Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= K10C2_4
         (1233 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17568861|ref|NP_509082.1| aspartic proteinase family member (...   782   0.0
gi|39585844|emb|CAE61258.1| Hypothetical protein CBG05064 [Caeno...   526   e-148
gi|32566657|ref|NP_872129.1| aspartic protease (46.6 kD) (asp-2)...   140   6e-32
gi|7507925|pir||T29692 hypothetical protein T18H9.2 - Caenorhabd...   140   6e-32
gi|32566655|ref|NP_505384.2| aspartic protease (asp-2) [Caenorha...   140   6e-32
gi|39590347|emb|CAE66086.1| Hypothetical protein CBG11303 [Caeno...   140   8e-32
gi|39590349|emb|CAE66088.1| Hypothetical protein CBG11305 [Caeno...   139   1e-31
gi|1507727|gb|AAB06576.1| aspartic protease                           138   3e-31
gi|17557206|ref|NP_505135.1| aspartic protease (42.0 kD) (asp-5)...   136   9e-31
gi|17557208|ref|NP_505133.1| aspartic protease (41.5 kD) (asp-6)...   132   1e-29
gi|39588688|emb|CAE58212.1| Hypothetical protein CBG01307 [Caeno...   127   7e-28
gi|39588689|emb|CAE58213.1| Hypothetical protein CBG01308 [Caeno...   127   7e-28
gi|39594552|emb|CAE72130.1| Hypothetical protein CBG19226 [Caeno...   124   3e-27
gi|39590348|emb|CAE66087.1| Hypothetical protein CBG11304 [Caeno...   124   6e-27
gi|17560024|ref|NP_505134.1| aspartic protease precursor family ...   122   2e-26
gi|39581556|emb|CAE58341.1| Hypothetical protein CBG01462 [Caeno...   110   9e-23
gi|39580229|emb|CAE72985.1| Hypothetical protein CBG20329 [Caeno...   108   3e-22
gi|45752338|emb|CAE12199.1| aspartyl protease precursor [Haemonc...   106   1e-21
gi|17560290|ref|NP_505232.1| aspartic protease precursor family ...   100   5e-20
gi|25151802|ref|NP_741677.1| aspartic protease (42.7 kD) (asp-1)...   100   1e-19
gi|3413442|emb|CAA08899.1| aspartic protease [Caenorhabditis ele...    99   2e-19
gi|39584216|emb|CAE61591.1| Hypothetical protein CBG05505 [Caeno...    99   2e-19
gi|9581803|emb|CAC00542.1| necepsin I [Necator americanus]             97   8e-19
gi|46485798|gb|AAS98423.1| aspartic proteinase [Oryza sativa (ja...    97   8e-19
gi|1168537|sp|P42211|ASPR_ORYSA Aspartic proteinase precursor >g...    97   1e-18
gi|9798668|dbj|BAB11756.1| pepsinogen C [Oryctolagus cuniculus]        96   2e-18
gi|11359777|pir||T45034 hypothetical protein Y39B6B.h [imported]...    95   4e-18
gi|2499819|sp|Q42456|APR1_ORYSA Aspartic proteinase oryzasin 1 p...    94   7e-18
gi|4103749|gb|AAD09345.1| aspartic protease precursor [Strongylo...    94   9e-18
gi|17538662|ref|NP_500928.1| cathepsin e family member (4G953) [...    94   9e-18
gi|25151573|ref|NP_741673.1| aspartic protease precursor family ...    93   1e-17
gi|11359778|pir||T45036 hypothetical protein Y39B6B.j [imported]...    93   1e-17
gi|1322391|emb|CAA96571.1| parasite pepsinogen [Haemonchus conto...    93   1e-17
gi|34894316|ref|NP_908483.1| unnamed protein product [Oryza sati...    92   2e-17
gi|25155274|ref|NP_741674.1| aspartic protease precursor family ...    91   4e-17
gi|21616051|emb|CAC86003.1| aspartic proteinase [Theobroma cacao]      91   6e-17
gi|15233518|ref|NP_192355.1| aspartyl protease family protein [A...    89   2e-16
gi|17557992|ref|NP_506185.1| pepsinogen precursor family member ...    88   5e-16
gi|18203304|sp|Q9N2D3|PEPC_CALJA Gastricsin precursor (Pepsinoge...    87   8e-16
gi|9798664|dbj|BAB11754.1| pepsinogen C [Sorex unguiculatus]           87   8e-16
gi|30685656|ref|NP_193936.2| aspartyl protease family protein [A...    87   8e-16
gi|5822248|pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin...    86   1e-15
gi|1168536|sp|P42210|ASPR_HORVU Phytepsin precursor (Aspartic pr...    86   1e-15
gi|17566864|ref|NP_507653.1| predicted CDS, aspartic protease fa...    86   2e-15
gi|29244579|ref|NP_080249.2| progastricsin (pepsinogen C); urina...    86   2e-15
gi|3288145|emb|CAA76563.1| preprocathepsin D [Dictyostelium disc...    86   2e-15
gi|39580231|emb|CAE72987.1| Hypothetical protein CBG20332 [Caeno...    86   2e-15
gi|33352213|emb|CAE18153.1| aspartic proteinase [Chlamydomonas r...    85   4e-15
gi|50543010|ref|XP_499671.1| hypothetical protein [Yarrowia lipo...    84   5e-15
gi|39583893|emb|CAE63983.1| Hypothetical protein CBG08575 [Caeno...    84   5e-15
gi|5081317|gb|AAD39344.1| pepsinogen [Haemonchus contortus]            84   7e-15
gi|12231172|dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]    84   7e-15
gi|3551952|gb|AAC34854.1| senescence-associated protein 4 [Hemer...    84   9e-15
gi|9798658|dbj|BAB11751.1| pepsinogen A [Rhinolophus ferrumequinum]    84   9e-15
gi|129797|sp|P03955|PEPC_MACFU Gastricsin precursor (Pepsinogen ...    84   9e-15
gi|9798666|dbj|BAB11755.1| pepsinogen C [Rhinolophus ferrumequinum]    83   2e-14
gi|7435839|pir||S71591 aspartic proteinase precursor, wound-indu...    83   2e-14
gi|15186732|dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]        82   3e-14
gi|7435838|pir||T07915 probable aspartic proteinase (EC 3.4.23.-...    82   3e-14
gi|12843350|dbj|BAB25952.1| unnamed protein product [Mus musculus]     82   3e-14
gi|4505757|ref|NP_002621.1| progastricsin (pepsinogen C); Prepro...    81   4e-14
gi|50550685|ref|XP_502815.1| hypothetical protein [Yarrowia lipo...    81   4e-14
gi|999902|pdb|1HTR|B Chain B, Progastricsin (Pepsinogen C) (E.C....    81   4e-14
gi|31197675|ref|XP_307785.1| ENSANGP00000022754 [Anopheles gambi...    81   4e-14
