Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M03C11_1
(1140 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554256|ref|NP_499294.1| protein kinase C-like (3L484) [Caen... 774 0.0
gi|39591899|emb|CAE71477.1| Hypothetical protein CBG18395 [Caeno... 735 0.0
gi|7161864|emb|CAB76566.1| serine/threonine protein kinase [Mus ... 345 1e-93
gi|33468971|ref|NP_071861.1| serine/threonine kinase 32B; serine... 345 1e-93
gi|26349721|dbj|BAC38500.1| unnamed protein product [Mus musculus] 345 1e-93
gi|8923754|ref|NP_060871.1| serine/threonine kinase 32B; gene fo... 337 4e-91
gi|23398528|gb|AAH38238.1| Serine/threonine kinase 32B [Homo sap... 336 5e-91
gi|50747232|ref|XP_420796.1| PREDICTED: similar to Serine/threon... 335 1e-90
gi|10946600|ref|NP_067277.1| serine/threonine kinase 32C; hypoth... 335 1e-90
gi|20071425|gb|AAH26457.1| Serine/threonine kinase 32C [Mus musc... 335 1e-90
gi|50755238|ref|XP_414667.1| PREDICTED: similar to serine/threon... 332 8e-90
gi|30520199|ref|NP_848864.1| serine/threonine kinase 32A [Mus mu... 332 1e-89
gi|32455269|ref|NP_775846.2| serine/threonine kinase 32C; PKE pr... 332 1e-89
gi|49117936|gb|AAH72876.1| Unknown (protein for MGC:80293) [Xeno... 329 8e-89
gi|34879357|ref|XP_344678.1| similar to gene for serine/threonin... 324 2e-87
gi|34861706|ref|XP_344971.1| similar to PKE protein kinase [Ratt... 324 3e-87
gi|48139533|ref|XP_397018.1| similar to Serine/threonine kinase ... 302 1e-80
gi|37181831|gb|AAQ88719.1| HSA250839 [Homo sapiens] 293 5e-78
gi|28277145|gb|AAH45760.1| STK32C protein [Homo sapiens] 292 9e-78
gi|13358640|dbj|BAB33045.1| hypothetical protein [Macaca fascicu... 290 4e-77
gi|32822717|gb|AAH55002.1| Stk32a protein [Mus musculus] 283 4e-75
gi|47221698|emb|CAG10170.1| unnamed protein product [Tetraodon n... 282 9e-75
gi|31203333|ref|XP_310615.1| ENSANGP00000007431 [Anopheles gambi... 275 1e-72
gi|34878555|ref|XP_223548.2| similar to gene for serine/threonin... 269 1e-70
gi|50259970|gb|EAL22636.1| hypothetical protein CNBB2680 [Crypto... 261 3e-68
gi|39578752|emb|CAE57154.1| Hypothetical protein CBG25088 [Caeno... 259 6e-68
gi|49074986|ref|XP_401588.1| hypothetical protein UM03973.1 [Ust... 259 8e-68
gi|38110890|gb|EAA56543.1| hypothetical protein MG06514.4 [Magna... 249 1e-64
gi|46128507|ref|XP_388807.1| hypothetical protein FG08631.1 [Gib... 242 1e-62
gi|14582566|gb|AAK69536.1| protein kinase C-like protein [Blumer... 237 3e-61
gi|21166148|gb|AAM43765.1| similar to Dictyostelium discoideum (... 208 2e-52
gi|15231959|ref|NP_187484.1| serine/threonine protein kinase (PK... 207 3e-52
gi|2129541|pir||S68463 protein kinase ATPK19 (EC 2.7.1.-) - Arab... 204 2e-51
gi|15231960|ref|NP_187485.1| serine/threonine protein kinase (PK... 202 9e-51
gi|21537155|gb|AAM61496.1| putative ribosomal-protein S6 kinase ... 201 3e-50
gi|1362152|pir||S56639 ribosomal protein S6 kinase homolog (clon... 200 4e-50
gi|1730069|sp|P54644|KRAC_DICDI RAC-family serine/threonine-prot... 200 6e-50
gi|48126576|ref|XP_393285.1| similar to putative cAMP-dependent ... 197 5e-49
gi|1890142|dbj|BAA18952.1| catalytic subunit of cAMP-dependent h... 196 6e-49
gi|7649389|emb|CAB89082.1| S6 ribosomal protein kinase [Asparagu... 196 6e-49
gi|23509142|ref|NP_701810.1| rac-beta serine/threonine protein k... 196 8e-49
gi|41056189|ref|NP_957317.1| similar to protein kinase, cAMP dep... 196 8e-49
gi|46909485|gb|AAT06260.1| protein kinase B-like protein [Plasmo... 196 8e-49
gi|50417908|gb|AAH78343.1| Unknown (protein for MGC:91856) [Dani... 196 1e-48
gi|46433231|gb|EAK92679.1| hypothetical protein CaO19.399 [Candi... 195 2e-48
gi|17136902|ref|NP_476977.1| CG4379-PA [Drosophila melanogaster]... 194 2e-48
gi|31242643|ref|XP_321752.1| ENSANGP00000016916 [Anopheles gambi... 194 2e-48
gi|50417448|gb|AAH77281.1| Unknown (protein for MGC:80071) [Xeno... 194 3e-48
gi|125204|sp|P25321|KAPA_CRIGR cAMP-dependent protein kinase, al... 194 3e-48
gi|493956|pdb|1CTP|E Chain E, Camp-Dependent Protein Kinase (E.C... 194 4e-48
gi|576052|pdb|1CMK|E Chain E, Camp-Dependent Protein Kinase Cata... 194 4e-48
gi|34303892|dbj|BAC82421.1| hypothetical protein [Entamoeba hist... 194 4e-48
gi|37575481|gb|AAQ93804.1| ribosomal protein S6 kinase [Zea mays] 194 4e-48
gi|34978340|sp|P36887|KAPA_PIG cAMP-dependent protein kinase, al... 194 4e-48
gi|47220928|emb|CAG03461.1| unnamed protein product [Tetraodon n... 194 4e-48
gi|102679|pir||S19028 protein kinase (EC 2.7.1.37) A, cAMP-depen... 193 5e-48
gi|50427081|ref|XP_462147.1| unnamed protein product [Debaryomyc... 193 5e-48
gi|4322296|gb|AAD16002.1| cAMP-dependent protein kinase catalyti... 193 7e-48
gi|4322300|gb|AAD16004.1| cAMP-dependent protein kinase catalyti... 193 7e-48
gi|4322298|gb|AAD16003.1| cAMP-dependent protein kinase catalyti... 193 7e-48
gi|28971730|dbj|BAC65325.1| testis catalytic subunit of cyclic a... 192 9e-48
gi|125207|sp|P27791|KAPA_RAT cAMP-dependent protein kinase, alph... 192 9e-48
gi|47215419|emb|CAG01116.1| unnamed protein product [Tetraodon n... 192 1e-47
gi|34098572|sp|Q8MJ44|KAPA_CANFA cAMP-dependent protein kinase, ... 192 1e-47
gi|15808362|emb|CAC88366.1| cAMP-dependent protein kinase cataly... 192 2e-47
gi|9858805|gb|AAG01142.1| protein kinase A [Blumeria graminis] 191 2e-47
