Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K11E8_11
(355 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|14530495|emb|CAA94243.3| Hypothetical protein K11E8.1b [Caeno... 240 6e-63
gi|7505787|pir||T23615 hypothetical protein K11E8.1b - Caenorhab... 238 2e-62
gi|32565735|ref|NP_501897.3| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|7505786|pir||T23614 hypothetical protein K11E8.1a - Caenorhab... 219 8e-57
gi|32565732|ref|NP_501898.3| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|14530497|emb|CAA94244.2| Hypothetical protein K11E8.1c [Caeno... 219 8e-57
gi|14530496|emb|CAA94242.2| Hypothetical protein K11E8.1a [Caeno... 219 8e-57
gi|32565730|ref|NP_501900.3| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|32565743|ref|NP_501903.3| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|32565740|ref|NP_501902.2| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|32565737|ref|NP_501901.2| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|17542676|ref|NP_501899.1| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|7505788|pir||T23616 hypothetical protein K11E8.1c - Caenorhab... 219 8e-57
gi|25145098|ref|NP_501896.2| UNCoordinated locomotion UNC-43, DE... 219 8e-57
gi|39581826|emb|CAE60719.1| Hypothetical protein CBG04391 [Caeno... 219 1e-56
gi|31204371|ref|XP_311134.1| ENSANGP00000017518 [Anopheles gambi... 211 2e-54
gi|46576378|sp|Q00168|KCCA_DROME Calcium/calmodulin-dependent pr... 209 8e-54
gi|348329|pir||D44412 Ca2+/calmodulin-dependent protein kinase (... 209 8e-54
gi|7428014|pir||JU0270 Ca2+/calmodulin-dependent protein kinase ... 209 8e-54
gi|24638772|ref|NP_726634.1| CG18069-PB [Drosophila melanogaster... 209 8e-54
gi|348327|pir||B44412 calmodulin-dependent protein kinase II (EC... 209 8e-54
gi|45549243|ref|NP_524635.3| CG18069-PC [Drosophila melanogaster... 209 8e-54
gi|1561717|gb|AAB40712.1| calcium/calmodulin-dependent protein k... 208 2e-53
gi|1561715|gb|AAB40711.1| calcium/calmodulin-dependent protein k... 199 8e-51
gi|18158420|ref|NP_076302.1| calcium/calmodulin-dependent protei... 195 2e-49
gi|26667183|ref|NP_742113.1| calcium/calmodulin-dependent protei... 195 2e-49
gi|26667180|ref|NP_001212.2| calcium/calmodulin-dependent protei... 195 2e-49
gi|3241849|dbj|BAA28870.1| calmodulin-dependent protein kinase I... 195 2e-49
gi|47523818|ref|NP_999546.1| calcium/calmodulin-dependent protei... 195 2e-49
gi|6978595|ref|NP_036651.1| calcium/calmodulin-dependent protein... 195 2e-49
gi|6688230|emb|CAB65123.1| calcium/calmodulin dependent protein ... 195 2e-49
gi|26328339|dbj|BAC27910.1| unnamed protein product [Mus musculus] 195 2e-49
gi|47228547|emb|CAG05367.1| unnamed protein product [Tetraodon n... 195 2e-49
gi|466360|gb|AAA81938.1| calmodulin dependent protein kinase II ... 194 3e-49
gi|50540150|ref|NP_001002542.1| zgc:92792 [Danio rerio] >gnl|BL_... 194 5e-49
gi|26333029|dbj|BAC30232.1| unnamed protein product [Mus musculus] 194 5e-49
gi|10443732|gb|AAG17554.1| calcium/calmodulin-dependent protein ... 193 8e-49
gi|603213|gb|AAA57338.1| calcium/calmodulin-dependent kinase typ... 193 8e-49
gi|26667203|ref|NP_751911.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|631810|pir||S43845 Ca2+/calmodulin-dependent protein kinase (... 192 1e-48
gi|26667199|ref|NP_751910.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|3241847|dbj|BAA28869.1| calmodulin-dependent protein kinase I... 192 1e-48
gi|26667206|ref|NP_751912.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|47523472|ref|NP_999358.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|20178304|sp|Q13555|KCCG_HUMAN Calcium/calmodulin-dependent pr... 192 1e-48
gi|12643414|sp|Q13557|KCCD_HUMAN Calcium/calmodulin-dependent pr... 192 1e-48
gi|20177955|sp|Q923T9|KCCG_MOUSE Calcium/calmodulin-dependent pr... 192 1e-48
gi|19424316|ref|NP_598289.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|18448919|gb|AAL69956.1| CaM kinase II gamma J [Mustela putori... 192 1e-48
gi|26667211|ref|NP_751913.1| calcium/calmodulin-dependent protei... 192 1e-48
gi|2511440|gb|AAB80848.1| calcium/calmodulin-dependent protein k... 192 1e-48
gi|21039158|gb|AAM33514.1| calcium/calmodulin-dependent protein ... 192 1e-48
gi|26667191|ref|NP_001213.2| calcium/calmodulin-dependent protei... 192 1e-48
gi|560653|gb|AAB30671.1| Ca2+/calmodulin-dependent protein kinas... 192 1e-48
gi|18448923|gb|AAL69958.1| CaM kinase II gamma G-2 [Mustela puto... 192 1e-48
gi|30519907|ref|NP_848712.1| calcium/calmodulin -dependent prote... 192 1e-48
gi|26344219|dbj|BAC35766.1| unnamed protein product [Mus musculus] 192 1e-48
gi|26051208|ref|NP_742076.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|7434373|pir||S68470 Ca2+/calmodulin-dependent protein kinase ... 192 2e-48
gi|50749382|ref|XP_421612.1| PREDICTED: similar to calcium/calmo... 192 2e-48
