Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K10H10_1
(212 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531751|ref|NP_497006.1| ubiquitin specific protease (55.9 k... 144 7e-34
gi|967276|gb|AAA74956.1| tRNA-guanine transglycosylase 144 7e-34
gi|39589198|emb|CAE57931.1| Hypothetical protein CBG00984 [Caeno... 140 7e-33
gi|41053915|ref|NP_956267.1| ubiquitin specific protease 14; wu:... 91 5e-18
gi|47220322|emb|CAF98421.1| unnamed protein product [Tetraodon n... 91 7e-18
gi|50737088|ref|XP_419150.1| PREDICTED: similar to Ubiquitin car... 90 1e-17
gi|49522029|gb|AAH74641.1| Unknown (protein for MGC:69343) [Xeno... 89 2e-17
gi|4827050|ref|NP_005142.1| ubiquitin specific protease 14 [Homo... 88 6e-17
gi|30585387|gb|AAP36966.1| Homo sapiens ubiquitin specific prote... 88 6e-17
gi|38503277|sp|P60051|UB14_PANTR Ubiquitin carboxyl-terminal hyd... 88 6e-17
gi|34877885|ref|XP_214624.2| similar to ubiquitin specific prote... 87 1e-16
gi|31560313|ref|NP_067497.2| ubiquitin specific protease 14; dUB... 87 1e-16
gi|730934|sp|P40826|UB14_RABIT Ubiquitin carboxyl-terminal hydro... 87 1e-16
gi|7415810|dbj|BAA93551.1| deubiquitinating enzyme [Mus musculus] 87 1e-16
gi|12847371|dbj|BAB27544.1| unnamed protein product [Mus musculus] 87 1e-16
gi|11993465|gb|AAG42751.1| ubiquitin-specific protease 6 [Arabid... 77 1e-13
gi|18403643|ref|NP_564596.1| ubiquitin-specific protease 6, puta... 77 1e-13
gi|25349746|pir||A96556 probable tRNA-guaninine transglycosylase... 77 1e-13
gi|34913872|ref|NP_918283.1| putative ubiquitin-specific protein... 77 1e-13
gi|29504794|gb|AAH50197.1| Usp14 protein [Mus musculus] 75 4e-13
gi|42565077|ref|NP_566680.2| ubiquitin-specific protease 7, puta... 74 1e-12
gi|28393202|gb|AAO42031.1| putative ubiquitin-specific protease ... 74 1e-12
gi|11993467|gb|AAG42752.1| ubiquitin-specific protease 7 [Arabid... 74 1e-12
gi|31202139|ref|XP_310017.1| ENSANGP00000024243 [Anopheles gambi... 69 2e-11
gi|31202133|ref|XP_310014.1| ENSANGP00000015158 [Anopheles gambi... 69 2e-11
gi|48100968|ref|XP_395043.1| similar to Ubiquitin specific prote... 69 3e-11
gi|24583343|ref|NP_609377.1| CG5384-PA [Drosophila melanogaster]... 63 1e-09
gi|50549747|ref|XP_502344.1| hypothetical protein [Yarrowia lipo... 62 3e-09
gi|32417262|ref|XP_329109.1| hypothetical protein [Neurospora cr... 62 3e-09
gi|19115029|ref|NP_594117.1| putative ubiquitin carboxyl-termina... 61 7e-09
gi|46130632|ref|XP_389096.1| hypothetical protein FG08920.1 [Gib... 59 3e-08
gi|38100626|gb|EAA47727.1| hypothetical protein MG02970.4 [Magna... 58 5e-08
gi|9280231|dbj|BAB01721.1| ubiquitin specific protease; queuine ... 58 6e-08
gi|49128199|ref|XP_412836.1| hypothetical protein AN8699.2 [Aspe... 54 7e-07
gi|23613293|ref|NP_703615.1| ubiquitin carboxyl-terminal hydrola... 52 3e-06
gi|9844928|gb|AAG00799.1| ubiquitin carboxyl-terminal hydrolase ... 52 4e-06
gi|34932475|ref|XP_225740.2| similar to high mobility group prot... 50 1e-05
gi|21355605|ref|NP_651118.1| CG6697-PA [Drosophila melanogaster]... 42 0.004
gi|28828788|gb|AAO51383.1| similar to Homo sapiens (Human). Hypo... 39 0.030