gi|349816|pdb|1APM|E Chain E, c-AMP-Dependent Protein Kinase (E.... 191 2e-47
gi|102678|pir||S19027 protein kinase A (EC 2.7.1.-) catalytic ch... 191 2e-47
gi|285145|pir||A60543 protein kinase (EC 2.7.1.37), cAMP-depende... 191 3e-47
gi|6755076|ref|NP_035230.1| protein kinase, cAMP dependent, cata... 191 3e-47
gi|4506055|ref|NP_002721.1| cAMP-dependent protein kinase cataly... 191 3e-47
gi|46909584|ref|NP_997401.1| cAMP-dependent protein kinase catal... 191 3e-47
gi|25141308|ref|NP_740960.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|2098410|pdb|1YDT|E Chain E, Structure Of Camp-Dependent Prote... 191 4e-47
gi|28948416|pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme C... 191 4e-47
gi|17508227|ref|NP_493605.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|25141300|ref|NP_740954.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|25141296|ref|NP_740958.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|38707442|dbj|BAD04044.1| catalytic subunit of cAMP-dependent ... 191 4e-47
gi|25141298|ref|NP_740956.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|25141310|ref|NP_740962.1| cyclic AMP-dependent catalytic subu... 191 4e-47
gi|2914581|pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistid... 190 5e-47
gi|2981777|pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic... 190 5e-47
gi|230462|pdb|2CPK|E Chain E, c-AMP-Dependent Protein Kinase (E.... 190 5e-47
gi|14719578|pdb|1JBP|E Chain E, Crystal Structure Of The Catalyt... 190 5e-47
gi|2911458|gb|AAC04355.1| cAMP-dependent protein kinase catalyti... 190 5e-47
gi|200367|gb|AAA39936.1| cAMP-dependent protein kinase catalytic... 190 5e-47
gi|7110693|ref|NP_032880.1| protein kinase, cAMP dependent, cata... 190 5e-47
gi|20151205|pdb|1L3R|E Chain E, Crystal Structure Of A Transitio... 190 6e-47
gi|50513587|pdb|1SMH|A Chain A, Protein Kinase A Variant Complex... 190 6e-47
gi|2982123|pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Al... 190 6e-47
gi|125218|sp|P24256|KAPI_BOVIN cAMP-dependent protein kinase, be... 190 6e-47
gi|27807059|ref|NP_777010.1| cAMP-dependent protein kinase catal... 190 6e-47
gi|34098738|sp|Q9MZD9|KAPA_SHEEP cAMP-dependent protein kinase, ... 190 6e-47
gi|27807057|ref|NP_777009.1| cAMP-dependent protein kinase catal... 190 6e-47
gi|4506057|ref|NP_002722.1| cAMP-dependent protein kinase cataly... 190 6e-47
gi|50254457|gb|EAL17206.1| hypothetical protein CNBN0340 [Crypto... 190 6e-47
gi|8568077|gb|AAF76424.1| sperm cAMP-dependent protein kinase ca... 190 6e-47
gi|33636738|ref|NP_891993.1| cAMP-dependent protein kinase catal... 190 6e-47
gi|50751398|ref|XP_422379.1| PREDICTED: similar to cAMP-dependen... 190 6e-47
gi|40889426|pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-De... 189 8e-47
gi|17508225|ref|NP_493606.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|25141302|ref|NP_740957.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|49076120|ref|XP_402071.1| hypothetical protein UM04456.1 [Ust... 189 1e-46
gi|25141306|ref|NP_740959.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|476509|pir||OKHUCG protein kinase (EC 2.7.1.37), cAMP-depende... 189 1e-46
gi|25141304|ref|NP_740955.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|25141294|ref|NP_740961.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|15619015|ref|NP_002723.2| protein kinase, cAMP-dependent, cat... 189 1e-46
gi|28302248|gb|AAH46697.1| Kin-1-prov protein [Xenopus laevis] 189 1e-46
gi|25058324|gb|AAH39888.1| Protein kinase, cAMP-dependent, catal... 189 1e-46
gi|25141292|ref|NP_740963.1| cyclic AMP-dependent catalytic subu... 189 1e-46
gi|15808364|emb|CAC88367.1| cAMP-dependent protein kinase cataly... 189 1e-46
gi|4325024|gb|AAD17221.1| cAMP-dependent protein kinase catalyti... 189 1e-46
gi|23478593|gb|EAA15636.1| kinase Akt/PKB-related [Plasmodium yo... 189 1e-46
gi|33860165|sp|P05383|KAPB_PIG cAMP-dependent protein kinase, be... 189 1e-46
gi|89281|pir||S00085 protein kinase (EC 2.7.1.37), cAMP-dependen... 189 1e-46
gi|464395|sp|P28178|PK2_DICDI Protein kinase 2 >gnl|BL_ORD_ID|12... 188 2e-46
gi|34810567|pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb I... 188 2e-46
gi|32414173|ref|XP_327566.1| hypothetical protein ( (AY029769) p... 188 2e-46
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 188 2e-46
gi|25141290|ref|NP_740964.1| cyclic AMP-dependent catalytic subu... 188 2e-46
gi|37927861|pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb 188 2e-46
gi|476512|pir||OKKWC1 protein kinase (EC 2.7.1.37), cAMP-depende... 188 2e-46
gi|4885549|ref|NP_005456.1| v-akt murine thymoma viral oncogene ... 187 3e-46
gi|11131397|sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-prot... 187 3e-46
gi|45433564|ref|NP_035915.2| thymoma viral proto-oncogene 3; PKB... 187 3e-46
gi|49259182|pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylm... 187 3e-46
gi|7512664|pir||T17287 protein kinase (EC 2.7.1.37) akt3 short s... 187 3e-46
gi|33304021|gb|AAQ02518.1| v-akt murine thymoma viral oncogene-l... 187 3e-46
gi|34860159|ref|XP_215070.2| similar to protein kinase, cAMP dep... 187 3e-46
gi|32307163|ref|NP_859029.1| v-akt murine thymoma viral oncogene... 187 3e-46
gi|50740731|ref|XP_419544.1| PREDICTED: similar to RAC-gamma ser... 187 5e-46
