Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M110_3
(1152 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536609|ref|NP_495727.1| TWiK family of potassium channels (... 724 0.0
gi|39587238|emb|CAE57706.1| Hypothetical protein CBG00713 [Caeno... 621 e-176
gi|39594328|emb|CAE71906.1| Hypothetical protein CBG18967 [Caeno... 207 3e-52
gi|17564904|ref|NP_504663.1| predicted CDS, TWiK family of potas... 144 5e-33
gi|17536611|ref|NP_495961.1| TWiK family of potassium channels (... 127 6e-28
gi|39591758|emb|CAE71336.1| Hypothetical protein CBG18237 [Caeno... 126 8e-28
gi|17555324|ref|NP_499790.1| twk-8 protein like family member (3... 125 1e-27
gi|34850053|gb|AAK39218.3| Twik family of potassium channels pro... 123 7e-27
gi|39589137|emb|CAE57870.1| Hypothetical protein CBG00910 [Caeno... 122 2e-26
gi|39587874|emb|CAE67892.1| Hypothetical protein CBG13488 [Caeno... 117 4e-25
gi|31441785|emb|CAB03071.3| C. elegans TWK-30 protein (correspon... 116 9e-25
gi|39589742|emb|CAE66977.1| Hypothetical protein CBG12373 [Caeno... 114 4e-24
gi|25147096|ref|NP_508732.2| twk-8 protein like family member (X... 114 6e-24
gi|25395539|pir||H88124 protein T12C9.3 [imported] - Caenorhabdi... 112 1e-23
gi|39597860|emb|CAE68552.1| Hypothetical protein CBG14385 [Caeno... 112 2e-23
gi|39587366|emb|CAE75020.1| Hypothetical protein CBG22924 [Caeno... 111 4e-23
gi|25144330|ref|NP_498903.2| TWiK family of potassium channels (... 111 4e-23
gi|7500584|pir||T21834 hypothetical protein F36A2.4 - Caenorhabd... 105 2e-21
gi|17507181|ref|NP_492381.1| fibronectin, type III and ion trans... 105 2e-21
gi|7497822|pir||T28933 hypothetical protein C52B9.6 - Caenorhabd... 103 6e-21
gi|1078847|pir||S44635 f22b7.7 protein - Caenorhabditis elegans 102 1e-20
gi|39596461|emb|CAE63080.1| Hypothetical protein CBG07369 [Caeno... 101 4e-20
gi|17570153|ref|NP_510305.1| TWiK family of potassium channels (... 98 4e-19
gi|25151930|ref|NP_741843.1| putative potassium channel subunit ... 94 6e-18
gi|25151933|ref|NP_741842.1| putative potassium channel subunit ... 94 6e-18
gi|25151936|ref|NP_741845.1| putative potassium channel subunit ... 94 6e-18
gi|25151942|ref|NP_741844.1| putative potassium channel subunit ... 94 6e-18
gi|21392667|gb|AAM51529.1| Hypothetical protein C44E12.3a [Caeno... 94 6e-18
gi|25151939|ref|NP_741846.1| putative potassium channel subunit ... 94 6e-18
gi|39585309|emb|CAE61631.1| Hypothetical protein CBG05561 [Caeno... 89 3e-16
gi|39590497|emb|CAE66237.1| Hypothetical protein CBG11481 [Caeno... 87 1e-15
gi|24641306|ref|NP_572720.1| CG1756-PA [Drosophila melanogaster]... 86 2e-15
gi|11359804|pir||T43393 potassium channel chain n2P17m3 homolog ... 85 4e-15
gi|31043788|emb|CAB07375.2| Hypothetical protein F31D4.7 [Caenor... 84 6e-15
gi|17564896|ref|NP_506416.1| TWiK family of potassium channels (... 84 6e-15
gi|17560382|ref|NP_508031.1| putative protein family member, wit... 84 6e-15
gi|31211993|ref|XP_314981.1| ENSANGP00000021390 [Anopheles gambi... 83 1e-14
gi|48107867|ref|XP_396190.1| similar to ENSANGP00000017384 [Apis... 83 1e-14
gi|39593815|emb|CAE62108.1| Hypothetical protein CBG06143 [Caeno... 82 2e-14
gi|25146143|ref|NP_506906.2| potassium channel TWIK-1 family mem... 82 3e-14