gi|31197673|ref|XP_307784.1| ENSANGP00000013568 [Anopheles gambi...    81   4e-14
gi|12231174|dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]    81   4e-14
gi|4582534|emb|CAB40349.1| preprocardosin B [Cynara cardunculus]       81   4e-14
gi|387014|gb|AAA60062.1| pepsinogen                                    81   4e-14
gi|1350571|sp|P08424|RENI_RAT Renin precursor (Angiotensinogenas...    81   6e-14
gi|4581209|emb|CAB40134.1| preprocardosin A [Cynara cardunculus]       80   7e-14
gi|206609|gb|AAA42030.1| preprorenin (EC 3.4.99.19)                    80   7e-14
gi|39581226|emb|CAE70423.1| Hypothetical protein CBG16997 [Caeno...    80   7e-14
gi|11265728|pir||JC7272 aspartic proteinase (EC 3.4.23.-) - comm...    80   7e-14
gi|11265692|pir||T49112 aspartic proteinase like protein - Arabi...    80   1e-13
gi|22330379|ref|NP_176419.2| aspartyl protease family protein [A...    80   1e-13
gi|9798662|dbj|BAB11753.1| pepsinogen C [Suncus murinus]               80   1e-13
gi|15221141|ref|NP_172655.1| aspartyl protease family protein [A...    80   1e-13
gi|1354272|gb|AAC49730.1| aspartic proteinase [Arabidopsis thali...    80   1e-13
gi|45382405|ref|NP_990209.1| pepsinogen A [Gallus gallus] >gnl|B...    80   1e-13
gi|3024367|sp|Q64411|PEPC_CAVPO Gastricsin precursor (Pepsinogen...    80   1e-13
gi|11990128|emb|CAC19555.1| pepsin A [Camelus dromedarius]             80   1e-13
gi|21907889|dbj|BAC05689.1| aspartic protease BmAsp-2 [Brugia ma...    79   2e-13
gi|18959216|ref|NP_579818.1| progastricsin; progastricsin (pepsi...    79   2e-13
gi|24647681|ref|NP_650622.1| CG5860-PA [Drosophila melanogaster]...    79   2e-13
gi|5921649|gb|AAD56283.1| pepsinogen A form IIa [Pseudopleuronec...    79   2e-13
gi|7435837|pir||T11686 aspartic proteinase (EC 3.4.23.-) - cowpea      79   3e-13
gi|39590350|emb|CAE66089.1| Hypothetical protein CBG11306 [Caeno...    79   3e-13
gi|57046|emb|CAA30082.1| unnamed protein product [Rattus norvegi...    79   3e-13
gi|49019802|emb|CAD80095.2| pepsin A1 [Trematomus bernacchii]          79   3e-13
gi|20800441|gb|AAB03843.2| aspartic proteinase [Vigna unguiculat...    78   4e-13
gi|1705600|sp|P10977|CARV_CANAL Vacuolar aspartic protease precu...    78   4e-13
gi|25452827|sp|Q9DEX3|CATD_CLUHA Cathepsin D precursor >gnl|BL_O...    78   4e-13
gi|129791|sp|P00793|PEPA_CHICK Pepsin A precursor                      78   4e-13
gi|1665867|emb|CAA70340.1| aspartic proteinase [Centaurea calcit...    78   4e-13
gi|40641523|emb|CAE52913.1| putative vacuaolar aspartic proteina...    78   5e-13
gi|13676837|ref|NP_112469.1| renin 1 structural [Mus musculus] >...    78   5e-13
gi|49019527|emb|CAD80096.1| pepsin A2 [Trematomus bernacchii]          78   5e-13
gi|25154798|ref|NP_741676.1| aspartic protease family member (5T...    77   6e-13
gi|50557048|ref|XP_505932.1| hypothetical protein [Yarrowia lipo...    77   6e-13
gi|50401196|sp|Q9TSZ1|RENI_CALJA Renin precursor (Angiotensinoge...    77   6e-13
gi|1076696|pir||S49349 cyprosin (EC 3.4.23.-) - cardoon >gnl|BL_...    77   8e-13
gi|49019530|emb|CAD80097.1| pepsin A3 [Trematomus bernacchii]          77   8e-13
gi|9798654|dbj|BAB11749.1| pepsinogen A [Suncus murinus]               77   8e-13
gi|4389326|pdb|1B5F|A Chain A, Native Cardosin A From Cynara Car...    77   8e-13
gi|34740274|dbj|BAC87742.1| pepsinogen [Paralichthys olivaceus]        77   8e-13
gi|46434627|gb|EAK94031.1| hypothetical protein CaO19.1891 [Cand...    77   1e-12
gi|25290004|pir||E96649 hypothetical protein F19K23.21 [imported...    77   1e-12
gi|12231176|dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]    76   1e-12
gi|45185830|ref|NP_983546.1| ACR144Wp [Eremothecium gossypii] >g...    76   1e-12
gi|129777|sp|P28712|PEP1_RABIT Pepsin II-1 precursor (Pepsin A) ...    76   1e-12
gi|50548267|ref|XP_501603.1| hypothetical protein [Yarrowia lipo...    76   1e-12
gi|49091158|ref|XP_407040.1| hypothetical protein AN2903.2 [Aspe...    76   2e-12
gi|1246038|gb|AAB35842.1| pepsinogen A [turtles, Peptide, 361 aa]      76   2e-12
gi|39583181|emb|CAE61399.1| Hypothetical protein CBG05258 [Caeno...    75   2e-12
gi|50346961|gb|AAT75162.1| renin [Macaca fascicularis]                 75   2e-12
gi|50058380|gb|AAT68959.1| preprorenin [Canis familiaris]              75   2e-12
gi|543860|sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease precu...    75   2e-12
gi|22218078|dbj|BAC07516.1| pepsinogen III [Oryctolagus cuniculus]     75   2e-12
gi|19921120|ref|NP_609458.1| CG17134-PA [Drosophila melanogaster...    75   2e-12
gi|17549909|ref|NP_510191.1| aspartic protease (49.3 kD) (asp-4)...    75   3e-12
gi|7489316|pir||T12049 cyprosin (EC 3.4.23.-) - cardoon (fragmen...    75   3e-12
gi|530795|gb|AAA20876.1| pepsinogen                                    75   3e-12
gi|20129385|ref|NP_609235.1| CG13095-PA [Drosophila melanogaster...    75   3e-12
gi|24583545|ref|NP_609457.1| CG6508-PA [Drosophila melanogaster]...    75   3e-12
gi|1169175|sp|P40782|CYP1_CYNCA Cyprosin precursor >gnl|BL_ORD_I...    75   3e-12
gi|129783|sp|P27822|PEP3_RABIT Pepsin III precursor (Pepsin A) >...    75   3e-12
gi|21392388|dbj|BAC00850.1| pepsinogen [Aspergillus oryzae]            75   3e-12
gi|629757|pir||S47096 cynarase (EC 3.4.23.-) - cardoon                 75   3e-12
gi|28849951|ref|NP_788787.1| pregnancy-associated glycoprotein 2...    75   3e-12
gi|3392909|emb|CAA20104.1| EG:EG0001.1 [Drosophila melanogaster]       75   4e-12
