|ref|XP_425832.1| PREDICTED: similar to pepsinogen B ... 67 9e-10
gi|6681081|ref|NP_031825.1| cathepsin E preproprotein [Mus muscu... 67 9e-10
gi|46395760|sp|Q805F2|CTE2_XENLA Cathepsin E2 precursor >gnl|BL_... 67 9e-10
gi|28849955|ref|NP_788795.1| pregnancy-associated glycoprotein 1... 67 9e-10
gi|162858|gb|AAA30447.1| preprochymosin a [Bos taurus] 67 9e-10
gi|625238|pir||CMBO chymosin (EC 3.4.23.4) precursor - bovine 67 9e-10
gi|116403|sp|P00794|CHYM_BOVIN Chymosin precursor (Preprorennin) 67 9e-10
gi|24647679|ref|NP_650621.1| CG17283-PA [Drosophila melanogaster... 67 1e-09
gi|9581805|emb|CAC00543.1| necepsin II [Necator americanus] 67 1e-09
gi|3378161|emb|CAA07719.1| cathepsin D [Chionodraco hamatus] 67 1e-09
gi|47523112|ref|NP_999038.1| pepsin; pepsinogen [Sus scrofa] >gn... 67 1e-09
gi|116405|sp|P18276|CHYM_SHEEP Chymosin precursor (Preprorennin)... 67 1e-09
gi|21392382|dbj|BAC00848.1| aspartic protease [Aspergillus oryzae] 67 1e-09
gi|45360583|ref|NP_988964.1| hypothetical protein MGC76043 [Xeno... 66 1e-09
gi|47211933|emb|CAF92442.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|17561740|ref|NP_503825.1| aspartic protease family member (5D... 66 2e-09
gi|28189935|dbj|BAC56582.1| similar to pregnancy-associated glyc... 66 2e-09
gi|28189895|dbj|BAC56562.1| similar to aspartic proteinase [Bos ... 66 2e-09
gi|28436104|dbj|BAC57431.1| cathepsin D [Xenopus laevis] 66 2e-09
gi|49070738|ref|XP_399658.1| hypothetical protein UM02043.1 [Ust... 66 2e-09
gi|28189535|dbj|BAC56382.1| similar to aspartic proteinase [Bos ... 66 2e-09
gi|28189755|dbj|BAC56492.1| similar to aspartic proteinase [Bos ... 66 2e-09
gi|46395759|sp|Q800A0|CATE_RANCA Cathepsin E precursor >gnl|BL_O... 66 2e-09
gi|28189889|dbj|BAC56559.1| similar to aspartic proteinase [Bos ... 66 2e-09
gi|50555686|ref|XP_505251.1| hypothetical protein [Yarrowia lipo... 66 2e-09
gi|3095036|gb|AAC15793.1| plasmepsin [Plasmodium ovale] 66 2e-09
gi|11120702|ref|NP_068521.1| pepsinogen F protein [Rattus norveg... 65 2e-09
gi|25289999|pir||JC7573 pepsinogen C - African clawed frog >gnl|... 65 2e-09
gi|34146966|gb|AAB65877.2| Hypothetical protein F59D6.2 [Caenorh... 65 3e-09
gi|21914374|gb|AAM81358.1| aspartyl proteinase [Leptosphaeria ma... 65 3e-09
gi|46138535|ref|XP_390958.1| hypothetical protein FG10782.1 [Gib... 65 3e-09
gi|17981530|gb|AAL51056.1| cathepsin D [Apriona germari] 65 3e-09
gi|30794284|ref|NP_851337.1| prochymosin; chymosin precursor; re... 65 3e-09
gi|1168764|sp|P43092|CAR3_CANAL Candidapepsin 3 precursor (Aspar... 65 4e-09
gi|28189885|dbj|BAC56557.1| similar to aspartic proteinase [Bos ... 65 4e-09
gi|6180007|gb|AAF05750.1| pregnancy-associated glycoprotein-11 [... 65 4e-09
gi|6179991|gb|AAF05742.1| pregnancy-associated glycoprotein-3 [C... 65 4e-09
gi|28603718|ref|NP_788792.1| pregnancy-associated glycoprotein 8... 65 4e-09
gi|4099023|gb|AAD00524.1| aspartic protease [Onchocerca volvulus] 64 6e-09
gi|45384244|ref|NP_990385.1| pepsinogen [Gallus gallus] >gnl|BL_... 64 6e-09
gi|360431|prf||1403354A pepsinogen 64 6e-09
gi|350733|prf||0803215A rennin,pro 64 6e-09
gi|50419019|ref|XP_458031.1| unnamed protein product [Debaryomyc... 64 6e-09
gi|17389633|gb|AAH17842.1| Pronapsin A [Homo sapiens] 64 7e-09