gi|25147273|ref|NP_508526.2| potassium channel subunit n2P16 fam... 82 3e-14
gi|50507748|emb|CAB01238.2| Hypothetical protein M04B2.5 [Caenor... 82 3e-14
gi|7505363|pir||T23373 hypothetical protein K06B4.12 - Caenorhab... 82 3e-14
gi|17542644|ref|NP_502170.1| TWiK family of potassium channels (... 82 3e-14
gi|27503347|gb|AAH42262.1| MGC53410 protein [Xenopus laevis] 82 3e-14
gi|39597681|emb|CAE68372.1| Hypothetical protein CBG14128 [Caeno... 81 4e-14
gi|25146228|ref|NP_506091.2| TWiK family of potassium channels (... 81 4e-14
gi|7506281|pir||T23907 hypothetical protein R04F11.4 - Caenorhab... 81 4e-14
gi|39584824|emb|CAE67719.1| Hypothetical protein CBG13294 [Caeno... 81 4e-14
gi|7505938|pir||T16629 hypothetical protein M02F4.5 - Caenorhabd... 80 7e-14
gi|17570151|ref|NP_508522.1| TWiK family of potassium channels (... 80 7e-14
gi|7503954|pir||T16426 hypothetical protein F52E4.4 - Caenorhabd... 80 7e-14
gi|39585409|emb|CAE61731.1| Hypothetical protein CBG05682 [Caeno... 80 7e-14
gi|17565098|ref|NP_507480.1| potassium channel TWIK-1 family mem... 80 7e-14
gi|39597677|emb|CAE68368.1| Hypothetical protein CBG14123 [Caeno... 80 7e-14
gi|31204249|ref|XP_311073.1| ENSANGP00000017384 [Anopheles gambi... 80 9e-14
gi|17536613|ref|NP_494333.1| TWiK family of potassium channels (... 80 9e-14
gi|39584651|emb|CAE72404.1| Hypothetical protein CBG19563 [Caeno... 79 2e-13
gi|24645352|ref|NP_649891.1| CG9361-PA [Drosophila melanogaster]... 79 2e-13
gi|7511511|pir||T32347 outward rectifier potassium channel homol... 79 2e-13
gi|34785960|gb|AAH58054.1| LOC402860 protein [Danio rerio] 79 3e-13
gi|39592237|emb|CAE75458.1| Hypothetical protein CBG23453 [Caeno... 79 3e-13
gi|11067417|ref|NP_067720.1| putative potassium channel TWIK [Ra... 78 3e-13
gi|7496433|pir||T19429 hypothetical protein C24H11.8 - Caenorhab... 77 6e-13
gi|28704121|gb|AAH47247.1| Kcnk6-prov protein [Xenopus laevis] 77 6e-13
gi|32565622|ref|NP_499529.2| ion transport protein (3M891) [Caen... 77 6e-13
gi|4504847|ref|NP_002236.1| potassium channel, subfamily K, memb... 77 8e-13
gi|39595158|emb|CAE60195.1| Hypothetical protein CBG03756 [Caeno... 77 8e-13
gi|7503519|pir||T22269 hypothetical protein F46A9.3 - Caenorhabd... 76 1e-12
gi|13277636|gb|AAH03729.1| Potassium channel, subfamily K, membe... 76 1e-12
gi|32562837|ref|NP_492511.2| putative protein family member, wit... 76 1e-12
gi|50741362|ref|XP_419561.1| PREDICTED: similar to putative pota... 76 2e-12
gi|33636599|gb|AAQ23597.1| RE05370p [Drosophila melanogaster] 75 2e-12
gi|39590077|emb|CAE61075.1| Hypothetical protein CBG04825 [Caeno... 75 3e-12
gi|24646638|ref|NP_650300.1| CG9637-PA [Drosophila melanogaster]... 75 4e-12
gi|2213891|gb|AAB61602.1| rabKCNK1 [Oryctolagus cuniculus] 74 5e-12
gi|50507821|emb|CAB07854.2| Hypothetical protein R12G8.2 [Caenor... 74 5e-12
gi|17563162|ref|NP_507485.1| potassium channel family member (5S... 74 5e-12
gi|24655040|ref|NP_612084.1| CG9194-PA [Drosophila melanogaster]... 74 5e-12
gi|32565295|ref|NP_499470.2| putative protein family member, wit... 74 5e-12
gi|7509931|pir||T26953 hypothetical protein Y47D3B.5 - Caenorhab... 74 5e-12
gi|31198023|ref|XP_307959.1| ENSANGP00000013427 [Anopheles gambi... 74 6e-12