gi|26051218|ref|NP_742081.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|26051212|ref|NP_742078.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|5326759|gb|AAD42036.1| calcium/calmodulin-dependent protein k... 192 2e-48
gi|21707842|gb|AAH34044.1| Calcium/calmodulin-dependent protein ... 192 2e-48
gi|26051216|ref|NP_742080.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|26051210|ref|NP_742077.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|26051214|ref|NP_742079.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|26051204|ref|NP_001211.3| calcium/calmodulin-dependent protei... 192 2e-48
gi|12643413|sp|Q13554|KCCB_HUMAN Calcium/calmodulin-dependent pr... 192 2e-48
gi|125286|sp|P28652|KCCB_MOUSE Calcium/calmodulin-dependent prot... 192 2e-48
gi|26051206|ref|NP_742075.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|11120682|ref|NP_068507.1| calcium/calmodulin-dependent protei... 192 2e-48
gi|46048967|ref|NP_989625.1| calcium/calmodulin-dependent protei... 191 3e-48
gi|29124575|gb|AAH49002.1| Camk2g-prov protein [Xenopus laevis] 191 4e-48
gi|10443736|gb|AAG17556.1| calcium/calmodulin-dependent protein ... 191 4e-48
gi|10443734|gb|AAG17555.1| calcium/calmodulin-dependent protein ... 191 4e-48
gi|20177970|sp|Q9UQM7|KCCA_HUMAN Calcium/calmodulin-dependent pr... 190 5e-48
gi|26251712|gb|AAH40457.1| Calcium/calmodulin-dependent protein ... 190 5e-48
gi|6978593|ref|NP_037052.1| calcium/calmodulin-dependent protein... 190 5e-48
gi|90334|pir||S04365 Ca2+/calmodulin-dependent protein kinase (E... 190 5e-48
gi|25952118|ref|NP_741960.1| calcium/calmodulin-dependent protei... 190 5e-48
gi|25952114|ref|NP_057065.2| calcium/calmodulin-dependent protei... 190 5e-48
gi|4836795|gb|AAD30559.1| calcium/calmodulin-dependent protein k... 190 5e-48
gi|4589580|dbj|BAA76812.1| KIAA0968 protein [Homo sapiens] 190 5e-48
gi|33304057|gb|AAQ02536.1| calcium/calmodulin-dependent protein ... 190 5e-48
gi|39104626|dbj|BAC65692.3| mKIAA0968 protein [Mus musculus] 190 5e-48
gi|10443740|gb|AAG17558.1| calcium/calmodulin-dependent protein ... 190 5e-48
gi|10443738|gb|AAG17557.1| calcium/calmodulin-dependent protein ... 190 5e-48
gi|4139268|gb|AAD03743.1| calcium/calmodulin-dependent protein k... 189 9e-48
gi|4139270|gb|AAD03744.1| calcium/calmodulin-dependent protein k... 189 9e-48
gi|50417147|gb|AAH77143.1| Unknown (protein for MGC:101001) [Dan... 189 1e-47
gi|31982483|ref|NP_031621.2| calcium/calmodulin-dependent protei... 189 1e-47
gi|4063713|gb|AAC98390.1| calcium/calmodulin-dependent kinase II... 188 2e-47
gi|125284|sp|P11798|KCCA_MOUSE Calcium/calmodulin-dependent prot... 188 2e-47
gi|46048958|ref|NP_989626.1| calcium/calmodulin-dependent protei... 188 2e-47
gi|47221345|emb|CAF97263.1| unnamed protein product [Tetraodon n... 185 2e-46
gi|49257872|gb|AAH74394.1| Unknown (protein for MGC:84365) [Xeno... 184 3e-46
gi|18448915|gb|AAL69954.1| CaM kinase II gamma C-2 [Mustela puto... 180 7e-45
gi|47211442|emb|CAF93694.1| unnamed protein product [Tetraodon n... 170 7e-42
gi|34100406|gb|AAQ57276.1| calmodulin-dependent protein kinase t... 166 1e-40
gi|6137071|emb|CAB59634.1| Ca2+/calmodulin-dependent protein kin... 162 2e-39
gi|3241845|dbj|BAA28868.1| calmodulin-dependent protein kinase I... 159 1e-38
gi|41472476|gb|AAS07454.1| unknown [Homo sapiens] 156 8e-38
gi|47221517|emb|CAG08179.1| unnamed protein product [Tetraodon n... 137 7e-32
gi|225775|prf||1313192A calmodulin dependent protein kinase II 130 5e-30
gi|47218197|emb|CAF97061.1| unnamed protein product [Tetraodon n... 129 1e-29
gi|40226338|gb|AAH21269.2| CAMK2G protein [Homo sapiens] 123 8e-28
gi|2204281|gb|AAB61379.1| calcium/calmodulin-dependent protein k... 121 3e-27
gi|48095705|ref|XP_392343.1| similar to glucosamine--fructose-6-... 115 3e-25
gi|50746757|ref|XP_420640.1| PREDICTED: similar to Calcium/calmo... 114 5e-25
gi|47203058|emb|CAG14690.1| unnamed protein product [Tetraodon n... 112 2e-24
gi|27820092|gb|AAO25071.1| GH04968p [Drosophila melanogaster] 110 5e-24
gi|47203824|emb|CAG14691.1| unnamed protein product [Tetraodon n... 110 5e-24
gi|47216112|emb|CAG11180.1| unnamed protein product [Tetraodon n... 110 9e-24
gi|47939965|gb|AAH72206.1| MGC81183 protein [Xenopus laevis] 107 4e-23
gi|2854042|gb|AAC02532.1| protein kinase 4 [Toxoplasma gondii] 107 6e-23
gi|47223106|emb|CAG07193.1| unnamed protein product [Tetraodon n... 106 1e-22
gi|1279425|emb|CAA96439.1| calmodulin-domain protein kinase [Eim... 105 2e-22
gi|28829037|gb|AAO51612.1| similar to Dictyostelium discoideum (... 105 2e-22
gi|47212898|emb|CAF90788.1| unnamed protein product [Tetraodon n... 105 3e-22
gi|23491815|dbj|BAC19847.1| calcium/calmodulin-dependent protein... 105 3e-22
gi|47223108|emb|CAG07195.1| unnamed protein product [Tetraodon n... 104 4e-22
gi|50761048|ref|XP_425902.1| PREDICTED: similar to Death-associa... 104 4e-22
gi|49257590|gb|AAH74183.1| Unknown (protein for MGC:82022) [Xeno... 104 4e-22
gi|12484153|gb|AAG53993.1| calmodulin-domain protein kinase 1 [T... 103 6e-22