gi|48425310|pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal... 187 5e-46
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 187 5e-46
gi|13928778|ref|NP_113763.1| thymoma viral proto-oncogene 3; v-a... 187 5e-46
gi|6456802|emb|CAB61490.1| cAMP-dependent protein kinase A catal... 187 5e-46
gi|476513|pir||OKKWC2 protein kinase (EC 2.7.1.37), cAMP-depende... 186 7e-46
gi|34733343|gb|AAQ81631.1| protein kinase A [Rattus norvegicus] 186 7e-46
gi|16580138|gb|AAL02131.1| cAMP-dependent protein kinase catalyt... 186 7e-46
gi|49097964|ref|XP_410442.1| hypothetical protein AN6305.2 [Aspe... 186 9e-46
gi|732542|gb|AAA64341.1| cAMP-dependent protein kinase 186 9e-46
gi|3116066|emb|CAA11528.1| s-sgk2 [Squalus acanthias] 186 1e-45
gi|665540|gb|AAC46513.1| cAMP-dependent protein kinase catalytic... 186 1e-45
gi|47939913|gb|AAH72041.1| MGC78893 protein [Xenopus laevis] 186 1e-45
gi|50294600|ref|XP_449711.1| unnamed protein product [Candida gl... 185 1e-45
gi|32411229|ref|XP_326095.1| hypothetical protein ( (AF264760) c... 185 1e-45
gi|17980212|gb|AAL50556.1| serine-threonine protein kinase PK2 [... 185 1e-45
gi|23272313|gb|AAH35058.1| CAMP-dependent protein kinase catalyt... 185 1e-45
gi|28279352|gb|AAH46261.1| Akt2-prov protein [Xenopus laevis] 185 1e-45
gi|27524356|emb|CAC82611.1| protein kinase A catalytic subunit 1... 185 2e-45
gi|33303865|gb|AAQ02446.1| serum/glucocorticoid regulated kinase... 185 2e-45
gi|40363533|ref|NP_954682.1| serum/glucocorticoid regulated kina... 185 2e-45
gi|2996092|gb|AAC08427.1| rac serine-threonine kinase homolog [T... 185 2e-45
gi|39584482|emb|CAE72620.1| Hypothetical protein CBG19814 [Caeno... 185 2e-45
gi|25168263|ref|NP_005618.2| serum/glucocorticoid regulated kina... 185 2e-45
gi|3914977|sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase ... 184 3e-45
gi|50303505|ref|XP_451694.1| unnamed protein product [Kluyveromy... 184 3e-45
gi|400144|sp|P31750|KRAC_MOUSE RAC-alpha serine/threonine-protei... 184 3e-45
gi|50551661|ref|XP_503305.1| hypothetical protein [Yarrowia lipo... 184 3e-45
gi|50288647|ref|XP_446753.1| unnamed protein product [Candida gl... 184 3e-45
gi|538540|pir||A40831 gag-akt polyprotein - AKT8 murine leukemia... 184 3e-45
gi|6753034|ref|NP_033782.1| thymoma viral proto-oncogene 1 [Mus ... 184 3e-45
gi|400112|sp|P31748|KAKT_MLVAT AKT kinase transforming protein 184 3e-45
gi|125208|sp|P06244|KAPA_YEAST cAMP-dependent protein kinase typ... 184 3e-45
gi|33303885|gb|AAQ02456.1| v-akt murine thymoma viral oncogene h... 184 4e-45
gi|12653417|gb|AAH00479.1| AKT1 protein [Homo sapiens] 184 4e-45
gi|4885061|ref|NP_005154.1| serine/threonine protein kinase; Mur... 184 4e-45
gi|47220382|emb|CAF98481.1| unnamed protein product [Tetraodon n... 184 4e-45
gi|26333955|dbj|BAC30695.1| unnamed protein product [Mus musculus] 184 4e-45
gi|2144416|pir||OKBYC1 protein kinase (EC 2.7.1.37), cAMP-depend... 184 4e-45
gi|14719777|pdb|1FOT|A Chain A, Structure Of The Unliganded Camp... 183 6e-45
gi|45383215|ref|NP_989807.1| serum- and glucocorticoid-induced k... 183 6e-45
gi|50304295|ref|XP_452097.1| unnamed protein product [Kluyveromy... 183 6e-45
gi|50303809|ref|XP_451851.1| unnamed protein product [Kluyveromy... 183 6e-45
gi|125318|sp|P16912|KDC2_DROME Protein kinase DC2 >gnl|BL_ORD_ID... 183 7e-45
gi|21429726|gb|AAM50541.1| AT10577p [Drosophila melanogaster] 183 7e-45
gi|15100164|ref|NP_150233.1| v-akt murine thymoma viral oncogene... 183 7e-45
gi|24664872|ref|NP_524097.2| CG6117-PA [Drosophila melanogaster]... 183 7e-45
gi|28574900|ref|NP_730083.2| CG6117-PB [Drosophila melanogaster]... 183 7e-45
gi|50292225|ref|XP_448545.1| unnamed protein product [Candida gl... 183 7e-45
gi|173011|gb|AAA35165.1| cAMP-dependent protein kinase subunit (... 183 7e-45
gi|38110717|gb|EAA56397.1| hypothetical protein MG06368.4 [Magna... 183 7e-45
gi|8392888|ref|NP_058789.1| murine thymoma viral (v-akt) oncogen... 182 1e-44
gi|46518249|emb|CAA64172.2| cAMP-dependent protein kinase cataly... 182 1e-44
gi|6325053|ref|NP_015121.1| Involved in nutrient control of cell... 182 1e-44
gi|21450709|ref|NP_659438.1| serine/threonine kinase 32A; A93001... 182 1e-44
gi|50291879|ref|XP_448372.1| unnamed protein product [Candida gl... 182 1e-44
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 182 1e-44
gi|4826948|ref|NP_005035.1| protein kinase, X-linked [Homo sapie... 182 1e-44
gi|49067855|ref|XP_398217.1| hypothetical protein UM00602.1 [Ust... 182 2e-44
gi|34860642|ref|XP_342571.1| serum/glucocorticoid regulated kina... 182 2e-44
gi|27806747|ref|NP_776411.1| v-akt murine thymoma viral oncogene... 182 2e-44
gi|46445417|gb|EAL04686.1| hypothetical protein CaO19.12357 [Can... 182 2e-44
gi|3116064|emb|CAA11527.1| s-sgk1 [Squalus acanthias] 182 2e-44
gi|19075330|ref|NP_587830.1| putative protein kinase [Schizosacc... 182 2e-44
gi|38385750|gb|AAR19398.1| rhodopsin kinase [Loligo forbesi] 182 2e-44
gi|7327648|gb|AAF08967.2| rhodopsin kinase [Loligo pealei] 182 2e-44
gi|50260596|gb|EAL23249.1| hypothetical protein CNBA3650 [Crypto... 181 2e-44
gi|477098|pir||A48094 serum and glucocorticoid-regulated kinase ... 181 2e-44
gi|11096026|gb|AAG30145.1| cAMP dependent protein kinase catalyt... 181 2e-44
gi|50415747|ref|XP_457493.1| unnamed protein product [Debaryomyc... 181 2e-44