gi|25151576|ref|NP_741678.1| potassium channel TWIK-1 (36.4 kD) ... 74 6e-12
gi|19110344|gb|AAL82795.1| potassium channel TWIK-1 [Cavia porce... 74 6e-12
gi|6680538|ref|NP_032456.1| potassium channel, subfamily K, memb... 74 6e-12
gi|39595653|emb|CAE67155.1| Hypothetical protein CBG12580 [Caeno... 74 8e-12
gi|47221027|emb|CAG12721.1| unnamed protein product [Tetraodon n... 74 8e-12
gi|31207013|ref|XP_312473.1| ENSANGP00000021888 [Anopheles gambi... 73 1e-11
gi|6680540|ref|NP_032457.1| potassium channel, subfamily K, memb... 73 1e-11
gi|47225271|emb|CAG09771.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|48120923|ref|XP_396471.1| similar to ENSANGP00000021888 [Apis... 73 1e-11
gi|41055407|ref|NP_956927.1| hypothetical protein MGC63921 [Dani... 73 1e-11
gi|25147267|ref|NP_741881.1| UNCoordinated locomotion UNC-110, M... 73 1e-11
gi|25147270|ref|NP_741880.1| UNCoordinated locomotion UNC-110, M... 73 1e-11
gi|39580228|emb|CAE72984.1| Hypothetical protein CBG20326 [Caeno... 72 2e-11
gi|39582763|emb|CAE74226.1| Hypothetical protein CBG21910 [Caeno... 72 2e-11
gi|50740491|ref|XP_419477.1| PREDICTED: similar to potassium cha... 72 2e-11
gi|39584817|emb|CAE67712.1| Hypothetical protein CBG13286 [Caeno... 72 3e-11
gi|47206503|emb|CAF90084.1| unnamed protein product [Tetraodon n... 71 4e-11
gi|50748854|ref|XP_421431.1| PREDICTED: similar to potassium cha... 71 4e-11
gi|34861038|ref|XP_346569.1| hypothetical protein XP_346568 [Rat... 70 7e-11
gi|39588079|emb|CAE57311.1| Hypothetical protein CBG00233 [Caeno... 70 9e-11
gi|39580013|emb|CAE56818.1| Hypothetical protein CBG24632 [Caeno... 70 9e-11
gi|39596487|emb|CAE63106.1| Hypothetical protein CBG07401 [Caeno... 70 1e-10
gi|4758624|ref|NP_004814.1| potassium channel, subfamily K, memb... 70 1e-10
gi|47217179|emb|CAG11015.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|18034771|ref|NP_446256.2| potassium inwardly-rectifying chann... 70 1e-10
gi|4504851|ref|NP_003731.1| potassium channel, subfamily K, memb... 69 2e-10
gi|29835154|gb|AAH51088.1| Kcnk5 protein [Mus musculus] 69 2e-10
gi|11496265|ref|NP_067517.1| potassium channel, subfamily K, mem... 69 2e-10
gi|17570149|ref|NP_509516.1| TWiK family of potassium channels (... 69 2e-10
gi|39594139|emb|CAE70249.1| Hypothetical protein CBG16741 [Caeno... 69 2e-10
gi|7496375|pir||T15584 hypothetical protein C24A3.6 - Caenorhabd... 69 2e-10
gi|50740494|ref|XP_419478.1| PREDICTED: similar to potassium cha... 69 2e-10
gi|17530889|ref|NP_511112.1| CG1615-PB [Drosophila melanogaster]... 68 4e-10
gi|50507717|emb|CAA91376.2| Hypothetical protein B0334.2 [Caenor... 68 4e-10
gi|7507331|pir||T24626 hypothetical protein T06H11.1 - Caenorhab... 68 4e-10
gi|17536607|ref|NP_496452.1| TWiK family of potassium channels (... 68 4e-10
gi|31240391|ref|XP_320609.1| ENSANGP00000010680 [Anopheles gambi... 68 4e-10
gi|17550920|ref|NP_510284.1| TWiK family of potassium channels (... 68 5e-10
gi|7497246|pir||T19860 hypothetical protein C40C9.1 - Caenorhabd... 68 5e-10
gi|19110352|gb|AAL82796.1| potassium channel TWIK-2 [Cavia porce... 68 5e-10
gi|17506133|ref|NP_491810.1| potassium channel DP4 family member... 68 5e-10
gi|32566087|ref|NP_502685.2| putative protein family member, wit... 67 6e-10