gi|17986011|ref|NP_525030.1| CG13374-PA [Drosophila melanogaster...    75   4e-12
gi|6981472|ref|NP_036774.1| renin 1; Renin [Rattus norvegicus] >...    75   4e-12
gi|48675385|ref|NP_001001600.1| pepsinogen A [Bos taurus] >gnl|B...    75   4e-12
gi|223468|prf||0807285A renin precursor                                75   4e-12
gi|2118133|pir||JC4870 pepsin A (EC 3.4.23.1) precursor - soft-s...    75   4e-12
gi|4506475|ref|NP_000528.1| renin precursor; angiotensin-forming...    75   4e-12
gi|50345843|gb|AAT74864.1| prorenin [Macaca mulatta]                   75   4e-12
gi|1778026|gb|AAB63442.1| aspartic proteinase [Schistosoma mansoni]    75   4e-12
gi|443239|pdb|1RNE|  Renin (Activated, Glycosylated, Inhibited) ...    75   4e-12
gi|37790800|gb|AAR03502.1| renin [Homo sapiens]                        75   4e-12
gi|12231180|dbj|BAB20973.1| aspartic proteinase 5 [Nepenthes alata]    75   4e-12
gi|337347|gb|AAA60364.1| renin                                         75   4e-12
gi|871442|emb|CAA25391.1| renin [Mus musculus]                         75   4e-12
gi|200688|gb|AAA40043.1| renin (Ren-1-d)                               75   4e-12
gi|38073842|ref|XP_110285.2| similar to renin (Ren-1-d) [Mus mus...    75   4e-12
gi|1065326|pdb|1HRN|A Chain A, Renin Complexed With Polyhydroxym...    75   4e-12
gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata]    75   4e-12
gi|16974928|pdb|1FLH|A Chain A, Crystal Structure Of Human Urope...    74   5e-12
gi|48103318|ref|XP_392857.1| similar to aspartic protease [Apis ...    74   5e-12
gi|34912092|ref|NP_917393.1| putative aspartic protease [Oryza s...    74   5e-12
gi|18152941|gb|AAB68519.2| proteinase A [Pichia angusta]               74   5e-12
gi|34912970|ref|NP_917832.1| putative aspartic protease [Oryza s...    74   7e-12
gi|12082176|dbj|BAB20798.1| pepsinogen A [Xenopus laevis]              74   7e-12
gi|129792|sp|P00790|PEPA_HUMAN Pepsin A precursor >gnl|BL_ORD_ID...    74   7e-12
gi|25290000|pir||JC7574 pepsinogen A - African clawed frog             74   7e-12
gi|13654253|ref|NP_112470.1| renin 2 tandem duplication of Ren1 ...    74   7e-12
gi|6978973|dbj|BAA90785.1| aspartic proteinase family member sim...    74   7e-12
gi|8896140|gb|AAF81255.1| pregnancy-associated glycoprotein 6 [S...    74   7e-12
gi|1065258|pdb|1PSN|  Pepsin 3a (E.C.3.4.23.1) >gnl|BL_ORD_ID|25...    74   7e-12
gi|223891|prf||1004236A renin                                          74   9e-12
gi|21629629|gb|AAM61957.1| synthetic renin 2/1d [Mus musculus]         74   9e-12
gi|34576991|gb|AAQ75735.1| pregnancy-associated glycoprotein 8 [...    74   9e-12
gi|13897888|gb|AAK48494.1| putative aspartic protease [Ipomoea b...    74   9e-12
gi|48374065|ref|NP_001001536.1| pregnancy-associated glycoprotei...    74   9e-12
gi|9798660|dbj|BAB11752.1| pepsinogen A [Canis familiaris]             74   9e-12
gi|21616053|emb|CAC86004.1| aspartic proteinase [Theobroma cacao]      74   9e-12
gi|46397366|sp|P14091|CATE_HUMAN Cathepsin E precursor                 73   1e-11
gi|132329|sp|P00796|RENS_MOUSE Renin 2 precursor (Angiotensinoge...    73   1e-11
gi|23943854|ref|NP_055039.1| pepsinogen 5, group I (pepsinogen A...    73   1e-11
gi|18203305|sp|Q9N2D4|PEPA_CALJA Pepsin A precursor >gnl|BL_ORD_...    73   1e-11
gi|129780|sp|P27677|PEP2_MACFU Pepsin A-2/A-3 precursor (Pepsin ...    73   2e-11
gi|101979|pir||S03433 candidapepsin (EC 3.4.23.24) precursor - y...    73   2e-11
gi|6680552|ref|NP_032463.1| napsin A aspartic peptidase; kidney-...    73   2e-11
gi|12832561|dbj|BAB22158.1| unnamed protein product [Mus musculus]     73   2e-11
gi|494607|pdb|1SMR|A Chain A, Renin (E.C.3.4.23.15) Complex With...    73   2e-11
gi|1585064|prf||2124254A pepsin:ISOTYPE=3a >gnl|BL_ORD_ID|864601...    73   2e-11
gi|115721|sp|P25796|CATE_CAVPO Cathepsin E precursor >gnl|BL_ORD...    73   2e-11
gi|30575834|gb|AAP32823.1| aspartyl proteinase [Paracoccidioides...    72   2e-11
gi|21907887|dbj|BAC05688.1| aspartic protease BmAsp-1 [Brugia ma...    72   2e-11
gi|4503145|ref|NP_001901.1| cathepsin E isoform a preproprotein;...    72   2e-11
gi|41053329|ref|NP_956325.1| Unknown (protein for MGC:63831); wu...    72   2e-11
gi|9798656|dbj|BAB11750.1| pepsinogen A [Sorex unguiculatus]           72   3e-11
gi|129787|sp|P28713|PEP4_RABIT Pepsin II-4 precursor (Pepsin A) ...    72   3e-11
gi|1585066|prf||2124254C pepsin:ISOTYPE=3c                             72   3e-11
gi|164604|gb|AAA31096.1| pepsinogen A precursor                        72   3e-11
gi|5921651|gb|AAD56284.1| pepsinogen A form IIb precursor [Pseud...    72   3e-11
gi|15079273|gb|AAH11473.1| Renin 2 tandem duplication of Ren1 [M...    72   3e-11
gi|27803878|gb|AAO22152.1| cathepsin D-like aspartic protease [A...    72   3e-11
gi|231168|pdb|5PEP|  Pepsin (E.C.3.4.23.1)                             72   3e-11
gi|49522906|gb|AAH75134.1| Unknown (protein for IMAGE:7009273) [...    72   3e-11
gi|38195404|gb|AAR13364.1| aspartic proteinase precursor [Botryo...    71   5e-11
gi|6224883|gb|AAF05996.1| pregnancy-associated glycoprotein-13 [...    71   5e-11
gi|39588731|emb|CAE58255.1| Hypothetical protein CBG01356 [Caeno...    71   5e-11
gi|19911571|dbj|BAB86888.1| pepsinogen B [Canis familiaris]            71   5e-11
gi|625423|pir||A30142 pepsin A (EC 3.4.23.1) 5 precursor - human       71   5e-11
gi|6978719|ref|NP_037070.1| cathepsin E [Rattus norvegicus] >gnl...    71   5e-11