gi|7434372|pir||T37321 Ca2+/calmodulin-dependent protein kinase ... 103 8e-22
gi|17539480|ref|NP_500139.1| CaM Kinase (39.1 kD) (cmk-1) [Caeno... 103 8e-22
gi|33772637|gb|AAQ54691.1| calcium/calmodulin-dependent protein ... 103 8e-22
gi|28465377|dbj|BAC57465.1| calcium-dependent protein kinase [Ba... 103 8e-22
gi|37362775|gb|AAQ91345.1| calmodulin-domain protein kinase [Eim... 103 8e-22
gi|39583744|emb|CAE63848.1| Hypothetical protein CBG08406 [Caeno... 103 8e-22
gi|4557511|ref|NP_001339.1| death-associated protein kinase 3 [H... 103 1e-21
gi|34328167|ref|NP_034149.2| death-associated kinase 2 [Mus musc... 103 1e-21
gi|26342637|dbj|BAC34975.1| unnamed protein product [Mus musculus] 103 1e-21
gi|33304011|gb|AAQ02513.1| CamKI-like protein kinase [synthetic ... 103 1e-21
gi|9966875|ref|NP_065130.1| calcium/calmodulin-dependent protein... 103 1e-21
gi|23943850|ref|NP_705718.1| calcium/calmodulin-dependent protei... 103 1e-21
gi|28893481|ref|NP_796317.1| calcium/calmodulin-dependent protei... 103 1e-21
gi|33304115|gb|AAQ02565.1| death-associated protein kinase 3 [sy... 103 1e-21
gi|47225849|emb|CAF98329.1| unnamed protein product [Tetraodon n... 103 1e-21
gi|47218247|emb|CAF96284.1| unnamed protein product [Tetraodon n... 103 1e-21
gi|30523260|gb|AAP31673.1| calcium/calmodulin-dependent protein ... 103 1e-21
gi|31200303|ref|XP_309099.1| ENSANGP00000019618 [Anopheles gambi... 102 1e-21
gi|11968142|ref|NP_071991.1| Death-associated like kinase [Rattu... 102 1e-21
gi|6681133|ref|NP_031854.1| death-associated kinase 3; ZIP kinas... 102 1e-21
gi|48141836|ref|XP_393569.1| similar to ENSANGP00000019618 [Apis... 102 2e-21
gi|23308741|ref|NP_694420.1| calcium/calmodulin-dependent serine... 100 5e-21
gi|2661106|gb|AAB88198.1| CASK [Homo sapiens] 100 7e-21
gi|22203757|ref|NP_666345.1| calcium/calmodulin-dependent serine... 100 7e-21
gi|4502567|ref|NP_003679.1| calcium/calmodulin-dependent serine ... 100 7e-21
gi|50776838|ref|XP_423275.1| PREDICTED: similar to calcium/calmo... 100 7e-21
gi|50730099|ref|XP_416769.1| PREDICTED: similar to CASK [Gallus ... 100 7e-21
gi|27735175|sp|O14936|CSKP_HUMAN Peripheral plasma membrane prot... 100 7e-21
gi|11559947|ref|NP_071520.1| calcium/calmodulin-dependent serine... 100 7e-21
gi|47227854|emb|CAG09017.1| unnamed protein product [Tetraodon n... 100 7e-21
gi|6753276|ref|NP_033936.1| calcium/calmodulin-dependent serine ... 100 7e-21
gi|47223289|emb|CAF98673.1| unnamed protein product [Tetraodon n... 100 7e-21
gi|3560543|gb|AAC35001.1| DAP-kinase related protein 1 [Homo sap... 100 9e-21
gi|6521217|dbj|BAA88064.1| Death-associated protein kinase 2 [Mu... 100 9e-21
gi|14670383|ref|NP_055141.2| death-associated protein kinase 2 [... 100 9e-21
gi|41152258|ref|NP_957123.1| hypothetical protein MGC73155 [Dani... 100 1e-20
gi|47221020|emb|CAG12714.1| unnamed protein product [Tetraodon n... 99 2e-20
gi|11067437|ref|NP_067731.1| serine/threonine kinase [Rattus nor... 99 2e-20
gi|37589428|gb|AAH58556.1| Mark2 protein [Mus musculus] 99 2e-20
gi|34782791|gb|AAH08771.2| MARK2 protein [Homo sapiens] 99 2e-20
gi|30584009|gb|AAP36253.1| Homo sapiens MAP/microtubule affinity... 99 2e-20
gi|7446398|pir||G01025 serine/threonine protein kinase - human 99 2e-20
gi|9845487|ref|NP_059672.1| MAP/microtubule affinity-regulating ... 99 2e-20
gi|9845489|ref|NP_004945.2| MAP/microtubule affinity-regulating ... 99 2e-20
gi|15042611|gb|AAK82368.1| Ser/Thr protein kinase PAR-1Balpha [H... 99 2e-20
gi|30583523|gb|AAP36006.1| MAP/microtubule affinity-regulating k... 99 2e-20
gi|26337255|dbj|BAC32312.1| unnamed protein product [Mus musculus] 99 2e-20
gi|17975557|ref|NP_524622.1| CG1495-PG [Drosophila melanogaster]... 99 2e-20
gi|19698204|dbj|BAB86594.1| serine/threonine kinase [Xenopus lae... 99 2e-20
gi|27694575|gb|AAH43730.1| Mark2-prov protein [Xenopus laevis] 99 2e-20
gi|50415076|gb|AAH77973.1| Unknown (protein for MGC:81026) [Xeno... 99 3e-20
gi|16758824|ref|NP_446399.1| MAP/microtubule affinity-regulating... 99 3e-20
gi|50740239|ref|XP_419403.1| PREDICTED: similar to MARK [Gallus ... 99 3e-20
gi|50256568|gb|EAL19293.1| hypothetical protein CNBH3920 [Crypto... 99 3e-20
gi|21704014|ref|NP_663490.1| MAP/microtubule affinity-regulating... 99 3e-20
gi|8099346|gb|AAF72103.1| MARK [Homo sapiens] 99 3e-20
gi|29378343|gb|AAO83853.1| calcium/calmodulin-dependent serine p... 99 3e-20
gi|27923329|gb|AAO27568.1| Ser/Thr protein kinase PAR-1B alpha [... 99 3e-20
gi|47939752|gb|AAH72186.1| MGC80341 protein [Xenopus laevis] 98 3e-20
gi|50748742|ref|XP_421385.1| PREDICTED: similar to MAP/microtubu... 98 5e-20
gi|12313875|ref|NP_073712.1| MAP/microtubule affinity-regulating... 98 5e-20
gi|47229753|emb|CAG06949.1| unnamed protein product [Tetraodon n... 98 5e-20
gi|18543359|ref|NP_570105.1| MAP/microtubule affinity-regulating... 98 5e-20