gi|7509540|pir||T26616 hypothetical protein Y37A1B.11 - Caenorha... 67 6e-10
gi|15718767|ref|NP_201567.1| potassium channel, subfamily K, mem... 67 8e-10
gi|39591002|emb|CAE58782.1| Hypothetical protein CBG01980 [Caeno... 67 8e-10
gi|7576935|gb|AAF64062.1| tandem pore domain potassium channel T... 67 8e-10
gi|15718765|ref|NP_057695.2| potassium channel, subfamily K, mem... 67 8e-10
gi|38086199|ref|XP_355877.1| similar to potassium channel, subfa... 67 1e-09
gi|16758136|ref|NP_445857.1| potassium channel, subfamily K, mem... 67 1e-09
gi|26331778|dbj|BAC29619.1| unnamed protein product [Mus musculus] 67 1e-09
gi|34855627|ref|XP_215230.2| hypothetical protein XP_215230 [Rat... 66 1e-09
gi|11359774|pir||T45032 hypothetical protein Y39B6B.f [imported]... 66 1e-09
gi|47219414|emb|CAG01577.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|45594290|gb|AAS68516.1| 2P K ion channel TRESK [Rattus norveg... 66 2e-09
gi|27807011|ref|NP_776983.1| potassium channel, subfamily K, mem... 65 2e-09
gi|47225555|emb|CAG12038.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|47216202|emb|CAG01236.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|38085211|ref|XP_285304.2| similar to TWIK-related spinal cord... 65 2e-09
gi|16758650|ref|NP_446258.1| potassium channel, subfamily K, mem... 65 3e-09
gi|25513799|pir||JC7703 TASK-5 protein - human 65 3e-09
gi|11641275|ref|NP_071753.1| potassium family, subfamily K, memb... 65 3e-09
gi|17570457|ref|NP_509942.1| ion transport protein family member... 65 4e-09
gi|4504849|ref|NP_002237.1| potassium channel, subfamily K, memb... 65 4e-09
gi|39585390|emb|CAE61712.1| Hypothetical protein CBG05661 [Caeno... 65 4e-09
gi|4103376|gb|AAD09338.1| putative potassium channel DP4 [Mus mu... 64 5e-09
gi|33859576|ref|NP_034738.1| potassium channel, subfamily K, mem... 64 5e-09
gi|39597266|emb|CAE59494.1| Hypothetical protein CBG02879 [Caeno... 64 5e-09
gi|14583127|gb|AAK69764.1| potassium channel TASK-3 [Rattus norv... 64 5e-09
gi|32469495|ref|NP_862823.1| TWIK-related spinal cord K+ channel... 64 5e-09
gi|17570155|ref|NP_510654.1| predicted CDS, TWiK family of potas... 64 5e-09
gi|15431283|ref|NP_203694.1| potassium channel, subfamily K, mem... 64 5e-09
gi|24647970|ref|NP_650726.1| CG10864-PA [Drosophila melanogaster... 64 5e-09
gi|39584578|emb|CAE74656.1| Hypothetical protein CBG22456 [Caeno... 64 7e-09
gi|48094838|ref|XP_394281.1| similar to ENSANGP00000013427 [Apis... 64 7e-09
gi|2465544|gb|AAC53367.1| TWIK-related acid-sensitive K+ channel... 64 7e-09
gi|7706135|ref|NP_057685.1| potassium channel, subfamily K, memb... 64 7e-09
gi|17565094|ref|NP_507483.1| putative protein family member, wit... 64 7e-09
gi|38075345|ref|XP_141526.2| similar to Potassium channel subfam... 64 7e-09
gi|24636274|sp|Q9ES08|CIW9_RAT Potassium channel subfamily K mem... 64 9e-09
gi|39594738|emb|CAE70606.1| Hypothetical protein CBG17283 [Caeno... 63 1e-08
gi|39930507|ref|NP_570826.1| potassium channel, subfamily K, mem... 62 2e-08
gi|17536221|ref|NP_494786.1| twk-8 protein like family member (2... 62 2e-08
gi|49035146|gb|AAK18976.2| Twik family of potassium channels pro... 62 2e-08
gi|39582439|emb|CAE74823.1| Hypothetical protein CBG22661 [Caeno... 62 2e-08