gi|387013|gb|AAA60061.1| pepsinogen A                                  71   5e-11
gi|2499826|sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein ...    71   5e-11
gi|6760077|gb|AAF28186.1| aspartyl proteinase [Coccidioides immi...    71   5e-11
gi|24647683|ref|NP_650623.1| CG5863-PA [Drosophila melanogaster]...    71   5e-11
gi|2136603|pir||I46617 pregnancy-associated glycoprotein - pig >...    71   5e-11
gi|494476|pdb|1PSA|A Chain A, Pepsin Hydrolase (Acid Proteinase)...    71   5e-11
gi|46309251|dbj|BAD15111.1| cathepsin D [Todarodes pacificus]          71   5e-11
gi|49019533|emb|CAD80098.1| gastricsin [Trematomus bernacchii]         71   5e-11
gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum]                     71   5e-11
gi|230676|pdb|2PSG|  Pepsinogen >gnl|BL_ORD_ID|1163236 gi|230912...    71   6e-11
gi|15425751|dbj|BAB64296.1| aspartic proteinase 2 [Glycine max]        71   6e-11
gi|30024582|dbj|BAC75704.1| proteinase A [Candida boidinii]            71   6e-11
gi|230907|pdb|3PEP|  Pepsin (E.C.3.4.23.1) >gnl|BL_ORD_ID|165015...    71   6e-11
gi|13096225|pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pep...    71   6e-11
gi|38303893|gb|AAH62002.1| Ctse protein [Rattus norvegicus]            71   6e-11
gi|2851407|sp|P16228|CATE_RAT Cathepsin E precursor >gnl|BL_ORD_...    71   6e-11
gi|17560028|ref|NP_505132.1| predicted CDS, aspartic protease fa...    70   8e-11
gi|48734644|gb|AAH72252.1| Unknown (protein for MGC:82347) [Xeno...    70   8e-11
gi|625424|pir||B30142 pepsin A (EC 3.4.23.1) 4 precursor - human       70   8e-11
gi|2510|emb|CAA31962.1| pre-aspartyl proteinase [Candida albicans]     70   8e-11
gi|6325103|ref|NP_015171.1| vacuolar proteinase A; Pep4p [Saccha...    70   8e-11
gi|22651403|gb|AAL61540.1| cathepsin D precursor [Danio rerio]         70   1e-10
gi|27503926|gb|AAH42316.1| Ctsd protein [Danio rerio] >gnl|BL_OR...    70   1e-10
gi|21392384|dbj|BAC00849.1| secreted aspartic protease [Aspergil...    70   1e-10
gi|109340|pir||C38302 pepsin (EC 3.4.23.-) II-2/3 precursor - ra...    70   1e-10
gi|129781|sp|P27821|PEP2_RABIT Pepsin II-2/3 precursor (Pepsin A...    70   1e-10
gi|6180001|gb|AAF05747.1| pregnancy-associated glycoprotein-8 [C...    70   1e-10
gi|21063965|gb|AAM29212.1| AT05209p [Drosophila melanogaster]          70   1e-10
gi|24653643|ref|NP_610961.1| CG10104-PA [Drosophila melanogaster...    70   1e-10
gi|50260546|gb|EAL23201.1| hypothetical protein CNBA5450 [Crypto...    70   1e-10
gi|1858020|gb|AAC60301.1| cathepsin D [Oncorhynchus mykiss]            70   1e-10
gi|23509298|ref|NP_701965.1| plasmepsin 2 precursor [Plasmodium ...    70   1e-10
gi|104296|pir||A39314 gastricsin (EC 3.4.23.3) precursor - bullf...    70   1e-10
gi|50547309|ref|XP_501124.1| hypothetical protein [Yarrowia lipo...    70   1e-10
gi|21552717|gb|AAM62283.1| cathepsin D preproprotein [Silurus as...    70   1e-10
gi|21355083|ref|NP_652013.1| CG1548-PA [Drosophila melanogaster]...    70   1e-10
gi|13928928|ref|NP_113858.1| kidney-derived aspartic protease-li...    69   2e-10
gi|28603726|ref|NP_788797.1| pregnancy-associated glycoprotein 1...    69   2e-10
gi|50547341|ref|XP_501140.1| hypothetical protein [Yarrowia lipo...    69   2e-10
gi|25290001|pir||JC7575 pepsinogen A - bullfrog >gnl|BL_ORD_ID|3...    69   2e-10
gi|2664292|emb|CAA75754.1| cellular aspartic protease [Aspergill...    69   2e-10
gi|1710090|sp|P52115|RENI_SHEEP Renin precursor (Angiotensinogen...    69   2e-10
gi|14278413|pdb|1G0V|A Chain A, The Structure Of Proteinase A Co...    69   2e-10
gi|5748654|emb|CAA08880.2| cathepsin E protein [Mus musculus]          69   2e-10
gi|2288908|emb|CAA71859.1| cathepsin E [Mus musculus]                  69   2e-10
gi|129793|sp|P11489|PEPA_MACMU Pepsin A precursor >gnl|BL_ORD_ID...    69   3e-10
gi|129776|sp|P03954|PEP1_MACFU Pepsin A-1 precursor (Pepsin III-...    69   3e-10
gi|2624629|pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A >...    69   3e-10
gi|7766834|pdb|1DP5|A Chain A, The Structure Of Proteinase A Com...    69   3e-10
gi|18858489|ref|NP_571785.1| cathepsin D; etID16901.18 [Danio re...    69   3e-10
gi|22219360|pdb|1M43|A Chain A, Crystal Structure Of Pmii In Com...    69   3e-10
gi|40557501|gb|AAR88049.1| pregnancy-associated glycoprotein 7 [...    69   3e-10
gi|6561816|gb|AAF17080.1| aspartyl protease 3 [Homo sapiens]           69   3e-10
gi|2811025|sp|O04057|ASPR_CUCPE Aspartic proteinase precursor >g...    68   4e-10
gi|50255620|gb|EAL18353.1| hypothetical protein CNBJ2760 [Crypto...    68   4e-10
gi|31559113|gb|AAP50847.1| cathepsin D [Bombyx mori]                   68   4e-10
gi|1942549|pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degra...    68   5e-10
gi|4389167|pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium ...    68   5e-10
gi|49077340|ref|XP_402541.1| hypothetical protein UM04926.1 [Ust...    68   5e-10
gi|19851890|gb|AAL99906.1| chymosin precursor [Bos taurus]             68   5e-10
gi|858754|gb|AAA68217.1| aspartic proteinase                           68   5e-10
gi|50549149|ref|XP_502045.1| hypothetical protein [Yarrowia lipo...    68   5e-10
gi|24987569|pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin ...    68   5e-10
gi|162856|gb|AAA30446.1| chymosin                                      68   5e-10
gi|1172530|sp|P46925|PLM2_PLAFA Plasmepsin 2 precursor (Aspartic...    68   5e-10
gi|38102423|gb|EAA49264.1| hypothetical protein MG00922.4 [Magna...    67   7e-10