gi|4758754|ref|NP_004842.1| NAPSA gene product [Homo sapiens] >g... 64 7e-09
gi|47086317|ref|NP_998025.1| renin; renin precursor [Danio rerio... 64 7e-09
gi|1168791|sp|P43159|CATE_RABIT Cathepsin E precursor >gnl|BL_OR... 64 7e-09
gi|37787745|gb|AAO41706.1| renin precursor [Danio rerio] 64 9e-09
gi|32421211|ref|XP_331049.1| VACUOLAR PROTEASE A PRECURSOR [Neur... 64 9e-09
gi|2499817|sp|Q01294|CARP_NEUCR Vacuolar protease A precursor >g... 64 9e-09
gi|17561738|ref|NP_503826.1| aspartic protease precursor family ... 64 9e-09
gi|47223178|emb|CAG11313.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|2055433|gb|AAB53224.1| pregnancy-associated glycoprotein 3 [O... 63 1e-08
gi|46395761|sp|Q805F3|CTE1_XENLA Cathepsin E1 precursor >gnl|BL_... 63 1e-08
gi|47215111|emb|CAG02535.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|16119024|gb|AAL14708.1| aspartic protease [Clonorchis sinensis] 63 2e-08
gi|11990126|emb|CAC19554.1| chymosin [Camelus dromedarius] 63 2e-08
gi|2689727|gb|AAB91422.1| pregnancy-associated glycoprotein [Fel... 62 2e-08
gi|4927648|gb|AAD33219.1| cathepsin D; lysosomal aspartic protei... 62 2e-08
gi|416749|sp|P32951|CAR1_CANPA Candidapepsin 1 precursor (Aspart... 62 2e-08
gi|11493777|gb|AAG35646.1| progastricsin [Salvelinus fontinalis] 62 2e-08
gi|3095038|gb|AAC15794.1| plasmepsin [Plasmodium malariae] 62 3e-08
gi|6179995|gb|AAF05744.1| pregnancy-associated glycoprotein-5 [C... 62 3e-08
gi|3550545|emb|CAA11249.1| plasmepsin [Plasmodium berghei] 62 3e-08
gi|39540664|tpg|DAA01803.1| TPA: pro-renin [Takifugu rubripes] 62 3e-08
gi|109130|pir||A41545 pregnancy-specific antigen 1 precursor - s... 62 4e-08
gi|23110952|ref|NP_683865.1| cathepsin E isoform b preproprotein... 62 4e-08
gi|3378673|emb|CAA08878.1| Cathepsin D [Podarcis sicula] 62 4e-08
gi|2499827|sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotei... 62 4e-08
gi|50728326|ref|XP_416090.1| PREDICTED: similar to aspartic prot... 62 4e-08
gi|50306705|ref|XP_453326.1| unnamed protein product [Kluyveromy... 61 5e-08
gi|9858101|gb|AAG00993.1| heme-binding aspartic proteinase [Boop... 61 5e-08
gi|2136604|pir||I47176 chymosin (EC 3.4.23.4) precursor - pig (f... 61 5e-08
gi|28603734|ref|NP_788801.1| pregnancy-associated glycoprotein 1... 61 5e-08
gi|16415894|emb|CAD01097.1| putative aspartyl-proteinase [Pleuro... 61 5e-08
gi|28189703|dbj|BAC56466.1| similar to pregnancy-associated glyc... 61 5e-08
gi|45384002|ref|NP_990508.1| prepro-cathepsin D; prepro-cathepsi... 60 8e-08
gi|12043774|gb|AAG47643.1| progastricsin [Salvelinus fontinalis] 60 8e-08
gi|24580868|ref|NP_722706.1| CG31926-PA [Drosophila melanogaster... 60 1e-07
gi|7341306|gb|AAF61241.1| pepsinogen F [Mus musculus] 60 1e-07
gi|31981154|ref|NP_067428.2| pepsinogen 5, group I; pepsinogen F... 60 1e-07
gi|477734|pir||B47701 aspartic proteinase ACPR (EC 3.4.23.-) pre... 60 1e-07
gi|4927642|gb|AAD33216.1| secreted aspartic protease 2 [Candida ... 60 1e-07
gi|16507116|gb|AAL24045.1| aspartic proteinase [Plasmodium chaba... 60 1e-07
gi|402686|gb|AAA30684.1| pregnancy-specific glycoprotein 59 2e-07
gi|11265726|pir||T45035 hypothetical protein Y39B6B.i [imported]... 59 2e-07