gi|6754432|ref|NP_034737.1| potassium channel, subfamily K, memb... 62 3e-08
gi|47224316|emb|CAG09162.1| unnamed protein product [Tetraodon n... 62 3e-08
gi|38566067|gb|AAH62094.1| Kcnk2 protein [Mus musculus] 62 3e-08
gi|10944275|emb|CAC14068.1| dJ781B1.1 (Two pore potassium channe... 62 3e-08
gi|31205787|ref|XP_311845.1| ENSANGP00000017550 [Anopheles gambi... 62 3e-08
gi|8132414|gb|AAF73282.1| two pore domain K+ channel subunit [Mu... 62 3e-08
gi|4768615|gb|AAD29577.1| two pore domain K+ channel subunit [Mu... 62 3e-08
gi|13124112|sp|Q9Z2T1|CIW8_MOUSE Potassium channel subfamily K m... 62 3e-08
gi|4103374|gb|AAD09337.1| putative potassium channel DP3 [Mus mu... 62 3e-08
gi|32454070|gb|AAP82866.1| pancreatic potassium channel TALK-1b ... 62 3e-08
gi|6502965|gb|AAF14528.1| two pore domain potassium channel KCNK... 62 3e-08
gi|6649861|gb|AAF21603.1| neuromuscular two P domain potassium c... 62 3e-08
gi|48095690|ref|XP_394509.1| similar to CG9637-PA [Apis mellifera] 61 4e-08
gi|13124054|sp|O95069|CIW2_HUMAN Potassium channel subfamily K m... 61 4e-08
gi|25282403|ref|NP_742038.1| potassium channel, subfamily K, mem... 61 4e-08
gi|19921794|ref|NP_610349.1| CG8713-PA [Drosophila melanogaster]... 61 4e-08
gi|47229323|emb|CAG04075.1| unnamed protein product [Tetraodon n... 61 6e-08
gi|14589851|ref|NP_055032.1| potassium channel, subfamily K, mem... 61 6e-08
gi|5712621|gb|AAD47569.1| TREK-1 potassium channel [Homo sapiens] 61 6e-08
gi|27807241|ref|NP_777111.1| potassium channel, subfamily K, mem... 61 6e-08
gi|13507377|gb|AAK28551.1| potassium channel TASK-4 [Homo sapiens] 61 6e-08
gi|9988112|emb|CAC07336.1| dJ137F1.2 (novel member of the potass... 61 6e-08
gi|32454074|gb|AAP82868.1| pancreatic potassium channel TALK-1d ... 61 6e-08
gi|19343981|gb|AAH25726.1| Potassium channel, subfamily K, membe... 61 6e-08
gi|17025230|ref|NP_113648.2| potassium channel, subfamily K, mem... 61 6e-08
gi|14149764|ref|NP_115491.1| potassium channel, subfamily K, mem... 61 6e-08
gi|17542648|ref|NP_501724.1| TWiK family of potassium channels (... 61 6e-08
gi|13431425|sp|Q9JL58|CIW9_CAVPO Potassium channel subfamily K m... 60 7e-08
gi|39596343|emb|CAE69981.1| Hypothetical protein CBG16379 [Caeno... 60 7e-08
gi|17555394|ref|NP_497973.1| TWiK family of potassium channels (... 60 1e-07
gi|39594882|emb|CAE70750.1| Hypothetical protein CBG17497 [Caeno... 60 1e-07
gi|19110360|gb|AAL82798.1| potassium channel KCNK7 [Cavia porcel... 60 1e-07
gi|7500371|pir||T21683 hypothetical protein F32H5.2 - Caenorhabd... 60 1e-07
gi|48124394|ref|XP_396556.1| similar to CG8713-PA [Apis mellifera] 59 2e-07
gi|48124383|ref|XP_393264.1| similar to ENSANGP00000017550 [Apis... 59 2e-07
gi|9988111|emb|CAC07335.1| dJ137F1.1 (novel member of the potass... 59 3e-07
gi|17559910|ref|NP_504782.1| ion transport protein family member... 59 3e-07
gi|7499459|pir||T30037 hypothetical protein F20A1.7 - Caenorhabd... 59 3e-07
gi|32566714|ref|NP_872139.1| ion transport protein family member... 59 3e-07
gi|17559912|ref|NP_504783.1| ion transport protein family member... 59 3e-07
gi|10801598|dbj|BAB16710.1| TASK1 splice bvariant (TASK1b) [Ratt... 58 4e-07
gi|50740290|ref|XP_419418.1| PREDICTED: similar to potassium cha... 58 4e-07