gi|510880|emb|CAA56373.1| putative aspartic protease [Brassica o...    67   7e-10
gi|1246039|gb|AAB35843.1| pepsinogen 2 [tuna, Peptide, 360 aa]         67   9e-10
gi|230825|pdb|3CMS|  Chymosin B (Formerly Known As Rennin) (E.C....    67   9e-10
gi|229748|pdb|1CMS|  Chymosin B (Formerly Known As Rennin) (E.C....    67   9e-10
gi|6739580|gb|AAF27315.1| prochymosin [Bubalus bubalis]                67   9e-10
gi|129786|sp|P27678|PEP4_MACFU Pepsin A-4 precursor (Pepsin I/II...    67   9e-10
gi|50760547|ref|XP_425832.1| PREDICTED: similar to pepsinogen B ...    67   9e-10
gi|6681081|ref|NP_031825.1| cathepsin E preproprotein [Mus muscu...    67   9e-10
gi|46395760|sp|Q805F2|CTE2_XENLA Cathepsin E2 precursor >gnl|BL_...    67   9e-10
gi|28849955|ref|NP_788795.1| pregnancy-associated glycoprotein 1...    67   9e-10
gi|162858|gb|AAA30447.1| preprochymosin a [Bos taurus]                 67   9e-10
gi|625238|pir||CMBO chymosin (EC 3.4.23.4) precursor - bovine          67   9e-10
gi|116403|sp|P00794|CHYM_BOVIN Chymosin precursor (Preprorennin)       67   9e-10
gi|24647679|ref|NP_650621.1| CG17283-PA [Drosophila melanogaster...    67   1e-09
gi|9581805|emb|CAC00543.1| necepsin II [Necator americanus]            67   1e-09
gi|3378161|emb|CAA07719.1| cathepsin D [Chionodraco hamatus]           67   1e-09
gi|47523112|ref|NP_999038.1| pepsin; pepsinogen [Sus scrofa] >gn...    67   1e-09
gi|116405|sp|P18276|CHYM_SHEEP Chymosin precursor (Preprorennin)...    67   1e-09
gi|21392382|dbj|BAC00848.1| aspartic protease [Aspergillus oryzae]     67   1e-09
gi|45360583|ref|NP_988964.1| hypothetical protein MGC76043 [Xeno...    66   1e-09
gi|47211933|emb|CAF92442.1| unnamed protein product [Tetraodon n...    66   1e-09
gi|17561740|ref|NP_503825.1| aspartic protease family member (5D...    66   2e-09
gi|28189935|dbj|BAC56582.1| similar to pregnancy-associated glyc...    66   2e-09
gi|28189895|dbj|BAC56562.1| similar to aspartic proteinase [Bos ...    66   2e-09
gi|28436104|dbj|BAC57431.1| cathepsin D [Xenopus laevis]               66   2e-09
gi|49070738|ref|XP_399658.1| hypothetical protein UM02043.1 [Ust...    66   2e-09
gi|28189535|dbj|BAC56382.1| similar to aspartic proteinase [Bos ...    66   2e-09
gi|28189755|dbj|BAC56492.1| similar to aspartic proteinase [Bos ...    66   2e-09
gi|46395759|sp|Q800A0|CATE_RANCA Cathepsin E precursor >gnl|BL_O...    66   2e-09
gi|28189889|dbj|BAC56559.1| similar to aspartic proteinase [Bos ...    66   2e-09
gi|50555686|ref|XP_505251.1| hypothetical protein [Yarrowia lipo...    66   2e-09
gi|3095036|gb|AAC15793.1| plasmepsin [Plasmodium ovale]                66   2e-09
gi|11120702|ref|NP_068521.1| pepsinogen F protein [Rattus norveg...    65   2e-09
gi|25289999|pir||JC7573 pepsinogen C - African clawed frog >gnl|...    65   2e-09
gi|34146966|gb|AAB65877.2| Hypothetical protein F59D6.2 [Caenorh...    65   3e-09
gi|21914374|gb|AAM81358.1| aspartyl proteinase [Leptosphaeria ma...    65   3e-09
gi|46138535|ref|XP_390958.1| hypothetical protein FG10782.1 [Gib...    65   3e-09
gi|17981530|gb|AAL51056.1| cathepsin D [Apriona germari]               65   3e-09
gi|30794284|ref|NP_851337.1| prochymosin; chymosin precursor; re...    65   3e-09
gi|1168764|sp|P43092|CAR3_CANAL Candidapepsin 3 precursor (Aspar...    65   4e-09
gi|28189885|dbj|BAC56557.1| similar to aspartic proteinase [Bos ...    65   4e-09
gi|6180007|gb|AAF05750.1| pregnancy-associated glycoprotein-11 [...    65   4e-09
gi|6179991|gb|AAF05742.1| pregnancy-associated glycoprotein-3 [C...    65   4e-09
gi|28603718|ref|NP_788792.1| pregnancy-associated glycoprotein 8...    65   4e-09
gi|4099023|gb|AAD00524.1| aspartic protease [Onchocerca volvulus]      64   6e-09
gi|45384244|ref|NP_990385.1| pepsinogen [Gallus gallus] >gnl|BL_...    64   6e-09
gi|360431|prf||1403354A pepsinogen                                     64   6e-09
gi|350733|prf||0803215A rennin,pro                                     64   6e-09
gi|50419019|ref|XP_458031.1| unnamed protein product [Debaryomyc...    64   6e-09
gi|17389633|gb|AAH17842.1| Pronapsin A [Homo sapiens]                  64   7e-09
gi|4758754|ref|NP_004842.1| NAPSA gene product [Homo sapiens] >g...    64   7e-09
gi|47086317|ref|NP_998025.1| renin; renin precursor [Danio rerio...    64   7e-09
gi|1168791|sp|P43159|CATE_RABIT Cathepsin E precursor >gnl|BL_OR...    64   7e-09
gi|37787745|gb|AAO41706.1| renin precursor [Danio rerio]               64   9e-09
gi|32421211|ref|XP_331049.1| VACUOLAR PROTEASE A PRECURSOR [Neur...    64   9e-09
gi|2499817|sp|Q01294|CARP_NEUCR Vacuolar protease A precursor >g...    64   9e-09
gi|17561738|ref|NP_503826.1| aspartic protease precursor family ...    64   9e-09
gi|47223178|emb|CAG11313.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|2055433|gb|AAB53224.1| pregnancy-associated glycoprotein 3 [O...    63   1e-08
gi|46395761|sp|Q805F3|CTE1_XENLA Cathepsin E1 precursor >gnl|BL_...    63   1e-08
gi|47215111|emb|CAG02535.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|16119024|gb|AAL14708.1| aspartic protease [Clonorchis sinensis]     63   2e-08
gi|11990126|emb|CAC19554.1| chymosin [Camelus dromedarius]             63   2e-08
gi|2689727|gb|AAB91422.1| pregnancy-associated glycoprotein [Fel...    62   2e-08
gi|4927648|gb|AAD33219.1| cathepsin D; lysosomal aspartic protei...    62   2e-08
gi|416749|sp|P32951|CAR1_CANPA Candidapepsin 1 precursor (Aspart...    62   2e-08