gi|6322297|ref|NP_012371.1| putative catalytic subunit of cAMP-d... 181 2e-44
gi|47223805|emb|CAF98575.1| unnamed protein product [Tetraodon n... 181 2e-44
gi|50552438|ref|XP_503629.1| hypothetical protein [Yarrowia lipo... 181 2e-44
gi|6755490|ref|NP_035491.1| serum/glucocorticoid regulated kinas... 181 3e-44
gi|38110989|gb|EAA56628.1| hypothetical protein MG06599.4 [Magna... 181 3e-44
gi|12539654|gb|AAG59601.1| Akt [Xenopus laevis] 181 3e-44
gi|2760821|gb|AAB95270.1| serine/threonine protein kinase [Entam... 181 3e-44
gi|20385903|gb|AAM21494.1| protein kinase Sch9 [Cryptococcus neo... 181 3e-44
gi|47124333|gb|AAH70401.1| Sgk protein [Mus musculus] 181 3e-44
gi|2117824|pir||I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-... 181 4e-44
gi|46122935|ref|XP_386021.1| hypothetical protein FG05845.1 [Gib... 181 4e-44
gi|516040|gb|AAA93199.1| cAMP-dependent protein kinase catalytic... 181 4e-44
gi|26324816|dbj|BAC26162.1| unnamed protein product [Mus musculus] 181 4e-44
gi|31240527|ref|XP_320677.1| ENSANGP00000020143 [Anopheles gambi... 181 4e-44
gi|15072452|gb|AAK40343.1| protein kinase 1 [Cryphonectria paras... 181 4e-44
gi|6680674|ref|NP_031460.1| thymoma viral proto-oncogene 2; RAC-... 181 4e-44
gi|19310195|dbj|BAB85907.1| p90 ribosomal S6 kinase [Asterina pe... 181 4e-44
gi|458284|gb|AAA57318.1| serine/threonine protein kinase 181 4e-44
gi|20149547|ref|NP_002944.2| ribosomal protein S6 kinase, 90kDa,... 180 5e-44
gi|37700244|ref|NP_937789.1| v-akt murine thymoma viral oncogene... 180 5e-44
gi|1438885|gb|AAC47172.1| putative protein kinase A catalytic su... 180 5e-44
gi|45384254|ref|NP_990386.1| serine/threonine protein kinase [Ga... 180 5e-44
gi|5139484|emb|CAB45657.1| bK407F11.2 (adrenergic, beta, recepto... 180 5e-44
gi|47230282|emb|CAG10696.1| unnamed protein product [Tetraodon n... 180 5e-44
gi|19075510|ref|NP_588010.1| putative proliferation-associated s... 180 5e-44
gi|3005003|gb|AAC09269.1| G protein-coupled receptor kinase 6, s... 180 6e-44
gi|3004994|gb|AAC09264.1| G protein-coupled receptor kinase 6 [M... 180 6e-44
gi|49257650|gb|AAH74305.1| Unknown (protein for MGC:84110) [Xeno... 180 6e-44
gi|4587211|dbj|BAA76665.1| cAMP-dependent protein kinase catalyt... 180 6e-44
gi|3005005|gb|AAC09270.1| G protein-coupled receptor kinase 6, s... 180 6e-44
gi|3004993|gb|AAC09263.1| G protein-coupled receptor kinase 6 [M... 180 6e-44
gi|50550707|ref|XP_502826.1| hypothetical protein [Yarrowia lipo... 180 6e-44
gi|345763|pir||JC1469 beta-adrenergic-receptor kinase (EC 2.7.1.... 180 6e-44
gi|4885055|ref|NP_005151.1| beta adrenergic receptor kinase 2 [H... 180 6e-44
gi|3004995|gb|AAC09265.1| G protein-coupled receptor kinase 6 [M... 180 6e-44
gi|6707685|sp|O70293|GRK6_MOUSE G protein-coupled receptor kinas... 180 6e-44
gi|13431833|sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase... 180 6e-44
gi|6322682|ref|NP_012755.1| Involved in nutrient control of cell... 180 6e-44
gi|3688803|gb|AAC62398.1| unknown [Xenopus laevis] 179 8e-44
gi|28558156|sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase S... 179 8e-44
gi|31615318|pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain 179 8e-44
gi|50287865|ref|XP_446362.1| unnamed protein product [Candida gl... 179 8e-44
gi|4502023|ref|NP_001617.1| v-akt murine thymoma viral oncogene ... 179 8e-44
gi|18056644|gb|AAL58094.1| protein kinase A catalytic subunit [T... 179 8e-44
gi|45185202|ref|NP_982919.1| ABL028Wp [Eremothecium gossypii] >g... 179 8e-44
gi|45187484|ref|NP_983707.1| ADL389Wp [Eremothecium gossypii] >g... 179 8e-44
gi|37926827|pdb|1MRV|A Chain A, Crystal Structure Of An Inactive... 179 8e-44
gi|48129277|ref|XP_396647.1| similar to G protein-coupled recept... 179 8e-44
gi|49067618|ref|XP_398099.1| hypothetical protein UM00484.1 [Ust... 179 8e-44
gi|4625|emb|CAA68689.1| unnamed protein product [Saccharomyces c... 179 8e-44
gi|337491|gb|AAA36585.1| rac protein kinase-beta [Homo sapiens] 179 8e-44
gi|21667388|gb|AAM74045.1| cAMP-dependent protein kinase catalyt... 179 8e-44
gi|31615317|pdb|1GZK|A Chain A, Molecular Mechanism For The Regu... 179 8e-44
gi|27066378|pdb|1O6K|A Chain A, Structure Of Activated Form Of P... 179 1e-43
gi|49116933|gb|AAH73077.1| Sgk protein [Xenopus laevis] 179 1e-43
gi|3005014|gb|AAC09272.1| G protein-coupled receptor kinase 6, s... 179 1e-43
gi|27066381|pdb|1O6L|A Chain A, Crystal Structure Of An Activate... 179 1e-43
gi|7305483|ref|NP_038759.1| serum/glucocorticoid regulated kinas... 179 1e-43
gi|1707667|emb|CAA66069.1| G protein-coupled receptor kinase [Ra... 179 1e-43
gi|13592065|ref|NP_112369.1| S6 protein kinase (Rsk-1) [Rattus n... 179 1e-43
gi|13928910|ref|NP_113845.1| G protein-coupled receptor kinase 6... 179 1e-43
gi|445069|prf||1908384A protein kinase 179 1e-43
gi|6322723|ref|NP_012796.1| 76.5 kDa Serine/threonine protein ki... 179 1e-43
gi|172181|gb|AAA34880.1| protein kinase 179 1e-43
gi|49904216|gb|AAH76923.1| Unknown (protein for MGC:89135) [Xeno... 179 1e-43
gi|730723|sp|P11792|SCH9_YEAST Serine/threonine-protein kinase S... 179 1e-43
gi|227604|prf||1707301A protein kinase 179 1e-43
gi|6321999|ref|NP_012075.1| protein kinase involved in growth co... 179 1e-43
gi|4426|emb|CAA31073.1| unnamed protein product [Saccharomyces c... 179 1e-43