gi|20870425|ref|XP_138942.1| RIKEN cDNA 4731413G05 [Mus musculus] 58 4e-07
gi|5821141|dbj|BAA35074.1| double-pore K channel 3 [Mus musculus] 58 5e-07
gi|34861469|ref|XP_219517.2| similar to mitogen activated protei... 58 5e-07
gi|11560129|ref|NP_071629.1| tandem pore domain potassium channe... 58 5e-07
gi|22122525|ref|NP_666149.1| potassium channel, subfamily K, mem... 58 5e-07
gi|16118231|ref|NP_203133.1| potassium channel, subfamily K, mem... 57 6e-07
gi|32454072|gb|AAP82867.1| pancreatic potassium channel TALK-1c ... 57 8e-07
gi|39594957|emb|CAE70825.1| Hypothetical protein CBG17601 [Caeno... 57 8e-07
gi|33300325|emb|CAE17863.1| Hypothetical protein K11H3.7 [Caenor... 57 8e-07
gi|26331130|dbj|BAC29295.1| unnamed protein product [Mus musculus] 57 1e-06
gi|12831215|ref|NP_075584.1| potassium channel TREK-2 [Rattus no... 57 1e-06
gi|26349569|dbj|BAC38424.1| unnamed protein product [Mus musculus] 57 1e-06
gi|19921934|ref|NP_610516.1| CG1688-PA [Drosophila melanogaster]... 57 1e-06
gi|45505228|gb|AAS66991.1| potassium channel TREK-2 [Oryctolagus... 56 1e-06
gi|24656702|ref|NP_611547.1| CG15655-PA [Drosophila melanogaster... 56 1e-06
gi|19716292|gb|AAL95706.1| potassium channel TREK2 splice varian... 56 2e-06
gi|19716290|gb|AAL95705.1| potassium channel TREK2 splice varian... 56 2e-06
gi|20143944|ref|NP_612190.1| potassium channel, subfamily K, mem... 56 2e-06
gi|20143946|ref|NP_612191.1| potassium channel, subfamily K, mem... 56 2e-06
gi|10863961|ref|NP_066984.1| potassium channel, subfamily K, mem... 56 2e-06
gi|34868980|ref|XP_223777.2| similar to dJ137F1.2 (novel member ... 56 2e-06
gi|32563600|ref|NP_492054.2| TWiK family of potassium channels (... 55 2e-06
gi|7499553|pir||T21188 hypothetical protein F21C3.1 - Caenorhabd... 55 2e-06
gi|50758683|ref|XP_417369.1| PREDICTED: similar to Potassium cha... 55 2e-06
gi|31231315|ref|XP_318503.1| ENSANGP00000021246 [Anopheles gambi... 55 2e-06
gi|16118233|ref|NP_203134.1| potassium channel, subfamily K, mem... 55 4e-06
gi|5031821|ref|NP_005705.1| potassium channel, subfamily K, memb... 55 4e-06
gi|34556101|emb|CAE46687.1| C. elegans TWK-8 protein (correspond... 55 4e-06
gi|17542646|ref|NP_501578.1| TWiK family of potassium channels (... 55 4e-06
gi|47227295|emb|CAF96844.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|39590727|emb|CAE65097.1| Hypothetical protein CBG09957 [Caeno... 54 7e-06
gi|31228802|ref|XP_318113.1| ENSANGP00000003582 [Anopheles gambi... 54 9e-06
gi|39594463|emb|CAE72041.1| Hypothetical protein CBG19123 [Caeno... 53 1e-05
gi|15419623|gb|AAK97094.1| tandem acid-sensitive potassium chann... 53 2e-05
gi|39586438|emb|CAE74097.1| Hypothetical protein CBG21757 [Caeno... 53 2e-05
gi|47222681|emb|CAG00115.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|31228794|ref|XP_318112.1| ENSANGP00000017590 [Anopheles gambi... 51 4e-05
gi|32566708|ref|NP_872137.1| putative protein family member, wit... 51 4e-05
gi|11177516|gb|AAG32314.1| tandem pore domain potassium channel ... 51 4e-05
gi|16306555|ref|NP_071337.2| potassium channel, subfamily K, mem... 51 4e-05
gi|21707910|gb|AAH33577.1| KCNK4 protein [Homo sapiens] 50 1e-04
gi|47208750|emb|CAF94456.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|17564898|ref|NP_506078.1| TWiK family of potassium channels (... 49 2e-04