gi|25154801|ref|NP_741675.1| predicted CDS, aspartic protease pr... 59 2e-07
gi|2499824|sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein... 59 2e-07
gi|2144165|pir||JC5077 aspartic proteinase (EC 3.4.23.-) - dog h... 59 2e-07
gi|49175772|gb|AAR87746.2| aspartic proteinase precursor [Botryo... 59 2e-07
gi|2499825|sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein ... 59 2e-07
gi|50545607|ref|XP_500342.1| hypothetical protein [Yarrowia lipo... 59 2e-07
gi|28189719|dbj|BAC56474.1| similar to aspartic proteinase [Bos ... 59 3e-07
gi|6179993|gb|AAF05743.1| pregnancy-associated glycoprotein-4 [C... 59 3e-07
gi|28603710|ref|NP_788788.1| pregnancy-associated glycoprotein 4... 59 3e-07
gi|24580865|ref|NP_722705.1| CG31928-PA [Drosophila melanogaster... 59 3e-07
gi|47523226|ref|NP_998974.1| pregnancy-associated glycoprotein 3... 59 3e-07
gi|19851892|gb|AAL99907.1| chymosin precursor [Bos taurus] 58 4e-07
gi|24159077|pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmeps... 58 4e-07
gi|49175773|gb|AAR87747.2| aspartic proteinase precursor [Botryo... 58 4e-07
gi|299522|gb|AAB26186.1| cathepsin D {EC 3.4.23.5} [cattle, Pept... 58 4e-07
gi|40557503|gb|AAR88050.1| pregnancy-associated glycoprotein 8 [... 58 4e-07
gi|3095034|gb|AAC15792.1| plasmepsin [Plasmodium vivax] >gnl|BL_... 58 4e-07
gi|47213062|emb|CAF91576.1| unnamed protein product [Tetraodon n... 58 4e-07
gi|19851894|gb|AAL99908.1| chymosin precursor [Bos taurus] 58 4e-07
gi|13637914|sp|P80209|CATD_BOVIN Cathepsin D precursor 58 4e-07
gi|12697815|dbj|BAB21620.1| cathepsin D [Bos taurus] 58 4e-07
gi|23483602|gb|EAA19219.1| plasmepsin [Plasmodium yoelii yoelii] 58 5e-07
gi|2689725|gb|AAB91421.1| pregnancy-associated glycoprotein [Equ... 58 5e-07
gi|40557495|gb|AAR88046.1| pregnancy-associated glycoprotein 4 [... 58 5e-07
gi|28603732|ref|NP_788800.1| pregnancy-associated glycoprotein 1... 58 5e-07
gi|28603738|ref|NP_788803.1| pregnancy-associated glycoprotein 2... 58 5e-07
gi|6180005|gb|AAF05749.1| pregnancy-associated glycoprotein-10 [... 57 7e-07
gi|50294061|ref|XP_449442.1| unnamed protein product [Candida gl... 57 7e-07
gi|23509297|ref|NP_701964.1| plasmepsin 1 precursor [Plasmodium ... 57 7e-07
gi|1619323|emb|CAA69878.1| aspartic protease [Trematomus bernacc... 57 7e-07
gi|46441787|gb|EAL01081.1| hypothetical protein CaO19.242 [Candi... 57 7e-07
gi|2055435|gb|AAB53225.1| pregnancy-associated glycoprotein 4 [O... 57 7e-07
gi|28189803|dbj|BAC56516.1| similar to pregnancy-associated glyc... 57 7e-07
gi|3024354|sp|P56272|PEP1_GADMO Pepsin IIB >gnl|BL_ORD_ID|116723... 57 9e-07
gi|28207660|gb|AAO32627.1| pregnancy-associated glycoprotein 5 [... 57 9e-07
gi|5542467|pdb|1QS8|A Chain A, Crystal Structure Of The P. Vivax... 57 9e-07
gi|6179987|gb|AAF05740.1| pregnancy-associated glycoprotein-1 [C... 57 9e-07
gi|40557487|gb|AAR88042.1| pregnancy-associated glycoprotein 1 [... 57 9e-07
gi|3334136|sp|O42778|CAR8_CANAL Candidapepsin 8 precursor (Aspar... 57 9e-07
gi|28603716|ref|NP_788791.1| pregnancy-associated glycoprotein 7... 57 9e-07
gi|7548466|gb|AAA34371.2| secreted aspartyl proteinase 1 [Candid... 57 1e-06
gi|40557505|gb|AAR88051.1| pregnancy-associated glycoprotein 9 [... 57 1e-06