gi|12313871|ref|NP_067491.1| MAP/microtubule affinity-regulating... 98 5e-20
gi|50754447|ref|XP_414388.1| PREDICTED: similar to Camk1-prov pr... 98 5e-20
gi|27923327|gb|AAO27567.1| Ser/Thr protein kinase PAR-1A [Xenopu... 98 5e-20
gi|21356423|ref|NP_650065.1| CG17216-PA [Drosophila melanogaster... 97 6e-20
gi|2564680|gb|AAB81837.1| putative KP78 protein kinase [Drosophi... 97 6e-20
gi|19527891|gb|AAL90060.1| AT13327p [Drosophila melanogaster] 97 6e-20
gi|46852166|ref|NP_002367.4| MAP/microtubule affinity-regulating... 97 6e-20
gi|3089349|gb|AAC15093.1| Cdc25C associated protein kinase C-TAK... 97 6e-20
gi|19353236|gb|AAH24773.1| MAP/microtubule affinity-regulating k... 97 6e-20
gi|28071002|emb|CAD61882.1| unnamed protein product [Homo sapiens] 97 6e-20
gi|46227305|gb|EAK88255.1| calcium/calmodulin dependent protein ... 97 6e-20
gi|15042609|gb|AAK82367.1| Ser/Thr protein kinase PAR-1A [Homo s... 97 6e-20
gi|47217368|emb|CAG11073.1| unnamed protein product [Tetraodon n... 97 8e-20
gi|46488893|gb|AAS99650.1| calcium dependent protein kinase 4 [P... 97 8e-20
gi|23612547|ref|NP_704108.1| calmodulin-domain protein kinase, p... 97 8e-20
gi|23491280|gb|EAA22858.1| calmodulin-domain protein kinase [Pla... 97 8e-20
gi|6679643|ref|NP_031954.1| MAP/microtubule affinity-regulating ... 97 8e-20
gi|50510947|dbj|BAD32459.1| mKIAA1477 protein [Mus musculus] 97 1e-19
gi|33304093|gb|AAQ02554.1| calcium/calmodulin-dependent protein ... 97 1e-19
gi|4678722|emb|CAB41259.1| hypothetical protein [Homo sapiens] 97 1e-19
gi|31241959|ref|XP_321410.1| ENSANGP00000011528 [Anopheles gambi... 97 1e-19
gi|31240095|ref|XP_320461.1| ENSANGP00000022382 [Anopheles gambi... 97 1e-19
gi|4007153|emb|CAA19296.1| dJ272L16.1 (Rat Ca2+/Calmodulin depen... 97 1e-19
gi|31240093|ref|XP_320460.1| ENSANGP00000016067 [Anopheles gambi... 97 1e-19
gi|23491817|dbj|BAC19848.1| calcium/calmodulin-dependent protein... 97 1e-19
gi|27469628|gb|AAH41721.1| Camk1-prov protein [Xenopus laevis] 97 1e-19
gi|16755792|gb|AAL28100.1| calcium/calmodulin-dependent protein ... 97 1e-19
gi|14196445|ref|NP_065172.1| calcium/calmodulin-dependent protei... 97 1e-19
gi|31241957|ref|XP_321409.1| ENSANGP00000008538 [Anopheles gambi... 97 1e-19
gi|24648808|ref|NP_524441.2| CG6703-PB [Drosophila melanogaster]... 96 1e-19
gi|48094488|ref|XP_394194.1| similar to ENSANGP00000022382 [Apis... 96 1e-19
gi|14017937|dbj|BAB47489.1| KIAA1860 protein [Homo sapiens] 96 1e-19
gi|34855312|ref|XP_341801.1| similar to MAP/microtubule affinity... 96 1e-19
gi|29840797|sp|Q96L34|MRK4_HUMAN MAP/microtubule affinity-regula... 96 1e-19
gi|26986591|ref|NP_758483.1| MAP/microtubule affinity-regulating... 96 1e-19
gi|33636756|ref|NP_113605.2| MAP/microtubule affinity-regulating... 96 1e-19
gi|2133707|pir||S69210 protein kinase caki (EC 2.7.1.-), calcium... 96 1e-19
gi|21450191|ref|NP_659066.1| calcium/calmodulin-dependent protei... 96 2e-19
gi|3929615|gb|AAC80169.1| Camguk [Drosophila melanogaster] 96 2e-19
gi|2077934|dbj|BAA19880.1| Protein Kinase [Rattus norvegicus] 96 2e-19
gi|2271461|gb|AAC13355.1| calcium-dependent protein kinase-b [Pa... 96 2e-19
gi|18448971|gb|AAL69982.1| MAP/microtubule affinity-regulating k... 96 2e-19
gi|33469057|ref|NP_878262.1| calcium/calmodulin-dependent protei... 96 2e-19
gi|33299962|dbj|BAC80243.1| Ca2+/calmodulin-dependent protein ki... 96 2e-19
gi|45552743|ref|NP_995896.1| CG8201-PE [Drosophila melanogaster]... 96 2e-19
gi|41054053|ref|NP_956179.1| MAP/microtubule affinity-regulating... 96 2e-19
gi|47825355|ref|NP_001001457.1| hypothetical protein MGC76030 [X... 96 2e-19
gi|45552731|ref|NP_995890.1| CG8201-PO [Drosophila melanogaster]... 96 2e-19
gi|45552741|ref|NP_995895.1| CG8201-PC [Drosophila melanogaster]... 96 2e-19
gi|50752799|ref|XP_413751.1| PREDICTED: similar to Death-associa... 96 2e-19
gi|45552749|ref|NP_995899.1| CG8201-PB [Drosophila melanogaster]... 96 2e-19
gi|45552739|ref|NP_995894.1| CG8201-PG [Drosophila melanogaster]... 96 2e-19
gi|125692|sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II al... 96 2e-19
gi|39752597|gb|AAR30180.1| RE47050p [Drosophila melanogaster] 96 2e-19
gi|15042607|gb|AAK82366.1| Ser/Thr protein kinase PAR-1beta [Dro... 96 2e-19
gi|41056055|ref|NP_956367.1| Unknown (protein for MGC:66139); wu... 96 2e-19
gi|15042605|gb|AAK82365.1| Ser/Thr protein kinase PAR-1alpha [Dr... 96 2e-19
gi|45552751|ref|NP_995900.1| CG8201-PA [Drosophila melanogaster]... 96 2e-19
gi|33589284|gb|AAQ22409.1| SD05712p [Drosophila melanogaster] 96 2e-19
gi|16197787|gb|AAL13494.1| GH01890p [Drosophila melanogaster] 96 2e-19
gi|45552745|ref|NP_995897.1| CG8201-PF [Drosophila melanogaster]... 96 2e-19
gi|33304069|gb|AAQ02542.1| ribosomal protein S6 kinase, 90kDa, p... 95 3e-19
gi|50760361|ref|XP_417986.1| PREDICTED: similar to hypothetical ... 95 3e-19
gi|91277|pir||C32571 ribosomal protein S6 kinase II (EC 2.7.-.-)... 95 3e-19
gi|4759050|ref|NP_004577.1| ribosomal protein S6 kinase, 90kDa, ... 95 3e-19