gi|11493777|gb|AAG35646.1| progastricsin [Salvelinus fontinalis]       62   2e-08
gi|3095038|gb|AAC15794.1| plasmepsin [Plasmodium malariae]             62   3e-08
gi|6179995|gb|AAF05744.1| pregnancy-associated glycoprotein-5 [C...    62   3e-08
gi|3550545|emb|CAA11249.1| plasmepsin [Plasmodium berghei]             62   3e-08
gi|39540664|tpg|DAA01803.1| TPA: pro-renin [Takifugu rubripes]         62   3e-08
gi|109130|pir||A41545 pregnancy-specific antigen 1 precursor - s...    62   4e-08
gi|23110952|ref|NP_683865.1| cathepsin E isoform b preproprotein...    62   4e-08
gi|3378673|emb|CAA08878.1| Cathepsin D [Podarcis sicula]               62   4e-08
gi|2499827|sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotei...    62   4e-08
gi|50728326|ref|XP_416090.1| PREDICTED: similar to aspartic prot...    62   4e-08
gi|50306705|ref|XP_453326.1| unnamed protein product [Kluyveromy...    61   5e-08
gi|9858101|gb|AAG00993.1| heme-binding aspartic proteinase [Boop...    61   5e-08
gi|2136604|pir||I47176 chymosin (EC 3.4.23.4) precursor - pig (f...    61   5e-08
gi|28603734|ref|NP_788801.1| pregnancy-associated glycoprotein 1...    61   5e-08
gi|16415894|emb|CAD01097.1| putative aspartyl-proteinase [Pleuro...    61   5e-08
gi|28189703|dbj|BAC56466.1| similar to pregnancy-associated glyc...    61   5e-08
gi|45384002|ref|NP_990508.1| prepro-cathepsin D; prepro-cathepsi...    60   8e-08
gi|12043774|gb|AAG47643.1| progastricsin [Salvelinus fontinalis]       60   8e-08
gi|24580868|ref|NP_722706.1| CG31926-PA [Drosophila melanogaster...    60   1e-07
gi|7341306|gb|AAF61241.1| pepsinogen F [Mus musculus]                  60   1e-07
gi|31981154|ref|NP_067428.2| pepsinogen 5, group I; pepsinogen F...    60   1e-07
gi|477734|pir||B47701 aspartic proteinase ACPR (EC 3.4.23.-) pre...    60   1e-07
gi|4927642|gb|AAD33216.1| secreted aspartic protease 2 [Candida ...    60   1e-07
gi|16507116|gb|AAL24045.1| aspartic proteinase [Plasmodium chaba...    60   1e-07
gi|402686|gb|AAA30684.1| pregnancy-specific glycoprotein               59   2e-07
gi|11265726|pir||T45035 hypothetical protein Y39B6B.i [imported]...    59   2e-07
gi|25154801|ref|NP_741675.1| predicted CDS, aspartic protease pr...    59   2e-07
gi|2499824|sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein...    59   2e-07
gi|2144165|pir||JC5077 aspartic proteinase (EC 3.4.23.-) - dog h...    59   2e-07
gi|49175772|gb|AAR87746.2| aspartic proteinase precursor [Botryo...    59   2e-07
gi|2499825|sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein ...    59   2e-07
gi|50545607|ref|XP_500342.1| hypothetical protein [Yarrowia lipo...    59   2e-07
gi|28189719|dbj|BAC56474.1| similar to aspartic proteinase [Bos ...    59   3e-07
gi|6179993|gb|AAF05743.1| pregnancy-associated glycoprotein-4 [C...    59   3e-07
gi|28603710|ref|NP_788788.1| pregnancy-associated glycoprotein 4...    59   3e-07
gi|24580865|ref|NP_722705.1| CG31928-PA [Drosophila melanogaster...    59   3e-07
gi|47523226|ref|NP_998974.1| pregnancy-associated glycoprotein 3...    59   3e-07
gi|19851892|gb|AAL99907.1| chymosin precursor [Bos taurus]             58   4e-07
gi|24159077|pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmeps...    58   4e-07
gi|49175773|gb|AAR87747.2| aspartic proteinase precursor [Botryo...    58   4e-07
gi|299522|gb|AAB26186.1| cathepsin D {EC 3.4.23.5} [cattle, Pept...    58   4e-07
gi|40557503|gb|AAR88050.1| pregnancy-associated glycoprotein 8 [...    58   4e-07
gi|3095034|gb|AAC15792.1| plasmepsin [Plasmodium vivax] >gnl|BL_...    58   4e-07
gi|47213062|emb|CAF91576.1| unnamed protein product [Tetraodon n...    58   4e-07
gi|19851894|gb|AAL99908.1| chymosin precursor [Bos taurus]             58   4e-07
gi|13637914|sp|P80209|CATD_BOVIN Cathepsin D precursor                 58   4e-07
gi|12697815|dbj|BAB21620.1| cathepsin D [Bos taurus]                   58   4e-07
gi|23483602|gb|EAA19219.1| plasmepsin [Plasmodium yoelii yoelii]       58   5e-07
gi|2689725|gb|AAB91421.1| pregnancy-associated glycoprotein [Equ...    58   5e-07
gi|40557495|gb|AAR88046.1| pregnancy-associated glycoprotein 4 [...    58   5e-07
gi|28603732|ref|NP_788800.1| pregnancy-associated glycoprotein 1...    58   5e-07
gi|28603738|ref|NP_788803.1| pregnancy-associated glycoprotein 2...    58   5e-07
gi|6180005|gb|AAF05749.1| pregnancy-associated glycoprotein-10 [...    57   7e-07
gi|50294061|ref|XP_449442.1| unnamed protein product [Candida gl...    57   7e-07
gi|23509297|ref|NP_701964.1| plasmepsin 1 precursor [Plasmodium ...    57   7e-07
gi|1619323|emb|CAA69878.1| aspartic protease [Trematomus bernacc...    57   7e-07
gi|46441787|gb|EAL01081.1| hypothetical protein CaO19.242 [Candi...    57   7e-07
gi|2055435|gb|AAB53225.1| pregnancy-associated glycoprotein 4 [O...    57   7e-07
gi|28189803|dbj|BAC56516.1| similar to pregnancy-associated glyc...    57   7e-07
gi|3024354|sp|P56272|PEP1_GADMO Pepsin IIB >gnl|BL_ORD_ID|116723...    57   9e-07
gi|28207660|gb|AAO32627.1| pregnancy-associated glycoprotein 5 [...    57   9e-07
gi|5542467|pdb|1QS8|A Chain A, Crystal Structure Of The P. Vivax...    57   9e-07
gi|6179987|gb|AAF05740.1| pregnancy-associated glycoprotein-1 [C...    57   9e-07
gi|40557487|gb|AAR88042.1| pregnancy-associated glycoprotein 1 [...    57   9e-07
gi|3334136|sp|O42778|CAR8_CANAL Candidapepsin 8 precursor (Aspar...    57   9e-07