gi|40557491|gb|AAR88044.1| pregnancy-associated glycoprotein 2 v... 57 1e-06
gi|40557489|gb|AAR88043.1| pregnancy-associated glycoprotein 2 [... 57 1e-06
gi|45643446|gb|AAS72876.1| aspartyl protease [Triatoma infestans] 57 1e-06
gi|28189897|dbj|BAC56563.1| similar to aspartic proteinase [Bos ... 57 1e-06
gi|1929102|emb|CAA72511.1| extracellular aspartic proteinase [Rh... 56 2e-06
gi|7435833|pir||JE0371 pepsin C (EC 3.4.23.-) precursor - chicken 56 2e-06
gi|4589842|dbj|BAA76892.1| pepsinogen C [Gallus gallus] 56 2e-06
gi|45382395|ref|NP_990208.1| pepsinogen C [Gallus gallus] >gnl|B... 56 2e-06
gi|50548623|ref|XP_501781.1| hypothetical protein [Yarrowia lipo... 56 2e-06
gi|18859121|ref|NP_571879.1| nothepsin; aspartic proteinase [Dan... 56 2e-06
gi|50545213|ref|XP_500144.1| hypothetical protein [Yarrowia lipo... 55 3e-06
gi|17549907|ref|NP_509142.1| aspartic protease (43.4 kD) (asp-3)... 55 3e-06
gi|627805|pir||A61388 renin (EC 3.4.23.15) - rabbit (fragment) 55 3e-06
gi|26354406|dbj|BAC40831.1| unnamed protein product [Mus musculus] 55 3e-06
gi|6753556|ref|NP_034113.1| cathepsin D [Mus musculus] >gnl|BL_O... 55 3e-06
gi|28603736|ref|NP_788802.1| pregnancy-associated glycoprotein 2... 55 3e-06
gi|18203300|sp|Q9MZS8|CATD_SHEEP Cathepsin D precursor >gnl|BL_O... 55 3e-06
gi|28603720|ref|NP_788793.1| pregnancy-associated glycoprotein 9... 55 3e-06
gi|50513832|pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspep... 55 3e-06
gi|35952|emb|CAA24937.1| unnamed protein product [Homo sapiens] 55 3e-06
gi|4503143|ref|NP_001900.1| cathepsin D preproprotein [Homo sapi... 55 3e-06
gi|67678|pir||KHPGD cathepsin D (EC 3.4.23.5) - pig 55 3e-06
gi|50593064|gb|AAT79343.1| ASP-1 [Parastrongyloides trichosuri] 55 3e-06
gi|30584113|gb|AAP36305.1| Homo sapiens cathepsin D (lysosomal a... 55 3e-06
gi|230424|pdb|2APR| Acid Proteinase (Rhizopuspepsin) (E.C.3.4.2... 55 4e-06
gi|360235|prf||1402278B rhizopuspepsin II 55 4e-06
gi|625239|pir||A26681 rhizopuspepsin (EC 3.4.23.21) II precursor... 55 4e-06
gi|169742|gb|AAA33881.1| rhizopuspepsinogen precursor [Rhizopus ... 55 4e-06
gi|1705599|sp|P06026|CARP_RHICH Rhizopuspepsin precursor >gnl|BL... 55 4e-06
gi|169740|gb|AAA33879.1| rhizopuspepsin precursor (EC 3.4.23.6) 55 4e-06
gi|28189627|dbj|BAC56428.1| similar to pregnancy-associated glyc... 55 4e-06
gi|115720|sp|P24268|CATD_RAT Cathepsin D precursor >gnl|BL_ORD_I... 54 6e-06
gi|42476045|ref|NP_599161.2| cathepsin D [Rattus norvegicus] >gn... 54 6e-06
gi|494295|pdb|1LYA|A Chain A, Cathepsin D (E.C.3.4.23.5) >gnl|BL... 54 6e-06
gi|2055445|gb|AAB53230.1| pregnancy-associated glycoprotein 9 [O... 54 6e-06
gi|115639|sp|P00799|CARP_RHIMI Mucorpepsin precursor (Mucor renn... 54 6e-06
gi|2554745|pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex 54 6e-06
gi|40557497|gb|AAR88047.1| pregnancy-associated glycoprotein 5 [... 54 8e-06
gi|2055439|gb|AAB53227.1| pregnancy-associated glycoprotein 6 [O... 54 8e-06
gi|38197533|gb|AAH61685.1| MGC68767 protein [Xenopus laevis] 54 8e-06
gi|28189539|dbj|BAC56384.1| similar to aspartic proteinase [Bos ... 54 8e-06
gi|47198554|emb|CAF89152.1| unnamed protein product [Tetraodon n... 54 1e-05
gi|40557493|gb|AAR88045.1| pregnancy-associated glycoprotein 3 [... 54 1e-05