gi|22507357|ref|NP_683747.1| ribosomal protein S6 kinase polypep... 95 3e-19
gi|33354095|dbj|BAC81131.1| RPS6KA3 [Homo sapiens] >gnl|BL_ORD_I... 95 3e-19
gi|19527140|ref|NP_598687.1| calcium/calmodulin-dependent protei... 95 4e-19
gi|19745200|ref|NP_604463.1| regulator of G-protein signalling 1... 95 4e-19
gi|26354647|dbj|BAC40950.1| unnamed protein product [Mus musculus] 95 4e-19
gi|3114436|pdb|1A06| Calmodulin-Dependent Protein Kinase From Rat 95 4e-19
gi|284367|pir||S27966 probable serine/threonine-specific protein... 95 4e-19
gi|7497946|pir||T20232 hypothetical protein C54G4.1 - Caenorhabd... 94 5e-19
gi|32563675|ref|NP_492204.2| protein kinase and Protein kinase C... 94 5e-19
gi|50415115|gb|AAH77360.1| Unknown (protein for MGC:81366) [Xeno... 94 5e-19
gi|2271459|gb|AAC13354.1| calcium-dependent protein kinase-a [Pa... 94 7e-19
gi|18401539|ref|NP_566580.1| CBL-interacting protein kinase 1 (C... 94 7e-19
gi|11066952|gb|AAG28776.1| CBL-interacting protein kinase 1 [Ara... 94 7e-19
gi|20260556|gb|AAM13176.1| unknown protein [Arabidopsis thaliana] 94 7e-19
gi|102256|pir||A40811 myosin-light-chain kinase (EC 2.7.1.117) A... 94 7e-19
gi|1730055|sp|P25323|KMLC_DICDI Myosin light chain kinase (MLCK)... 94 7e-19
gi|9294138|dbj|BAB02040.1| serine/threonine kinase [Arabidopsis ... 94 7e-19
gi|38605718|sp|P53355|DAK1_HUMAN Death-associated protein kinase... 94 9e-19
gi|2564679|gb|AAB81836.1| putative KP78 protein kinase [Drosophi... 94 9e-19
gi|18416872|ref|NP_568281.1| calmodulin-domain protein kinase is... 94 9e-19
gi|30582709|gb|AAP35581.1| death-associated protein kinase 1 [Ho... 94 9e-19
gi|39582051|emb|CAE63694.1| Hypothetical protein CBG08209 [Caeno... 94 9e-19
gi|20150446|pdb|1JKK|A Chain A, 2.4a X-Ray Structure Of Ternary ... 94 9e-19
gi|2136035|pir||I38138 protein-serine kinase (EC 2.7.1.-) PSK-H1... 94 9e-19
gi|48128969|ref|XP_396640.1| similar to CG1776-PA [Apis mellifera] 94 9e-19
gi|20150170|pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary ... 94 9e-19
gi|34851710|ref|XP_344761.1| similar to protein serine kinase Ps... 94 9e-19
gi|27901803|ref|NP_006733.1| protein serine kinase H1; serine/th... 94 9e-19
gi|27734116|ref|NP_775608.1| hypothetical protein E130013P03 [Mu... 94 9e-19
gi|30584399|gb|AAP36448.1| Homo sapiens death-associated protein... 94 9e-19
gi|17530179|gb|AAL40735.1| protein serine kinase/luciferase fusi... 94 9e-19
gi|4826684|ref|NP_004929.1| death-associated protein kinase 1 [H... 94 9e-19
gi|21356537|ref|NP_650066.1| CG6715-PA [Drosophila melanogaster]... 94 9e-19
gi|33304047|gb|AAQ02531.1| protein serine kinase H1 [synthetic c... 94 9e-19
gi|47216138|emb|CAG10012.1| unnamed protein product [Tetraodon n... 93 1e-18
gi|4502553|ref|NP_003647.1| calcium/calmodulin-dependent protein... 93 1e-18
gi|47227255|emb|CAF96804.1| unnamed protein product [Tetraodon n... 93 1e-18
gi|33638111|gb|AAQ24165.1| ribosomal protein S6 kinase splice va... 93 1e-18
gi|26328137|dbj|BAC27809.1| unnamed protein product [Mus musculus] 93 1e-18
gi|3172111|dbj|BAA28663.1| HrPOPK-1 [Halocynthia roretzi] 93 1e-18
gi|33304167|gb|AAQ02591.1| calcium/calmodulin-dependent protein ... 93 1e-18
gi|21743250|dbj|BAC03375.1| microtubule affinity-regulating kina... 93 1e-18
gi|13366084|dbj|BAB39380.1| MAP/microtubule affinity-regulating ... 93 1e-18
gi|7434355|pir||T07415 probable serine/threonine-specific protei... 93 1e-18
gi|28829839|gb|AAO52341.1| similar to Xenopus laevis (African cl... 93 1e-18
gi|13592065|ref|NP_112369.1| S6 protein kinase (Rsk-1) [Rattus n... 93 1e-18
gi|34935429|ref|XP_234468.2| similar to ribosomal protein S6 kin... 93 1e-18
gi|47216774|emb|CAG03778.1| unnamed protein product [Tetraodon n... 93 1e-18
gi|21666998|gb|AAM73860.1| putative serine/threonine protein kin... 93 1e-18
gi|21667003|gb|AAM73862.1| putative serine/threonine protein kin... 93 1e-18
gi|21666992|gb|AAM73857.1| putative serine/threonine protein kin... 93 1e-18
gi|21667000|gb|AAM73861.1| putative serine/threonine protein kin... 93 1e-18
gi|37901484|gb|AAP51269.1| SNF1-related protein kinase [Lycopers... 93 1e-18
gi|21666994|gb|AAM73858.1| putative serine/threonine protein kin... 93 1e-18
gi|21666996|gb|AAM73859.1| putative serine/threonine protein kin... 93 1e-18
gi|47125198|gb|AAH70744.1| MGC83745 protein [Xenopus laevis] 93 1e-18
gi|50762384|ref|XP_429223.1| PREDICTED: similar to Death-associa... 93 1e-18
gi|18034789|ref|NP_542151.1| phosphorylase kinase, gamma 2 (test... 92 2e-18
gi|50745818|ref|XP_420257.1| PREDICTED: similar to Ribosomal pro... 92 2e-18
gi|13605770|gb|AAK32877.1| 90-kDa ribosomal protein S6 kinase [R... 92 2e-18
gi|50730201|ref|XP_416804.1| PREDICTED: similar to ribosomal pro... 92 2e-18
gi|39590019|emb|CAE61017.1| Hypothetical protein CBG04756 [Caeno... 92 2e-18
gi|25396625|pir||G89287 protein H39E23.1 [imported] - Caenorhabd... 92 2e-18