gi|50507754|emb|CAH04700.1| Hypothetical protein F55C5.3b [Caeno... 49 2e-04
gi|17556454|ref|NP_497621.1| predicted CDS, open rectifier K+ ch... 49 2e-04
gi|28571421|ref|NP_572321.2| CG3367-PA [Drosophila melanogaster]... 49 2e-04
gi|19110369|gb|AAL82797.1| potassium channel TWIK-2 [Cavia porce... 48 4e-04
gi|48106734|ref|XP_396150.1| similar to ENSANGP00000021390 [Apis... 48 5e-04
gi|39592213|emb|CAE75434.1| Hypothetical protein CBG23427 [Caeno... 48 5e-04
gi|50749036|ref|XP_426457.1| PREDICTED: similar to potassium cha... 47 6e-04
gi|47215428|emb|CAG01125.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|17564894|ref|NP_505731.1| TWiK family of potassium channels (... 47 6e-04
gi|41409397|ref|NP_962233.1| hypothetical protein MAP3299c [Myco... 47 0.001
gi|47229993|emb|CAG10407.1| unnamed protein product [Tetraodon n... 47 0.001
gi|39593400|emb|CAE64870.1| Hypothetical protein CBG09670 [Caeno... 46 0.001
gi|11560127|ref|NP_071628.1| potassium channel, subfamily K, mem... 46 0.001
gi|40445393|ref|NP_954859.1| potassium channel, subfamily K, mem... 46 0.001
gi|44890021|emb|CAF32139.1| outward-rectifier potassium channel ... 46 0.001
gi|11545761|ref|NP_071338.1| potassium channel, subfamily K, mem... 46 0.002
gi|19882235|ref|NP_084187.1| TREK2; outward rectifying potassium... 46 0.002
gi|28868871|ref|NP_791490.1| conserved hypothetical protein [Pse... 45 0.002
gi|38102438|gb|EAA49275.1| hypothetical protein MG00933.4 [Magna... 45 0.003
gi|20091059|ref|NP_617134.1| potassium channel protein [Methanos... 45 0.003
gi|32405542|ref|XP_323384.1| hypothetical protein [Neurospora cr... 45 0.003
gi|24528452|gb|AAN62847.1| tandem pore domain potassium channel ... 45 0.003
gi|23821211|emb|CAD53325.1| potassium channel [Neurospora crassa] 45 0.003
gi|45357590|ref|NP_987147.1| putative potassium channel protein ... 45 0.004
gi|33867199|ref|NP_898757.1| conserved hypothetical protein [Rho... 44 0.005
gi|50751022|ref|XP_426614.1| PREDICTED: similar to sodium- and c... 44 0.007
gi|38077857|ref|XP_139424.3| similar to potassium channel TASK3 ... 44 0.007
gi|26990011|ref|NP_745436.1| conserved hypothetical protein [Pse... 44 0.007
gi|29377477|ref|NP_816631.1| conserved hypothetical protein [Ent... 43 0.016
gi|48102756|ref|XP_395425.1| similar to ENSANGP00000021246 [Apis... 43 0.016
gi|47458968|ref|YP_015830.1| putative K+ ion channel membrane pr... 42 0.021
gi|47222588|emb|CAG02953.1| unnamed protein product [Tetraodon n... 42 0.021
gi|50311387|ref|XP_455718.1| unnamed protein product [Kluyveromy... 42 0.027
gi|15669547|ref|NP_248360.1| potassium channel protein, putative... 42 0.027
gi|22535558|dbj|BAC10733.1| putative potassium channel [Oryza sa... 42 0.027
gi|47224354|emb|CAG09200.1| unnamed protein product [Tetraodon n... 42 0.035
gi|24639778|ref|NP_726963.1| CG32770-PA [Drosophila melanogaster... 42 0.035
gi|50552031|ref|XP_503490.1| hypothetical protein [Yarrowia lipo... 41 0.046
gi|11177892|ref|NP_068625.1| potassium channel, subfamily T, mem... 41 0.046
gi|37360374|dbj|BAC98165.1| mKIAA1422 protein [Mus musculus] 41 0.046
gi|46134185|ref|XP_389408.1| hypothetical protein FG09232.1 [Gib... 41 0.046