gi|13605770|gb|AAK32877.1| 90-kDa ribosomal protein S6 kinase [R... 179 1e-43
gi|9844082|emb|CAC03748.1| cAMP-dependent protein kinase catalyt... 179 1e-43
gi|173013|gb|AAA35166.1| cAMP-dependent protein kinase subunit (... 179 1e-43
gi|47220260|emb|CAG03294.1| unnamed protein product [Tetraodon n... 179 1e-43
gi|20072336|gb|AAH26549.1| Serum/glucocorticoid regulated kinase... 178 2e-43
gi|47086473|ref|NP_997951.1| ribosomal protein S6 kinase polypep... 178 2e-43
gi|46436399|gb|EAK95762.1| hypothetical protein CaO19.9817 [Cand... 178 2e-43
gi|31240177|ref|XP_320502.1| ENSANGP00000008658 [Anopheles gambi... 178 2e-43
gi|11596395|gb|AAG38600.1| cAMP-dependent protein kinase catalyt... 178 2e-43
gi|35481|emb|CAA43372.1| human protein kinase B [Homo sapiens] 178 2e-43
gi|50730201|ref|XP_416804.1| PREDICTED: similar to ribosomal pro... 178 2e-43
gi|20127541|ref|NP_057360.2| serum/glucocorticoid regulated kina... 178 2e-43
gi|50548247|ref|XP_501593.1| hypothetical protein [Yarrowia lipo... 178 2e-43
gi|50741701|ref|XP_419611.1| PREDICTED: similar to ribosomal pro... 178 2e-43
gi|25168261|ref|NP_733794.1| serum/glucocorticoid regulated kina... 178 2e-43
gi|33878427|gb|AAH14037.2| SGK2 protein [Homo sapiens] 178 2e-43
gi|19923570|ref|NP_066958.2| ribosomal protein S6 kinase, 90kDa,... 178 2e-43
gi|6166243|sp|Q15349|K6A2_HUMAN Ribosomal protein S6 kinase alph... 178 2e-43
gi|33303995|gb|AAQ02505.1| serum/glucocorticoid regulated kinase... 178 2e-43
gi|47213969|emb|CAG00660.1| unnamed protein product [Tetraodon n... 178 2e-43
gi|33303975|gb|AAQ02495.1| ribosomal protein S6 kinase, 90kDa, p... 178 2e-43
gi|9507093|ref|NP_062105.1| serum/glucocorticoid regulated kinas... 178 2e-43
gi|33304069|gb|AAQ02542.1| ribosomal protein S6 kinase, 90kDa, p... 177 3e-43
gi|33354095|dbj|BAC81131.1| RPS6KA3 [Homo sapiens] >gnl|BL_ORD_I... 177 3e-43
gi|4759050|ref|NP_004577.1| ribosomal protein S6 kinase, 90kDa, ... 177 3e-43
gi|22507357|ref|NP_683747.1| ribosomal protein S6 kinase polypep... 177 3e-43
gi|631936|pir||S41099 protein kinase (EC 2.7.1.37), cAMP-depende... 177 3e-43
gi|34853790|ref|XP_341759.1| ribosomal protein S6 kinase, 90kD, ... 177 3e-43
gi|545623|gb|AAB30032.1| cAMP-dependent protein kinase C subunit... 177 3e-43
gi|401774|gb|AAC82495.1| ribosomal protein S6 kinase 3 [Homo sap... 177 3e-43
gi|47225434|emb|CAG11917.1| unnamed protein product [Tetraodon n... 177 3e-43
gi|507141|gb|AAA19440.1| cAMP-dependent protein kinase catalytic... 177 3e-43
gi|13676454|dbj|BAB41150.1| hypothetical protein [Macaca fascicu... 177 3e-43
gi|15420611|gb|AAK97389.1| PKA catalytic subunit alpha [Oryctola... 177 3e-43
gi|9506749|ref|NP_062370.1| G protein-coupled receptor kinase 2,... 177 3e-43
gi|125692|sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II al... 177 4e-43
gi|12621084|ref|NP_075217.1| G protein-coupled receptor kinase 2... 177 4e-43
gi|1673504|emb|CAA66181.1| G protein-coupled receptor kinase GRK... 177 4e-43
gi|47086403|ref|NP_997980.1| v-akt murine thymoma viral oncogene... 177 4e-43
gi|401772|gb|AAC82496.1| ribosomal protein S6 kinase 2 [Homo sap... 177 4e-43
gi|50420447|ref|XP_458760.1| unnamed protein product [Debaryomyc... 177 5e-43
gi|28300431|gb|AAO37581.1| RPS6KA2 [Mus musculus] 177 5e-43
gi|6755374|ref|NP_035429.1| ribosomal protein S6 kinase, polypep... 177 5e-43
gi|25005142|gb|AAN71007.1| ribosomal protein S6 kinase [Mus musc... 177 5e-43
gi|32420385|ref|XP_330636.1| hypothetical protein [Neurospora cr... 177 5e-43
gi|16266771|dbj|BAB69974.1| kinase Akt/PKB [Asterina pectinifera] 177 5e-43
gi|50547917|ref|XP_501428.1| hypothetical protein [Yarrowia lipo... 176 7e-43
gi|48094345|ref|XP_394147.1| similar to cyclic AMP-dependent cat... 176 7e-43
gi|15219539|ref|NP_175130.1| protein kinase family protein [Arab... 176 7e-43
gi|49097300|ref|XP_410110.1| hypothetical protein AN5973.2 [Aspe... 176 7e-43
gi|33942081|ref|NP_898837.1| Cdc42 binding protein kinase beta [... 176 7e-43
gi|29294760|gb|AAH49076.1| Rps6ka1 protein [Mus musculus] 176 7e-43
gi|7578502|gb|AAF64072.1| protein kinase A [Candida albicans] 176 9e-43
gi|992673|gb|AAC50410.1| G protein-coupled receptor kinase GRK4-... 176 9e-43
gi|992674|gb|AAC50411.1| G protein-coupled receptor kinase GRK4-... 176 9e-43
gi|992675|gb|AAC50412.1| G protein-coupled receptor kinase GRK4-... 176 9e-43
gi|23956080|ref|NP_058675.1| protein kinase, X-linked; putative ... 176 9e-43
gi|992672|gb|AAC50409.1| G protein-coupled receptor kinase GRK4-... 176 9e-43
gi|6537166|gb|AAF15553.1| Rsk-2 [Xenopus laevis] 176 9e-43
gi|50425563|ref|XP_461377.1| unnamed protein product [Debaryomyc... 176 9e-43
gi|48104993|ref|XP_395876.1| similar to p70 ribosomal protein S6... 176 1e-42
gi|50255581|gb|EAL18314.1| hypothetical protein CNBJ2370 [Crypto... 176 1e-42
gi|33695161|ref|NP_892027.1| G protein-coupled receptor kinase 2... 176 1e-42
gi|971259|gb|AAC50408.1| G protein-coupled receptor kinase GRK4,... 176 1e-42
gi|1770422|emb|CAA66802.1| G protein-coupled receptor kinase [Ho... 176 1e-42
gi|4885347|ref|NP_005298.1| G protein-coupled receptor kinase 2-... 176 1e-42
gi|971257|gb|AAC50407.1| G protein-coupled receptor kinase GRK4,... 176 1e-42
gi|47212674|emb|CAF94155.1| unnamed protein product [Tetraodon n... 176 1e-42