gi|50426711|ref|XP_461953.1| unnamed protein product [Debaryomyc... 37 0.11
gi|30680235|ref|NP_849320.1| ubiquitin family protein [Arabidops... 36 0.19
gi|50303065|ref|XP_451470.1| unnamed protein product [Kluyveromy... 36 0.19
gi|50754959|ref|XP_414559.1| PREDICTED: similar to Hypothetical ... 35 0.33
gi|34870667|ref|XP_340788.1| similar to hypothetical protein MGC... 35 0.56
gi|49259487|pdb|1V5T|A Chain A, Solution Structure Of The Ubiqui... 35 0.56
gi|47221811|emb|CAG08865.1| unnamed protein product [Tetraodon n... 35 0.56
gi|21450802|ref|NP_659486.1| hypothetical protein MGC10067 [Homo... 35 0.56
gi|46575895|ref|NP_077795.2| cDNA sequence BC002236 [Mus musculu... 35 0.56
gi|22800619|gb|AAH13425.2| Hypothetical protein MGC10067 [Homo s... 35 0.56
gi|50539706|ref|NP_001002319.1| zgc:86634 [Danio rerio] >gnl|BL_... 34 0.96
gi|34901836|ref|NP_912264.1| putative PNGase (peptide N-glycanas... 33 1.3
gi|33146540|dbj|BAC79717.1| putative PNGase (peptide N-glycanase... 33 1.3
gi|50761859|ref|XP_424859.1| PREDICTED: similar to KIAA0433 [Gal... 33 1.6
gi|19115071|ref|NP_594159.1| yeast dsk2 homolog, ubiquitin-like ... 33 2.1
gi|31200221|ref|XP_309058.1| ENSANGP00000019582 [Anopheles gambi... 33 2.1
gi|47220077|emb|CAG12225.1| unnamed protein product [Tetraodon n... 32 2.8
gi|14318532|ref|NP_116665.1| Ubiquitin-specific protease situate... 32 3.7
gi|20070398|ref|NP_613055.1| DNA segment, Chr 7, Wayne State Uni... 32 4.8
gi|34859122|ref|XP_215053.2| similar to D7Wsu128e protein [Rattu... 32 4.8
gi|15030121|gb|AAH11313.1| D7Wsu128e protein [Mus musculus] 32 4.8
gi|50513945|pdb|1V86|A Chain A, Solution Structure Of The Ubiqui... 32 4.8
gi|20129061|ref|NP_608344.1| CG14224-PA [Drosophila melanogaster... 31 6.2
gi|50292485|ref|XP_448675.1| unnamed protein product [Candida gl... 31 6.2
>gi|17531751|ref|NP_497006.1| ubiquitin specific protease (55.9 kD)
(usp-14) [Caenorhabditis elegans]
gi|20178345|sp|Q17361|UBPE_CAEEL Ubiquitin carboxyl-terminal
hydrolase 14 (Ubiquitin thiolesterase 14)
(Ubiquitin-specific processing protease 14)
(Deubiquitinating enzyme 14)
gi|7511620|pir||T19227 queuine tRNA-ribosyltransferase (EC
2.4.2.29) C13B4.2 - Caenorhabditis elegans
gi|3874273|emb|CAB03876.1| Hypothetical protein C13B4.2
[Caenorhabditis elegans]
gi|3878545|emb|CAB05785.1| Hypothetical protein C13B4.2
[Caenorhabditis elegans]
Length = 489
Score = 144 bits (362), Expect = 7e-34
Identities = 70/70 (100%), Positives = 70/70 (100%)
Frame = -1
Query: 212 MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI 33
MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI
Sbjct: 1 MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI 60
Query: 32 KENMTIMMMG 3
KENMTIMMMG
Sbjct: 61 KENMTIMMMG 70
>gi|967276|gb|AAA74956.1| tRNA-guanine transglycosylase
Length = 489
Score = 144 bits (362), Expect = 7e-34
Identities = 70/70 (100%), Positives = 70/70 (100%)
Frame = -1
Query: 212 MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI 33
MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI
Sbjct: 1 MPIVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDDDWEGITI 60
Query: 32 KENMTIMMMG 3
KENMTIMMMG
Sbjct: 61 KENMTIMMMG 70