gi|18203303|sp|Q9N2D2|CHYM_CALJA Chymosin precursor (Preprorenni... 54 1e-05
gi|6224885|gb|AAF05997.1| pregnancy-associated glycoprotein-14 [... 53 1e-05
gi|1705595|sp|P43231|CAR2_RHINI Rhizopuspepsin 2 precursor (Aspa... 53 1e-05
gi|2055437|gb|AAB53226.1| pregnancy-associated glycoprotein 5 [O... 53 1e-05
gi|14488780|pdb|1J71|A Chain A, Structure Of The Extracellular A... 53 1e-05
gi|6179999|gb|AAF05746.1| pregnancy-associated glycoprotein-7 [C... 53 1e-05
gi|1942831|pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap... 53 2e-05
gi|1585068|prf||2124256A Asp protease:ISOTYPE=prepro=1-56 53 2e-05
gi|7435834|pir||T10264 pregnancy-specific antigen 7 precursor - ... 53 2e-05
gi|115640|sp|P10602|CAR1_RHINI Rhizopuspepsin 1 precursor (Aspar... 53 2e-05
gi|28603714|ref|NP_788790.1| pregnancy-associated glycoprotein 6... 52 2e-05
gi|1168765|sp|Q03699|CAR3_RHINI Rhizopuspepsin 3 precursor (Aspa... 52 2e-05
gi|28189805|dbj|BAC56517.1| similar to pregnancy-associated glyc... 52 2e-05
gi|25290002|pir||C96715 protein F4N2.8 [imported] - Arabidopsis ... 52 2e-05
gi|28603730|ref|NP_788799.1| pregnancy-associated glycoprotein 1... 52 2e-05
gi|115719|sp|P00795|CATD_PIG Cathepsin D 52 2e-05
gi|50259458|gb|EAL22131.1| hypothetical protein CNBC2690 [Crypto... 52 2e-05
gi|20875195|ref|XP_131138.1| similar to prochymosin [Mus musculus] 52 3e-05
gi|101001|pir||A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus... 52 3e-05
gi|1478380|gb|AAB36149.1| SAP2=major secreted aspartic proteinas... 52 3e-05
gi|499671|gb|AAA33880.1| rhizopuspepsin I 52 3e-05
gi|50553977|ref|XP_504397.1| hypothetical protein [Yarrowia lipo... 52 3e-05
gi|1827844|pdb|2ASI| Aspartic Proteinase 52 3e-05
gi|5915874|sp|P81214|CARP_SYNRA Syncephapepsin precursor >gnl|BL... 52 3e-05
gi|32420321|ref|XP_330604.1| hypothetical protein [Neurospora cr... 52 3e-05
gi|20378984|gb|AAM21051.1| secreted aspartic proteinase 2 [Candi... 52 4e-05
gi|3152654|gb|AAC17105.1| aspartic protease precursor [Phaffia r... 52 4e-05
gi|915540|gb|AAA73628.1| pregnancy-specific antigen 52 4e-05
gi|50551395|ref|XP_503171.1| hypothetical protein [Yarrowia lipo... 52 4e-05
gi|23509296|ref|NP_701963.1| plasmepsin, putative [Plasmodium fa... 51 5e-05
gi|6180003|gb|AAF05748.1| pregnancy-associated glycoprotein-9 [C... 51 5e-05
gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin ... 51 5e-05
gi|50548755|ref|XP_501847.1| hypothetical protein [Yarrowia lipo... 51 5e-05
gi|109338|pir||A38302 pepsin (EC 3.4.23.-) F precursor - rabbit 51 5e-05
gi|2094893|pdb|1ZAP| Secreted Aspartic Protease From C. Albicans 51 5e-05
gi|28189673|dbj|BAC56451.1| similar to pregnancy-associated glyc... 51 6e-05
gi|6323149|ref|NP_013221.1| Aspartic protease, attached to the p... 51 6e-05
gi|38110671|gb|EAA56356.1| hypothetical protein MG06327.4 [Magna... 51 6e-05
gi|49522956|gb|AAH75272.1| Unknown (protein for MGC:88899) [Xeno... 51 6e-05
gi|129802|sp|P27823|PEPF_RABIT Pepsin F precursor >gnl|BL_ORD_ID... 50 8e-05
gi|28603712|ref|NP_788789.1| pregnancy-associated glycoprotein 5... 50 8e-05
gi|28603728|ref|NP_788798.1| pregnancy-associated glycoprotein 1... 50 8e-05
gi|6179997|gb|AAF05745.1| pregnancy-associated glycoprotein-6 [C... 50 8e-05