gi|28603716|ref|NP_788791.1| pregnancy-associated glycoprotein 7...    57   9e-07
gi|7548466|gb|AAA34371.2| secreted aspartyl proteinase 1 [Candid...    57   1e-06
gi|40557505|gb|AAR88051.1| pregnancy-associated glycoprotein 9 [...    57   1e-06
gi|40557491|gb|AAR88044.1| pregnancy-associated glycoprotein 2 v...    57   1e-06
gi|40557489|gb|AAR88043.1| pregnancy-associated glycoprotein 2 [...    57   1e-06
gi|45643446|gb|AAS72876.1| aspartyl protease [Triatoma infestans]      57   1e-06
gi|28189897|dbj|BAC56563.1| similar to aspartic proteinase [Bos ...    57   1e-06
gi|1929102|emb|CAA72511.1| extracellular aspartic proteinase [Rh...    56   2e-06
gi|7435833|pir||JE0371 pepsin C (EC 3.4.23.-) precursor - chicken      56   2e-06
gi|4589842|dbj|BAA76892.1| pepsinogen C [Gallus gallus]                56   2e-06
gi|45382395|ref|NP_990208.1| pepsinogen C [Gallus gallus] >gnl|B...    56   2e-06
gi|50548623|ref|XP_501781.1| hypothetical protein [Yarrowia lipo...    56   2e-06
gi|18859121|ref|NP_571879.1| nothepsin; aspartic proteinase [Dan...    56   2e-06
gi|50545213|ref|XP_500144.1| hypothetical protein [Yarrowia lipo...    55   3e-06
gi|17549907|ref|NP_509142.1| aspartic protease (43.4 kD) (asp-3)...    55   3e-06
gi|627805|pir||A61388 renin (EC 3.4.23.15) - rabbit (fragment)         55   3e-06
gi|26354406|dbj|BAC40831.1| unnamed protein product [Mus musculus]     55   3e-06
gi|6753556|ref|NP_034113.1| cathepsin D [Mus musculus] >gnl|BL_O...    55   3e-06
gi|28603736|ref|NP_788802.1| pregnancy-associated glycoprotein 2...    55   3e-06
gi|18203300|sp|Q9MZS8|CATD_SHEEP Cathepsin D precursor >gnl|BL_O...    55   3e-06
gi|28603720|ref|NP_788793.1| pregnancy-associated glycoprotein 9...    55   3e-06
gi|50513832|pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspep...    55   3e-06
gi|35952|emb|CAA24937.1| unnamed protein product [Homo sapiens]        55   3e-06
gi|4503143|ref|NP_001900.1| cathepsin D preproprotein [Homo sapi...    55   3e-06
gi|67678|pir||KHPGD cathepsin D (EC 3.4.23.5) - pig                    55   3e-06
gi|50593064|gb|AAT79343.1| ASP-1 [Parastrongyloides trichosuri]        55   3e-06
gi|30584113|gb|AAP36305.1| Homo sapiens cathepsin D (lysosomal a...    55   3e-06
gi|230424|pdb|2APR|  Acid Proteinase (Rhizopuspepsin) (E.C.3.4.2...    55   4e-06
gi|360235|prf||1402278B rhizopuspepsin II                              55   4e-06
gi|625239|pir||A26681 rhizopuspepsin (EC 3.4.23.21) II precursor...    55   4e-06
gi|169742|gb|AAA33881.1| rhizopuspepsinogen precursor [Rhizopus ...    55   4e-06
gi|1705599|sp|P06026|CARP_RHICH Rhizopuspepsin precursor >gnl|BL...    55   4e-06
gi|169740|gb|AAA33879.1| rhizopuspepsin precursor (EC 3.4.23.6)        55   4e-06
gi|28189627|dbj|BAC56428.1| similar to pregnancy-associated glyc...    55   4e-06
gi|115720|sp|P24268|CATD_RAT Cathepsin D precursor >gnl|BL_ORD_I...    54   6e-06
gi|42476045|ref|NP_599161.2| cathepsin D [Rattus norvegicus] >gn...    54   6e-06
gi|494295|pdb|1LYA|A Chain A, Cathepsin D (E.C.3.4.23.5) >gnl|BL...    54   6e-06
gi|2055445|gb|AAB53230.1| pregnancy-associated glycoprotein 9 [O...    54   6e-06
gi|115639|sp|P00799|CARP_RHIMI Mucorpepsin precursor (Mucor renn...    54   6e-06
gi|2554745|pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex                 54   6e-06
gi|40557497|gb|AAR88047.1| pregnancy-associated glycoprotein 5 [...    54   8e-06
gi|2055439|gb|AAB53227.1| pregnancy-associated glycoprotein 6 [O...    54   8e-06
gi|38197533|gb|AAH61685.1| MGC68767 protein [Xenopus laevis]           54   8e-06
gi|28189539|dbj|BAC56384.1| similar to aspartic proteinase [Bos ...    54   8e-06
gi|47198554|emb|CAF89152.1| unnamed protein product [Tetraodon n...    54   1e-05
gi|40557493|gb|AAR88045.1| pregnancy-associated glycoprotein 3 [...    54   1e-05
gi|18203303|sp|Q9N2D2|CHYM_CALJA Chymosin precursor (Preprorenni...    54   1e-05
gi|6224885|gb|AAF05997.1| pregnancy-associated glycoprotein-14 [...    53   1e-05
gi|1705595|sp|P43231|CAR2_RHINI Rhizopuspepsin 2 precursor (Aspa...    53   1e-05
gi|2055437|gb|AAB53226.1| pregnancy-associated glycoprotein 5 [O...    53   1e-05
gi|14488780|pdb|1J71|A Chain A, Structure Of The Extracellular A...    53   1e-05
gi|6179999|gb|AAF05746.1| pregnancy-associated glycoprotein-7 [C...    53   1e-05
gi|1942831|pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap...    53   2e-05
gi|1585068|prf||2124256A Asp protease:ISOTYPE=prepro=1-56              53   2e-05
gi|7435834|pir||T10264 pregnancy-specific antigen 7 precursor - ...    53   2e-05
gi|115640|sp|P10602|CAR1_RHINI Rhizopuspepsin 1 precursor (Aspar...    53   2e-05
gi|28603714|ref|NP_788790.1| pregnancy-associated glycoprotein 6...    52   2e-05
gi|1168765|sp|Q03699|CAR3_RHINI Rhizopuspepsin 3 precursor (Aspa...    52   2e-05
gi|28189805|dbj|BAC56517.1| similar to pregnancy-associated glyc...    52   2e-05
gi|25290002|pir||C96715 protein F4N2.8 [imported] - Arabidopsis ...    52   2e-05
gi|28603730|ref|NP_788799.1| pregnancy-associated glycoprotein 1...    52   2e-05
gi|115719|sp|P00795|CATD_PIG Cathepsin D                               52   2e-05
gi|50259458|gb|EAL22131.1| hypothetical protein CNBC2690 [Crypto...    52   2e-05
gi|20875195|ref|XP_131138.1| similar to prochymosin [Mus musculus]     52   3e-05
gi|101001|pir||A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus...    52   3e-05
gi|1478380|gb|AAB36149.1| SAP2=major secreted aspartic proteinas...    52   3e-05