gi|38109783|gb|EAA55600.1| hypothetical protein MG01251.4 [Magna... 176 1e-42
gi|45198429|ref|NP_985458.1| AFL090Wp [Eremothecium gossypii] >g... 176 1e-42
gi|47226221|emb|CAG08368.1| unnamed protein product [Tetraodon n... 175 2e-42
gi|3005016|gb|AAC09273.1| G protein-coupled receptor kinase 6, s... 175 2e-42
gi|3005018|gb|AAC09274.1| G protein-coupled receptor kinase 6, s... 175 2e-42
gi|414421|gb|AAA03565.1| putative novel receptor kinase 175 2e-42
gi|16758420|ref|NP_446072.1| Cdc42-binding protein kinase beta [... 175 2e-42
gi|20141386|sp|P43250|GRK6_HUMAN G protein-coupled receptor kina... 175 2e-42
gi|4504101|ref|NP_002073.1| G protein-coupled receptor kinase 6 ... 175 2e-42
gi|30841498|gb|AAP34403.1| CDC42-binding protein kinase beta [Ra... 175 2e-42
gi|33243964|gb|AAH55331.1| Ribosomal protein S6 kinase, polypept... 175 2e-42
gi|12860267|dbj|BAB31901.1| unnamed protein product [Mus musculus] 175 2e-42
gi|50731568|ref|XP_418280.1| PREDICTED: similar to Serine/threon... 175 2e-42
gi|531122|gb|AAB60689.1| beta-adrenergic receptor kinase [Homo s... 175 2e-42
gi|16878130|gb|AAH17272.1| GPRK6 protein [Homo sapiens] 175 2e-42
gi|125694|sp|P10666|K6AB_XENLA Ribosomal protein S6 kinase II be... 175 2e-42
gi|5006445|gb|AAD37506.1| CDC42-binding protein kinase beta [Hom... 175 2e-42
gi|16357474|ref|NP_006026.2| CDC42-binding protein kinase beta; ... 175 2e-42
gi|7497946|pir||T20232 hypothetical protein C54G4.1 - Caenorhabd... 175 2e-42
gi|303941|dbj|BAA03268.1| protein kinase [Schizosaccharomyces po... 175 2e-42
gi|19112742|ref|NP_595950.1| protein kinase c-like 2 [Schizosacc... 175 2e-42
gi|28839596|gb|AAH47871.1| CDC42BPB protein [Homo sapiens] 175 2e-42
gi|29387239|gb|AAH48261.1| CDC42BPB protein [Homo sapiens] 175 2e-42
gi|103166|pir||A41615 beta-adrenergic-receptor kinase (EC 2.7.1.... 175 2e-42
gi|417080|sp|P32865|GPK1_DROME G protein-coupled receptor kinase... 175 2e-42
gi|32563675|ref|NP_492204.2| protein kinase and Protein kinase C... 175 2e-42
gi|3023902|sp|P97711|GRK6_RAT G protein-coupled receptor kinase ... 175 2e-42
gi|49256532|gb|AAH71102.1| Unknown (protein for MGC:81220) [Xeno... 175 2e-42
gi|30923679|gb|EAA46156.1| CG40129-PA.3 [Drosophila melanogaster] 175 2e-42
gi|14133241|dbj|BAA86438.2| KIAA1124 protein [Homo sapiens] 175 2e-42
gi|50755265|ref|XP_414676.1| PREDICTED: similar to G protein-cou... 174 3e-42
gi|48138240|ref|XP_396874.1| similar to serine/threonine protein... 174 3e-42
gi|49093828|ref|XP_408375.1| hypothetical protein AN4238.2 [Aspe... 174 3e-42
gi|50414973|gb|AAH77874.1| Unknown (protein for MGC:80630) [Xeno... 174 3e-42
gi|41056055|ref|NP_956367.1| Unknown (protein for MGC:66139); wu... 174 3e-42
gi|2565330|gb|AAC24243.1| cAMP-dependent protein kinase catalyti... 174 3e-42
gi|31206439|ref|XP_312175.1| ENSANGP00000022036 [Anopheles gambi... 174 3e-42
gi|627387|pir||A53791 beta-adrenergic-receptor kinase (EC 2.7.1.... 174 3e-42
gi|4519169|dbj|BAA75507.1| rhodopsin kinase [Octopus dofleini] 174 3e-42
gi|49068900|ref|XP_398739.1| hypothetical protein UM01124.1 [Ust... 174 3e-42
gi|2104851|emb|CAA73580.1| cAMP-dependent protein kinase [Parame... 174 4e-42
gi|31563382|ref|NP_037389.4| serum/glucocorticoid regulated kina... 174 4e-42
gi|47220463|emb|CAG03243.1| unnamed protein product [Tetraodon n... 174 4e-42
gi|6466010|gb|AAF12758.1| protein kinase [Homo sapiens] >gnl|BL_... 174 4e-42
gi|45645188|sp|Q21734|KS6A_CAEEL Putative ribosomal protein S6 k... 174 4e-42
gi|17508705|ref|NP_492320.1| ribosomal protein S6 kinase (rsk-1)... 174 4e-42
gi|33303813|gb|AAQ02420.1| serum/glucocorticoid regulated kinase... 174 4e-42
gi|33300393|emb|CAB02301.2| Hypothetical protein T01H8.1b [Caeno... 174 4e-42
gi|27806217|ref|NP_776925.1| adrenergic, beta, receptor kinase 2... 174 4e-42
gi|50306467|ref|XP_453207.1| unnamed protein product [Kluyveromy... 174 4e-42
gi|17508707|ref|NP_492319.1| ribosomal protein S6 kinase (rsk-1)... 174 4e-42
gi|6175630|gb|AAF05109.1| G protein-coupled receptor kinase type... 174 4e-42
gi|50750015|ref|XP_426549.1| PREDICTED: similar to Serine/threon... 174 4e-42
gi|33300395|emb|CAE17938.1| Hypothetical protein T01H8.1c [Caeno... 174 4e-42
gi|29789163|ref|NP_080225.1| ribosomal protein S6 kinase polypep... 173 6e-42
gi|12060812|gb|AAG48248.1| p70 ribosomal protein S6 kinase [Arte... 173 6e-42
gi|4157977|emb|CAA76911.1| protein kinase C [Geodia cydonium] 173 6e-42
gi|46107178|ref|XP_380648.1| hypothetical protein FG00472.1 [Gib... 173 6e-42
gi|11181910|emb|CAC16111.1| bA54F22.1.1 (ribosomal protein S6 ki... 173 6e-42
gi|33303997|gb|AAQ02506.1| ribosomal protein S6 kinase, 90kDa, p... 173 6e-42
gi|23956386|ref|NP_705815.1| ribosomal protein S6 kinase, polype... 173 6e-42
gi|45190492|ref|NP_984746.1| AEL115Cp [Eremothecium gossypii] >g... 173 6e-42
gi|33638111|gb|AAQ24165.1| ribosomal protein S6 kinase splice va... 173 6e-42
gi|7657526|ref|NP_055311.1| ribosomal protein S6 kinase, 90kDa, ... 173 6e-42
gi|19115752|ref|NP_594840.1| serine/threonine protein kinase [Sc... 173 8e-42
gi|46442847|gb|EAL02133.1| hypothetical protein CaO19.829 [Candi... 173 8e-42
gi|26327211|dbj|BAC27349.1| unnamed protein product [Mus musculus] 173 8e-42
gi|18959280|ref|NP_573483.1| serum/glucocorticoid regulated kina... 173 8e-42