gi|50746315|ref|XP_420439.1| PREDICTED: similar to hypothetical ... 92 2e-18
gi|733123|gb|AAA97437.1| serine/threonine kinase 92 2e-18
gi|17562784|ref|NP_506499.1| serine/threonine kinase, establishe... 92 2e-18
gi|34899838|ref|NP_911265.1| putative calcium-dependent protein ... 92 2e-18
gi|34393291|dbj|BAC83205.1| putative calcium-dependent protein k... 92 2e-18
gi|125694|sp|P10666|K6AB_XENLA Ribosomal protein S6 kinase II be... 92 2e-18
gi|49256532|gb|AAH71102.1| Unknown (protein for MGC:81220) [Xeno... 92 2e-18
gi|25145948|ref|NP_741639.1| serine/threonine kinase, establishe... 92 2e-18
gi|46485791|gb|AAS98416.1| putative protein kinase [Oryza sativa... 92 3e-18
gi|8101954|gb|AAF72667.1| calcium/calmodulin-dependent serine pr... 92 3e-18
gi|47226950|emb|CAG05842.1| unnamed protein product [Tetraodon n... 92 3e-18
gi|29294760|gb|AAH49076.1| Rps6ka1 protein [Mus musculus] 92 3e-18
gi|32528297|ref|NP_872198.1| ribosomal protein S6 kinase, 90kDa,... 92 3e-18
gi|34785717|gb|AAH57317.1| Dapk1 protein [Mus musculus] >gnl|BL_... 92 3e-18
gi|13676454|dbj|BAB41150.1| hypothetical protein [Macaca fascicu... 92 3e-18
gi|29825683|gb|AAO91935.1| death-associated protein kinase-alpha... 92 3e-18
gi|24371219|ref|NP_083929.1| death associated protein kinase 1 [... 92 3e-18
gi|34894358|ref|NP_908504.1| unnamed protein product [Oryza sati... 92 3e-18
gi|6677811|ref|NP_033123.1| ribosomal protein S6 kinase polypept... 92 3e-18
gi|32027990|gb|AAO91934.2| death-associated protein kinase-beta ... 92 3e-18
gi|38604743|sp|Q80YE7|DAK1_MOUSE Death-associated protein kinase... 92 3e-18
gi|2134984|pir||I37275 death-associated protein kinase (EC 2.7.1... 92 3e-18
gi|19923570|ref|NP_066958.2| ribosomal protein S6 kinase, 90kDa,... 92 3e-18
gi|6166243|sp|Q15349|K6A2_HUMAN Ribosomal protein S6 kinase alph... 92 3e-18
gi|38648708|gb|AAH63268.1| BC033915 protein [Mus musculus] 92 3e-18
gi|32528295|ref|NP_004746.2| ribosomal protein S6 kinase, 90kDa,... 92 3e-18
gi|14133229|dbj|BAA76843.2| KIAA0999 protein [Homo sapiens] 91 4e-18
gi|22749267|ref|NP_689832.1| hypothetical protein MGC45428 [Homo... 91 4e-18
gi|21740293|emb|CAD39156.1| hypothetical protein [Homo sapiens] 91 4e-18
gi|41152373|ref|NP_956260.1| calcium/calmodulin-dependent protei... 91 4e-18
gi|4505785|ref|NP_000285.1| phosphorylase kinase, gamma 2 (testi... 91 4e-18
gi|50730959|ref|XP_417099.1| PREDICTED: similar to doublecortin-... 91 4e-18
gi|33303965|gb|AAQ02490.1| phosphorylase kinase, gamma 2 [synthe... 91 4e-18
gi|38569491|ref|NP_079440.2| KIAA0999 protein [Homo sapiens] 91 4e-18
gi|25387053|pir||E96522 hypothetical protein F11A17.18 [imported... 91 4e-18
gi|40254281|ref|NP_081815.3| RIKEN cDNA 6330415M09 [Mus musculus... 91 4e-18
gi|401772|gb|AAC82496.1| ribosomal protein S6 kinase 2 [Homo sap... 91 4e-18
gi|15221136|ref|NP_175260.1| CBL-interacting protein kinase 17 (... 91 4e-18
gi|26349831|dbj|BAC38555.1| unnamed protein product [Mus musculus] 91 4e-18
gi|26339854|dbj|BAC33590.1| unnamed protein product [Mus musculus] 91 4e-18
gi|12004268|gb|AAG43970.1| calmodulin-binding protein kinase [Ar... 91 6e-18
gi|49080506|ref|XP_403764.1| hypothetical protein UM06149.1 [Ust... 91 6e-18
gi|46518544|ref|NP_081164.1| phosphorylase kinase, gamma 2 (test... 91 6e-18
gi|28481728|ref|XP_133769.3| 5phosphorylase kinase, gamma 2 (tes... 91 6e-18
gi|47221835|emb|CAG08889.1| unnamed protein product [Tetraodon n... 91 6e-18
gi|50508332|dbj|BAD30183.1| putative serine/threonine kinase [Or... 91 6e-18
gi|33303997|gb|AAQ02506.1| ribosomal protein S6 kinase, 90kDa, p... 91 6e-18
gi|401774|gb|AAC82495.1| ribosomal protein S6 kinase 3 [Homo sap... 91 6e-18
gi|49168616|emb|CAG38803.1| RPS6KA6 [Homo sapiens] 91 6e-18
gi|7657526|ref|NP_055311.1| ribosomal protein S6 kinase, 90kDa, ... 91 6e-18
gi|7672782|gb|AAF66639.1| SNF1 [Lycopersicon esculentum] 91 6e-18
gi|47086473|ref|NP_997951.1| ribosomal protein S6 kinase polypep... 91 6e-18
gi|11181910|emb|CAC16111.1| bA54F22.1.1 (ribosomal protein S6 ki... 91 6e-18
gi|15239742|ref|NP_197446.1| calcium-dependent protein kinase 19... 91 7e-18
gi|737902|prf||1923385A Ca/calmodulin-dependent protein kinase I... 91 7e-18
gi|6978597|ref|NP_036859.1| calcium/calmodulin-dependent protein... 91 7e-18
gi|47221231|emb|CAG13167.1| unnamed protein product [Tetraodon n... 91 7e-18
gi|23489282|gb|EAA21537.1| Plasmodium falciparum CDPK2 protein [... 91 7e-18
gi|47226221|emb|CAG08368.1| unnamed protein product [Tetraodon n... 91 7e-18
gi|6320685|ref|NP_010765.1| Required for release from glucose re... 91 7e-18
gi|32261078|dbj|BAC78445.1| Ca2+/calmodulin-dependent protein ki... 91 7e-18
gi|7434354|pir||T10449 probable serine/threonine-specific protei... 91 7e-18
gi|4502557|ref|NP_001735.1| calcium/calmodulin-dependent protein... 91 7e-18
gi|47123268|gb|AAH70022.1| Unknown (protein for MGC:85904) [Dani... 91 7e-18
gi|41054605|ref|NP_956835.1| hypothetical protein MGC66101 [Dani... 91 7e-18