gi|40557499|gb|AAR88048.1| pregnancy-associated glycoprotein 6 [... 50 8e-05
gi|6179989|gb|AAF05741.1| pregnancy-associated glycoprotein-2 [C... 50 8e-05
gi|50257335|gb|EAL20044.1| hypothetical protein CNBF3700 [Crypto... 50 1e-04
gi|28189779|dbj|BAC56504.1| similar to pregnancy-associated glyc... 50 1e-04
gi|38048659|gb|AAR10232.1| similar to Drosophila melanogaster CG... 50 1e-04
gi|27806043|ref|NP_776836.1| pregnancy-associated glycoprotein 1... 50 1e-04
gi|2055443|gb|AAB53229.1| pregnancy-associated glycoprotein 8 [O... 50 1e-04
gi|49066778|ref|XP_397679.1| hypothetical protein UM00064.1 [Ust... 50 1e-04
gi|33347411|gb|AAQ15288.1| aspartic protease [Pyrus pyrifolia] 50 1e-04
gi|9910338|ref|NP_064476.1| prochymosin [Rattus norvegicus] >gnl... 50 1e-04
gi|89402|pir||S03266 aspartic proteinase (EC 3.4.23.-) (clone NM... 50 1e-04
gi|49071008|ref|XP_399793.1| hypothetical protein UM02178.1 [Ust... 50 1e-04
gi|46371116|gb|AAS90335.1| toxomepsin 1 [Toxoplasma gondii] 50 1e-04
gi|6323150|ref|NP_013222.1| Aspartic protease, attached to the p... 50 1e-04
gi|261083|gb|AAB24375.1| rennin [Mucor pusillus, Peptide, 427 aa... 50 1e-04
gi|49098328|ref|XP_410624.1| hypothetical protein AN6487.2 [Aspe... 50 1e-04
gi|443132|pdb|1MPP| Pepsin (Renin) (E.C.3.4.23.23) >gnl|BL_ORD_... 50 1e-04
gi|33347413|gb|AAQ15289.1| aspartic protease [Pyrus pyrifolia] 49 2e-04
>gi|17568861|ref|NP_509082.1| aspartic proteinase family member (XH64)
[Caenorhabditis elegans]
gi|7505697|pir||T25812 hypothetical protein K10C2.3 - Caenorhabditis
elegans
gi|13775446|gb|AAK39258.1| Hypothetical protein K10C2.3
[Caenorhabditis elegans]
Length = 410
Score = 782 bits (2019), Expect = 0.0
Identities = 393/410 (95%), Positives = 393/410 (95%)
Frame = -1
Query: 1233 MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA 1054
MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA
Sbjct: 1 MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA 60
Query: 1053 FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK 874
FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK
Sbjct: 61 FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK 120
Query: 873 TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK 694
TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK
Sbjct: 121 TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK 180
Query: 693 FMQATXXXXXXXXXXXXXXXXXGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT 514
FMQAT GFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT
Sbjct: 181 FMQATDLGLLMDGLGADGILGLGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT 240
Query: 513 DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL 334
DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL
Sbjct: 241 DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL 300
Query: 333 DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD 154
DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD
Sbjct: 301 DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD 360
Query: 153 LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD 4
LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD
Sbjct: 361 LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD 410