gi|17390848|gb|AAH18363.1| Sgk3 protein [Mus musculus] 173 8e-42
gi|39595602|emb|CAE67103.1| Hypothetical protein CBG12516 [Caeno... 173 8e-42
gi|7434394|pir||JE0377 p70 S6 kinase (EC 2.7.-.-) - human >gnl|B... 173 8e-42
gi|50730334|ref|XP_416852.1| PREDICTED: similar to Serine/threon... 173 8e-42
gi|125693|sp|P10665|K6AA_XENLA Ribosomal protein S6 kinase II al... 173 8e-42
gi|47212671|emb|CAF94152.1| unnamed protein product [Tetraodon n... 173 8e-42
gi|4501971|ref|NP_001610.1| beta adrenergic receptor kinase 1 [H... 173 8e-42
gi|49168616|emb|CAG38803.1| RPS6KA6 [Homo sapiens] 172 1e-41
gi|32425471|gb|AAH06106.2| RPS6KB2 protein [Homo sapiens] 172 1e-41
gi|50745818|ref|XP_420257.1| PREDICTED: similar to Ribosomal pro... 172 1e-41
gi|39582051|emb|CAE63694.1| Hypothetical protein CBG08209 [Caeno... 172 1e-41
gi|37588972|gb|AAH00094.2| RPS6KB2 protein [Homo sapiens] 172 1e-41
gi|12643872|sp|Q9UBS0|K6B2_HUMAN Ribosomal protein S6 kinase bet... 172 1e-41
gi|26328137|dbj|BAC27809.1| unnamed protein product [Mus musculus] 172 1e-41
gi|33303901|gb|AAQ02464.1| ribosomal protein S6 kinase, 70kDa, p... 172 1e-41
gi|4506739|ref|NP_003943.1| ribosomal protein S6 kinase, 70kDa, ... 172 1e-41
gi|6323751|ref|NP_013822.1| protein kinase; Ypk2p [Saccharomyces... 172 1e-41
gi|32528295|ref|NP_004746.2| ribosomal protein S6 kinase, 90kDa,... 172 1e-41
gi|3818592|gb|AAC69577.1| ribosome S6 protein kinase [Homo sapiens] 172 1e-41
gi|47605719|sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kina... 172 1e-41
gi|31980925|ref|NP_061357.2| G protein-coupled receptor kinase 5... 172 1e-41
gi|32528297|ref|NP_872198.1| ribosomal protein S6 kinase, 90kDa,... 172 1e-41
gi|6978465|ref|NP_036908.1| adrenergic receptor kinase, beta 1; ... 172 1e-41
gi|6650370|gb|AAF21806.1| rac serine/threonine kinase homolog [D... 172 1e-41
gi|47605756|sp|Q9Z2G7|GRK7_SPETR G protein-coupled receptor kina... 172 2e-41
gi|47230027|emb|CAG10441.1| unnamed protein product [Tetraodon n... 172 2e-41
gi|6016441|sp|O42632|KPC1_COCHE Protein kinase C-like >gnl|BL_OR... 172 2e-41
gi|33859769|ref|NP_570933.1| adrenergic receptor kinase, beta 1;... 172 2e-41
gi|50748598|ref|XP_421318.1| PREDICTED: similar to ribosomal pro... 172 2e-41
gi|3114991|emb|CAA73557.1| Serine/Threonine protein kinase [Syco... 172 2e-41
gi|28892991|ref|NP_796052.1| adrenergic receptor kinase, beta 2;... 172 2e-41
gi|179335|gb|AAA58391.1| receptor kinase >gnl|BL_ORD_ID|1537265 ... 172 2e-41
gi|31615810|pdb|1OMW|A Chain A, Crystal Structure Of The Complex... 172 2e-41
gi|47605537|sp|Q99MK8|ARK1_MOUSE Beta-adrenergic receptor kinase... 172 2e-41
gi|27807281|ref|NP_777135.1| adrenergic, beta, receptor kinase 1... 172 2e-41
gi|13096806|gb|AAH03196.1| Adrbk1 protein [Mus musculus] 172 2e-41
gi|50748818|ref|XP_421417.1| PREDICTED: similar to protein kinas... 171 2e-41
gi|455163|gb|AAA50509.1| p90 ribosomal S6 kinase 171 2e-41
gi|445070|prf||1908384B protein kinase 171 2e-41
gi|30725240|gb|AAP37655.1| serine/threonine protein kinase Akt [... 171 2e-41
gi|11230513|emb|CAC03986.2| putative protein kinase A catalytic ... 171 2e-41
gi|9858999|gb|AAD00706.3| putative protein kinase A catalytic su... 171 2e-41
gi|33146662|dbj|BAC80008.1| putative S6 ribosomal protein kinase... 171 2e-41
gi|13540624|ref|NP_110456.1| G protein-coupled receptor kinase 5... 171 2e-41
gi|6010221|emb|CAB57279.1| putative PKA-related protein kinase [... 171 2e-41
gi|6978467|ref|NP_037029.1| adrenergic receptor kinase, beta 2; ... 171 2e-41
gi|28629057|gb|AAO49460.1| protein kinase C [Leptosphaeria macul... 171 2e-41
gi|24643817|ref|NP_523437.2| CG17596-PA [Drosophila melanogaster... 171 2e-41
gi|28416327|gb|AAO42636.1| SD05277p [Drosophila melanogaster] 171 2e-41
gi|3121776|sp|Q64682|ARK1_MESAU Beta-adrenergic receptor kinase ... 171 2e-41
gi|4150896|emb|CAA73682.1| serine /threonine protein kinase [Rha... 171 3e-41
gi|7508813|pir||T26096 hypothetical protein W02B3.2 - Caenorhabd... 171 3e-41
gi|4582255|emb|CAB40193.1| kinase [Xenopus laevis] 171 3e-41
gi|39584758|emb|CAE67653.1| Hypothetical protein CBG13216 [Caeno... 171 3e-41
gi|32564603|ref|NP_497235.2| g protein-coupled receptor kinase w... 171 3e-41
gi|49118486|gb|AAH73469.1| Rps6kb1-A protein [Xenopus laevis] 171 3e-41
gi|39794417|gb|AAH64239.1| LOC394938 protein [Xenopus tropicalis] 171 4e-41
gi|1079127|pir||A55888 protein kinase (EC 2.7.1.37) akt [similar... 171 4e-41
gi|45551909|ref|NP_732113.2| CG4006-PC [Drosophila melanogaster]... 171 4e-41
gi|17402861|gb|AAF27051.2| SGK-like protein SGKL [Homo sapiens] 171 4e-41
gi|398924|emb|CAA81204.1| Dakt1 serine-threonine protein kinase ... 171 4e-41
gi|24647358|ref|NP_732114.1| CG4006-PA [Drosophila melanogaster]... 171 4e-41
gi|17570293|ref|NP_510647.1| serum and Glucocorticoid inducible ... 171 4e-41
gi|50514024|pdb|1VZO|A Chain A, The Structure Of The N-Terminal ... 171 4e-41
gi|39592150|emb|CAE75370.1| Hypothetical protein CBG23354 [Caeno... 171 4e-41
gi|32450549|gb|AAH54113.1| Rps6ka6 protein [Mus musculus] 171 4e-41
gi|260172|gb|AAB24228.1| beta-adrenergic receptor kinase; beta-A... 171 4e-41
gi|31418467|gb|AAH53365.1| Unknown (protein for MGC:61512) [Homo... 170 5e-41
gi|26328523|dbj|BAC28000.1| unnamed protein product [Mus musculus] 170 5e-41