gi|26326213|dbj|BAC26850.1| unnamed protein product [Mus musculu... 91 7e-18
gi|266412|sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protei... 91 7e-18
gi|33304109|gb|AAQ02562.1| calcium/calmodulin-dependent protein ... 91 7e-18
gi|203243|gb|AAA40856.1| calcium/calmodulin protein kinase 91 7e-18
gi|50312161|ref|XP_456112.1| unnamed protein product [Kluyveromy... 90 9e-18
gi|34857906|ref|XP_227490.2| similar to RIKEN cDNA 6330415M09 [R... 90 9e-18
gi|27529963|dbj|BAC53845.1| salt inducible kinase 2 [Mus musculus] 90 9e-18
gi|50753527|ref|XP_414024.1| PREDICTED: similar to Serine/threon... 90 9e-18
gi|47228175|emb|CAG07570.1| unnamed protein product [Tetraodon n... 90 9e-18
gi|37811658|gb|AAR03830.1| Snf1 related kinase 1 [Physcomitrella... 90 9e-18
gi|125693|sp|P10665|K6AA_XENLA Ribosomal protein S6 kinase II al... 90 9e-18
gi|47209687|emb|CAF92851.1| unnamed protein product [Tetraodon n... 90 9e-18
gi|33303975|gb|AAQ02495.1| ribosomal protein S6 kinase, 90kDa, p... 90 9e-18
gi|40788228|dbj|BAA20824.2| KIAA0369 [Homo sapiens] 90 1e-17
gi|4758128|ref|NP_004725.1| doublecortin and CaM kinase-like 1; ... 90 1e-17
gi|20128911|ref|NP_569972.1| CG4290-PA [Drosophila melanogaster]... 90 1e-17
gi|7511906|pir||T13741 hypothetical protein 22E5.8 - fruit fly (... 90 1e-17
gi|47013801|gb|AAT08446.1| putative serine/threonine kinase SADB... 90 1e-17
gi|6225242|sp|O15075|DCK1_HUMAN Serine/threonine-protein kinase ... 90 1e-17
gi|42571175|ref|NP_973661.1| calcium-dependent protein kinase, p... 90 1e-17
gi|25287680|pir||A84847 probable Ca2+ dependent protein kinase [... 90 1e-17
gi|38000010|gb|AAP57564.2| calcium-dependent protein kinase ZmCP... 90 1e-17
gi|6753252|ref|NP_033923.1| calcium/calmodulin-dependent protein... 90 1e-17
gi|34395684|sp|Q8TDC3|KI11_HUMAN Probable serine/threonine-prote... 89 2e-17
gi|30678280|ref|NP_850488.1| Snf1-related protein kinase (KIN10)... 89 2e-17
gi|18395701|ref|NP_566130.1| Snf1-related protein kinase (KIN10)... 89 2e-17
gi|46229407|gb|EAK90225.1| calcium/calmodulin-dependent protein ... 89 2e-17
gi|26328245|dbj|BAC27863.1| unnamed protein product [Mus musculus] 89 2e-17
gi|1076633|pir||A56009 serine/threonine-specific protein kinase ... 89 2e-17
gi|1076202|pir||S54788 calcium-stimulated protein kinase - Chlam... 89 2e-17
gi|21739847|emb|CAD38950.1| hypothetical protein [Homo sapiens] 89 2e-17
gi|406113|gb|AAA19670.1| protein kinase I 89 2e-17
gi|24308326|ref|NP_115806.1| KIAA1811 protein; SAD1 kinase [Homo... 89 2e-17
gi|50294644|ref|XP_449733.1| unnamed protein product [Candida gl... 89 2e-17
gi|9910164|ref|NP_064362.1| double cortin and calcium/calmodulin... 89 2e-17
gi|23619315|ref|NP_705277.1| calcium-dependent protein kinase [P... 89 2e-17
gi|50428135|ref|XP_458207.1| unnamed protein product [Debaryomyc... 89 2e-17
gi|26006151|dbj|BAC41418.1| mKIAA0369 protein [Mus musculus] 89 2e-17
gi|6716522|gb|AAF26675.1| CPG16 [Mus musculus] 89 2e-17
gi|26338930|dbj|BAC33136.1| unnamed protein product [Mus musculus] 89 2e-17
gi|17985955|ref|NP_445795.1| double cortin and calcium/calmoduli... 89 2e-17
gi|203220|gb|AAA40845.1| calcium/calmodulin-dependent protein ki... 89 2e-17
gi|6537166|gb|AAF15553.1| Rsk-2 [Xenopus laevis] 89 2e-17
gi|19171502|emb|CAC87494.1| calcium-dependent protein kinase [Ly... 89 2e-17
gi|47271332|emb|CAG27839.1| calcium-dependent protein kinase 8 [... 89 2e-17
gi|2117824|pir||I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-... 89 3e-17
gi|20149547|ref|NP_002944.2| ribosomal protein S6 kinase, 90kDa,... 89 3e-17
gi|50748598|ref|XP_421318.1| PREDICTED: similar to ribosomal pro... 89 3e-17
gi|15241748|ref|NP_198760.1| Snf1-related protein kinase, putati... 89 3e-17
gi|34303890|dbj|BAC82420.1| hypothetical protein [Entamoeba hist... 89 3e-17
gi|30694663|ref|NP_191312.2| calcium-dependent protein kinase, p... 89 3e-17
gi|47227067|emb|CAG00429.1| unnamed protein product [Tetraodon n... 89 3e-17
gi|11259874|pir||T46189 calcium-dependent protein kinase - Arabi... 89 3e-17
gi|34909116|ref|NP_915905.1| putative calcium-dependent protein ... 89 3e-17
gi|4099088|gb|AAD00542.1| SNF1 family protein kinase [Arabidopsi... 89 3e-17
gi|2654181|gb|AAC62515.1| calmodulin-dependent protein kinase; C... 89 3e-17
gi|4107009|dbj|BAA36298.1| OSK1 [Oryza sativa] >gnl|BL_ORD_ID|71... 89 3e-17
gi|2130048|pir||S59941 serine/threonine-specific protein kinase ... 89 3e-17
gi|50747888|ref|XP_421031.1| PREDICTED: similar to serine/threon... 89 3e-17
gi|32421231|ref|XP_331059.1| hypothetical protein ( (AF034963) c... 89 3e-17
gi|575292|emb|CAA57898.1| SNF1-related protein kinase [Hordeum v... 89 3e-17
gi|2077932|dbj|BAA19879.1| Protein Kinase [Rattus norvegicus] 88 4e-17
gi|8393035|ref|NP_058971.1| pregnancy upregulated non-ubiquitous... 88 4e-17
gi|6753248|ref|NP_036170.1| pregnancy upregulated non-ubiquitous... 88 4e-17