gi|499671|gb|AAA33880.1| rhizopuspepsin I                              52   3e-05
gi|50553977|ref|XP_504397.1| hypothetical protein [Yarrowia lipo...    52   3e-05
gi|1827844|pdb|2ASI|  Aspartic Proteinase                              52   3e-05
gi|5915874|sp|P81214|CARP_SYNRA Syncephapepsin precursor >gnl|BL...    52   3e-05
gi|32420321|ref|XP_330604.1| hypothetical protein [Neurospora cr...    52   3e-05
gi|20378984|gb|AAM21051.1| secreted aspartic proteinase 2 [Candi...    52   4e-05
gi|3152654|gb|AAC17105.1| aspartic protease precursor [Phaffia r...    52   4e-05
gi|915540|gb|AAA73628.1| pregnancy-specific antigen                    52   4e-05
gi|50551395|ref|XP_503171.1| hypothetical protein [Yarrowia lipo...    52   4e-05
gi|23509296|ref|NP_701963.1| plasmepsin, putative [Plasmodium fa...    51   5e-05
gi|6180003|gb|AAF05748.1| pregnancy-associated glycoprotein-9 [C...    51   5e-05
gi|21730846|pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin ...    51   5e-05
gi|50548755|ref|XP_501847.1| hypothetical protein [Yarrowia lipo...    51   5e-05
gi|109338|pir||A38302 pepsin (EC 3.4.23.-) F precursor - rabbit        51   5e-05
gi|2094893|pdb|1ZAP|  Secreted Aspartic Protease From C. Albicans      51   5e-05
gi|28189673|dbj|BAC56451.1| similar to pregnancy-associated glyc...    51   6e-05
gi|6323149|ref|NP_013221.1| Aspartic protease, attached to the p...    51   6e-05
gi|38110671|gb|EAA56356.1| hypothetical protein MG06327.4 [Magna...    51   6e-05
gi|49522956|gb|AAH75272.1| Unknown (protein for MGC:88899) [Xeno...    51   6e-05
gi|129802|sp|P27823|PEPF_RABIT Pepsin F precursor >gnl|BL_ORD_ID...    50   8e-05
gi|28603712|ref|NP_788789.1| pregnancy-associated glycoprotein 5...    50   8e-05
gi|28603728|ref|NP_788798.1| pregnancy-associated glycoprotein 1...    50   8e-05
gi|6179997|gb|AAF05745.1| pregnancy-associated glycoprotein-6 [C...    50   8e-05
gi|40557499|gb|AAR88048.1| pregnancy-associated glycoprotein 6 [...    50   8e-05
gi|6179989|gb|AAF05741.1| pregnancy-associated glycoprotein-2 [C...    50   8e-05
gi|50257335|gb|EAL20044.1| hypothetical protein CNBF3700 [Crypto...    50   1e-04
gi|28189779|dbj|BAC56504.1| similar to pregnancy-associated glyc...    50   1e-04
gi|38048659|gb|AAR10232.1| similar to Drosophila melanogaster CG...    50   1e-04
gi|27806043|ref|NP_776836.1| pregnancy-associated glycoprotein 1...    50   1e-04
gi|2055443|gb|AAB53229.1| pregnancy-associated glycoprotein 8 [O...    50   1e-04
gi|49066778|ref|XP_397679.1| hypothetical protein UM00064.1 [Ust...    50   1e-04
gi|33347411|gb|AAQ15288.1| aspartic protease [Pyrus pyrifolia]         50   1e-04
gi|9910338|ref|NP_064476.1| prochymosin [Rattus norvegicus] >gnl...    50   1e-04
gi|89402|pir||S03266 aspartic proteinase (EC 3.4.23.-) (clone NM...    50   1e-04
gi|49071008|ref|XP_399793.1| hypothetical protein UM02178.1 [Ust...    50   1e-04
gi|46371116|gb|AAS90335.1| toxomepsin 1 [Toxoplasma gondii]            50   1e-04
gi|6323150|ref|NP_013222.1| Aspartic protease, attached to the p...    50   1e-04
gi|261083|gb|AAB24375.1| rennin [Mucor pusillus, Peptide, 427 aa...    50   1e-04
gi|49098328|ref|XP_410624.1| hypothetical protein AN6487.2 [Aspe...    50   1e-04
gi|443132|pdb|1MPP|  Pepsin (Renin) (E.C.3.4.23.23) >gnl|BL_ORD_...    50   1e-04
gi|33347413|gb|AAQ15289.1| aspartic protease [Pyrus pyrifolia]         49   2e-04


>gi|17568861|ref|NP_509082.1| aspartic proteinase family member (XH64)
            [Caenorhabditis elegans]
 gi|7505697|pir||T25812 hypothetical protein K10C2.3 - Caenorhabditis
            elegans
 gi|13775446|gb|AAK39258.1| Hypothetical protein K10C2.3
            [Caenorhabditis elegans]
          Length = 410

 Score =  782 bits (2019), Expect = 0.0
 Identities = 393/410 (95%), Positives = 393/410 (95%)
 Frame = -1

Query: 1233 MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA 1054
            MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA
Sbjct: 1    MKVEVCSVENDRGLSRFFGFYVISSKHERINRRAGCLEIILSSIMIKTILLLAFVASTSA 60

Query: 1053 FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK 874
            FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK
Sbjct: 61   FVIPFKVHAAVTNITKGGQTLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK 120

Query: 873  TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK 694
            TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK
Sbjct: 121  TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVK 180

Query: 693  FMQATXXXXXXXXXXXXXXXXXGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT 514
            FMQAT                 GFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT
Sbjct: 181  FMQATDLGLLMDGLGADGILGLGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQT 240

Query: 513  DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL 334
            DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL
Sbjct: 241  DDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYL 300

Query: 333  DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD 154
            DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD
Sbjct: 301  DTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERD 360

Query: 153  LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD 4
            LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD
Sbjct: 361  LVISFFGTCRLQIIPTTDRIILGLPLYRGRCTYFDPIMQRVGFTPALLQD 410




[DB home][top]