gi|109371|pir||S12906 probable ribosomal protein S6 kinase (EC 2... 170 5e-41
gi|23512346|gb|AAH38491.1| Rps6kb1 protein [Mus musculus] 170 5e-41
gi|4506737|ref|NP_003152.1| ribosomal protein S6 kinase, 70kDa, ... 170 5e-41
gi|45430051|ref|NP_991385.1| p70S6K [Bos taurus] >gnl|BL_ORD_ID|... 170 5e-41
gi|7504545|pir||T22856 hypothetical protein F57F5.5 - Caenorhabd... 170 5e-41
gi|16648134|gb|AAL25332.1| GH13631p [Drosophila melanogaster] 170 5e-41
gi|17562588|ref|NP_506014.1| protein kinase C (80.2 kD) (pkc-1) ... 170 5e-41
gi|33304209|gb|AAQ02612.1| ribosomal protein S6 kinase, 70kDa, p... 170 5e-41
gi|125695|sp|P23443|K6B1_HUMAN Ribosomal protein S6 kinase (S6K)... 170 5e-41
gi|125696|sp|P21425|K6B1_RAT Ribosomal protein S6 kinase I (S6K)... 170 5e-41
gi|31242057|ref|XP_321459.1| ENSANGP00000008560 [Anopheles gambi... 170 6e-41
gi|25151367|ref|NP_741759.1| protein kinase and Protein kinase C... 170 6e-41
gi|17567857|ref|NP_508671.1| protein kinase and Protein kinase C... 170 6e-41
gi|27805901|ref|NP_776756.1| G protein-coupled receptor kinase 5... 170 6e-41
gi|29561781|emb|CAD87819.1| SI:dZ221D18.1 (novel protein similar... 170 6e-41
gi|17555946|ref|NP_499447.1| s6 kinase (3M341) [Caenorhabditis e... 170 6e-41
gi|19111951|ref|NP_595159.1| camp-dependent protein kinase catal... 170 6e-41
gi|50758354|ref|XP_415882.1| PREDICTED: similar to Ribosomal pro... 169 8e-41
gi|50756157|ref|XP_415041.1| PREDICTED: similar to CDC42-binding... 169 8e-41
gi|630707|pir||A53530 protein kinase C (EC 2.7.1.-) epsilon-rela... 169 8e-41
gi|24650924|ref|NP_524545.2| CG1954-PA [Drosophila melanogaster]... 169 1e-40
gi|27469638|gb|AAH41741.1| Cdc42bpb protein [Xenopus laevis] 169 1e-40
gi|125547|sp|P13678|KPC3_DROME Protein kinase C (PKC) (dPKC98F) ... 169 1e-40
gi|50405145|ref|YP_054237.1| cAMP-dependent protein kinase catal... 169 1e-40
>gi|17554256|ref|NP_499294.1| protein kinase C-like (3L484)
[Caenorhabditis elegans]
gi|7505957|pir||T23688 hypothetical protein M03C11.1 - Caenorhabditis
elegans
gi|3878636|emb|CAA88953.1| Hypothetical protein M03C11.1
[Caenorhabditis elegans]
Length = 379
Score = 774 bits (1998), Expect = 0.0
Identities = 379/379 (100%), Positives = 379/379 (100%)
Frame = -1
Query: 1140 MGVVRRGSDVTSHVSSVSGKSAPCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKYMN 961
MGVVRRGSDVTSHVSSVSGKSAPCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKYMN
Sbjct: 1 MGVVRRGSDVTSHVSSVSGKSAPCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKYMN 60
Query: 960 KRRCIEKGVAANVIRELTLLSKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQ 781
KRRCIEKGVAANVIRELTLLSKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQ
Sbjct: 61 KRRCIEKGVAANVIRELTLLSKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLSQQ 120
Query: 780 GKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQLEDDQ 601
GKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQLEDDQ
Sbjct: 121 GKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQLEDDQ 180
Query: 600 LATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKPEE 421
LATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKPEE
Sbjct: 181 LATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKPEE 240
Query: 420 AYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFEKK 241
AYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFEKK
Sbjct: 241 AYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFEKK 300
Query: 240 PSPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAF 61
PSPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAF
Sbjct: 301 PSPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSKAF 360
Query: 60 IDFSRHNVKIEPNGFVKLN 4
IDFSRHNVKIEPNGFVKLN
Sbjct: 361 IDFSRHNVKIEPNGFVKLN 379
>gi|39591899|emb|CAE71477.1| Hypothetical protein CBG18395
[Caenorhabditis briggsae]
Length = 380
Score = 735 bits (1898), Expect = 0.0
Identities = 360/381 (94%), Positives = 372/381 (97%), Gaps = 2/381 (0%)
Frame = -1
Query: 1140 MGVVRRGSDVTSHVSSVSGKS--APCLQHFSVIRSIGRGAFGKVCIVQERKTKKYFALKY 967
MGVVRRGSDVTSHVSS SGKS APCLQHFS+IRSIGRGAFGKVCIVQERKTKKYFALKY
Sbjct: 1 MGVVRRGSDVTSHVSS-SGKSGVAPCLQHFSIIRSIGRGAFGKVCIVQERKTKKYFALKY 59
Query: 966 MNKRRCIEKGVAANVIRELTLLSKMSHPFIVNLWYTFQDGDYMYMVSDLLLGGDLRYHLS 787
MNKRRCIEKGVAANVIRELTLLSK+SHPFIVNLWYTFQD DYMYMVSDLLLGGDLRYHLS
Sbjct: 60 MNKRRCIEKGVAANVIRELTLLSKISHPFIVNLWYTFQDPDYMYMVSDLLLGGDLRYHLS 119
Query: 786 QQGKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQLED 607
QQGKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQL D
Sbjct: 120 QQGKFAEDRAKLYLCEICLAVEYLHEMKIVHRDIKPENILLDEQGHAHLTDLNLATQLAD 179
Query: 606 DQLATSYSGTRPYMAPEIYATYLEIEDGYDSRVDWWALGVCFYEMLRGRTPFEFSSRTKP 427
DQLATSYSGTRPYMAPEIYATYLE+EDGYDSRVDWWALGVC+YEMLRGRTPFEFSSRTKP
Sbjct: 180 DQLATSYSGTRPYMAPEIYATYLELEDGYDSRVDWWALGVCYYEMLRGRTPFEFSSRTKP 239
Query: 426 EEAYVAFRESSIPYPAHWPTDLIQFINSMLKFDKEKRLVGLEAIKKHSYTERIDFKSVFE 247
EEAYVAFR++SIPYPAHWPTDLI FIN+MLKFDKEKRLVGLEAIKKH+YTERIDFKSVFE
Sbjct: 240 EEAYVAFRDASIPYPAHWPTDLIHFINAMLKFDKEKRLVGLEAIKKHAYTERIDFKSVFE 299
Query: 246 KKPSPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSK 67
+KP+PVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSK
Sbjct: 300 RKPAPVFIPCKEGLNCDPMYELEERILVSTPIHRRRTNHNNSSGRSSSEPQNAALVEVSK 359
Query: 66 AFIDFSRHNVKIEPNGFVKLN 4
AFIDFSRHN+KIEPNG + N
Sbjct: 360 AFIDFSRHNMKIEPNGVCRSN 380