gi|34881194|ref|XP_228473.2| similar to Ribosomal protein S6 kin... 88 4e-17
gi|45184832|ref|NP_982550.1| AAR009Wp [Eremothecium gossypii] >g... 88 4e-17
gi|15239716|ref|NP_197437.1| calcium-dependent protein kinase, p... 88 4e-17
gi|2665890|gb|AAB88537.1| calcium-dependent protein kinase [Frag... 88 4e-17
gi|3556|emb|CAA40281.1| calmodulin-dependent protein kinase type... 88 4e-17
gi|6324557|ref|NP_014626.1| Calmodulin-dependent protein kinase;... 88 4e-17
gi|50254951|gb|EAL17691.1| hypothetical protein CNBL2060 [Crypto... 88 4e-17
gi|37811654|gb|AAR03828.1| Snf1 related kinase 1 [Physcomitrella... 88 4e-17
gi|38569460|ref|NP_056006.1| salt-inducible kinase 2 [Homo sapie... 88 4e-17
gi|30704686|gb|AAH51996.1| Pnck protein [Mus musculus] 88 4e-17
gi|50287495|ref|XP_446177.1| unnamed protein product [Candida gl... 88 4e-17
gi|34853790|ref|XP_341759.1| ribosomal protein S6 kinase, 90kD, ... 88 4e-17
gi|33243964|gb|AAH55331.1| Ribosomal protein S6 kinase, polypept... 88 4e-17
gi|6755374|ref|NP_035429.1| ribosomal protein S6 kinase, polypep... 88 4e-17
gi|12860267|dbj|BAB31901.1| unnamed protein product [Mus musculus] 88 4e-17
gi|20513539|dbj|BAB91442.1| KIAA0781 protein [Homo sapiens] 88 4e-17
gi|50758162|ref|XP_415789.1| PREDICTED: similar to Psph-A protei... 88 4e-17
gi|46105418|ref|XP_380513.1| hypothetical protein FG00337.1 [Gib... 88 4e-17
gi|20521654|dbj|BAA34501.3| KIAA0781 protein [Homo sapiens] 88 4e-17
gi|15277982|gb|AAH12964.1| Ribosomal protein S6 kinase, polypept... 88 5e-17
gi|9910454|ref|NP_064308.1| ribosomal protein S6 kinase, polypep... 88 5e-17
gi|34861515|ref|XP_342005.1| similar to ribosomal protein S6 kin... 88 5e-17
gi|34147319|gb|AAN41657.1| OsCDPK protein [Oryza sativa (japonic... 88 5e-17
gi|38569497|ref|NP_848825.2| salt-inducible kinase 2 [Mus musculus] 88 5e-17
gi|49091482|ref|XP_407202.1| hypothetical protein AN3065.2 [Aspe... 88 5e-17
gi|26334143|dbj|BAC30789.1| unnamed protein product [Mus musculus] 88 5e-17
gi|31200097|ref|XP_308996.1| ENSANGP00000020228 [Anopheles gambi... 88 5e-17
gi|47207845|emb|CAF93074.1| unnamed protein product [Tetraodon n... 88 5e-17
gi|44804760|gb|AAS47705.1| calcium-dependent protein kinase 1 [C... 88 5e-17
gi|50080313|gb|AAT69647.1| hypothetical protein [Oryza sativa (j... 88 5e-17
gi|47230027|emb|CAG10441.1| unnamed protein product [Tetraodon n... 88 5e-17
gi|1279423|emb|CAA96438.1| calmodulin-domain protein kinase [Eim... 88 5e-17
gi|26324476|dbj|BAC25992.1| unnamed protein product [Mus musculus] 88 5e-17
gi|46436455|gb|EAK95817.1| hypothetical protein CaO19.2268 [Cand... 87 6e-17
gi|46436390|gb|EAK95753.1| hypothetical protein CaO19.9808 [Cand... 87 6e-17
gi|34395849|sp|Q8IWQ3|ST29_HUMAN Serine/threonine-protein kinase... 87 6e-17
gi|38102428|gb|EAA49267.1| hypothetical protein MG00925.4 [Magna... 87 6e-17
gi|50260814|gb|EAL23464.1| hypothetical protein CNBA1140 [Crypto... 87 6e-17
gi|45382735|ref|NP_990013.1| qin-induced kinase [Gallus gallus] ... 87 6e-17
gi|27501464|ref|NP_003948.1| serine/threonine kinase 29; chromos... 87 6e-17
gi|12643489|sp|Q9R1U5|SN1L_RAT Probable serine/threonine-protein... 87 6e-17
gi|11067425|ref|NP_067725.1| salt-inducible protein kinase [Ratt... 87 6e-17
gi|45190377|ref|NP_984631.1| AEL230Wp [Eremothecium gossypii] >g... 87 6e-17
gi|33187740|gb|AAP97724.1| putative serine/threonine protein kin... 87 6e-17
gi|6754746|ref|NP_034961.1| SNF1-like kinase; myocardial SNF1-li... 87 6e-17
gi|23489576|gb|EAA21610.1| myosin light chain kinase [Plasmodium... 87 6e-17
gi|26450847|dbj|BAC42531.1| putative calcium-dependent protein k... 87 6e-17
gi|15225092|ref|NP_180708.1| calcium-dependent protein kinase, p... 87 6e-17
gi|29249241|gb|EAA40757.1| GLP_608_36888_34957 [Giardia lamblia ... 87 6e-17
gi|34393400|dbj|BAC82911.1| putative CBL-interacting protein kin... 87 6e-17
gi|50554447|ref|XP_504632.1| hypothetical protein [Yarrowia lipo... 87 8e-17
gi|18406082|ref|NP_566843.1| Snf1-related protein kinase (KIN11)... 87 8e-17
gi|1742967|emb|CAA64382.1| ser/thr protein kinase [Arabidopsis t... 87 8e-17
gi|47013803|gb|AAT08447.1| putative serine/threonine kinase SADA... 87 8e-17
gi|42572559|ref|NP_974375.1| Snf1-related protein kinase (KIN11)... 87 8e-17
>gi|14530495|emb|CAA94243.3| Hypothetical protein K11E8.1b
[Caenorhabditis elegans]
gi|14530611|emb|CAC42357.1| Hypothetical protein K11E8.1b
[Caenorhabditis elegans]
Length = 137
Score = 240 bits (612), Expect = 6e-63
Identities = 117/117 (100%), Positives = 117/117 (100%)
Frame = -2
Query: 354 GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE 175
GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE
Sbjct: 21 GAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE 80
Query: 174 ESFHYLVFDLVTGGELFEDIVAREFYSEADASCCIMQILDGVNYCHQRGIVHRDMKV 4
ESFHYLVFDLVTGGELFEDIVAREFYSEADASCCIMQILDGVNYCHQRGIVHRDMKV
Sbjct: 81 ESFHYLVFDLVTGGELFEDIVAREFYSEADASCCIMQILDGVNYCHQRGIVHRDMKV 137