gi|15237430|ref|NP_199449.1| outward rectifying potassium channe... 41 0.046
gi|6686780|emb|CAB64717.1| KCO2 protein [Arabidopsis thaliana] 41 0.046
gi|21228960|ref|NP_634882.1| Potassium channel protein [Methanos... 41 0.060
gi|25154299|ref|NP_741649.1| SLOwpoke potassium channel subunit,... 41 0.060
gi|25154297|ref|NP_741648.1| SLOwpoke potassium channel subunit,... 41 0.060
gi|39595930|emb|CAE67433.1| Hypothetical protein CBG12923 [Caeno... 41 0.060
gi|25154301|ref|NP_741647.1| SLOwpoke potassium channel subunit,... 41 0.060
gi|47215137|emb|CAG12428.1| unnamed protein product [Tetraodon n... 41 0.060
gi|7510109|pir||T27083 hypothetical protein Y51A2D.19 - Caenorha... 41 0.060
gi|48769979|ref|ZP_00274323.1| COG1226: Kef-type K+ transport sy... 41 0.060
gi|15234351|ref|NP_192093.1| outward rectifying potassium channe... 41 0.060
gi|48138893|ref|XP_396947.1| similar to ENSANGP00000017550 [Apis... 41 0.060
gi|13365907|dbj|BAB39327.1| hypothetical protein [Macaca fascicu... 40 0.078
gi|47077510|dbj|BAD18642.1| unnamed protein product [Homo sapiens] 40 0.078
gi|38454262|ref|NP_942057.1| sodium- and chloride-activated ATP-... 40 0.078
gi|30023424|ref|NP_835055.1| Potassium channel protein [Bacillus... 40 0.078
gi|7243225|dbj|BAA92660.1| KIAA1422 protein [Homo sapiens] 40 0.078
gi|45506627|ref|ZP_00158979.1| COG1226: Kef-type K+ transport sy... 40 0.078
gi|41349443|ref|NP_940905.2| sodium- and chloride-activated ATP-... 40 0.078
gi|34534883|dbj|BAC87144.1| unnamed protein product [Homo sapiens] 40 0.078
gi|25027348|ref|NP_737402.1| conserved hypothetical protein [Cor... 40 0.078
gi|46113983|ref|ZP_00184200.2| COG1226: Kef-type K+ transport sy... 40 0.10
gi|38233330|ref|NP_939097.1| Putative membrane transport protein... 40 0.10
gi|47221472|emb|CAG08134.1| unnamed protein product [Tetraodon n... 40 0.13
gi|46119129|ref|ZP_00201439.1| hypothetical protein Cwat024731 [... 40 0.13
gi|50875213|emb|CAG35053.1| conserved hypothetical protein [Desu... 40 0.13
gi|17232125|ref|NP_488673.1| probable ion transporter [Nostoc sp... 39 0.17
gi|29249999|gb|EAA41500.1| GLP_623_28792_32637 [Giardia lamblia ... 39 0.17
gi|24376318|ref|NP_720426.1| conserved hypothetical protein [She... 39 0.17
gi|39595411|emb|CAE60449.1| Hypothetical protein CBG04057 [Caeno... 39 0.17
gi|17507109|ref|NP_491692.1| predicted CDS, twk-8 protein like f... 39 0.23
gi|48838131|ref|ZP_00295079.1| COG1226: Kef-type K+ transport sy... 39 0.23
gi|15217783|ref|NP_171752.1| outward rectifying potassium channe... 39 0.23
gi|38605046|sp|Q9FWX6|KCO4_ARATH Putative outward-rectifying pot... 39 0.23
gi|50732038|ref|XP_425942.1| PREDICTED: similar to Potassium cha... 39 0.30
gi|15828892|ref|NP_326252.1| POTASSIUM CHANNEL PROTEIN [Mycoplas... 39 0.30
gi|49478984|ref|YP_039385.1| potassium channel protein [Bacillus... 39 0.30
gi|48892039|ref|ZP_00325472.1| COG0664: cAMP-binding proteins - ... 39 0.30
gi|21397876|ref|NP_653861.1| KTN, KTN NAD-binding domain [Bacill... 39 0.30
gi|47217756|emb|CAG05978.1| unnamed protein product [Tetraodon n... 38 0.39
gi|21323543|dbj|BAB98170.1| Kef-type K+ transport systems, predi... 38 0.39
gi|48124397|ref|XP_396557.1| similar to ENSANGP00000003582 [Apis... 38 0.39
gi|2584731|emb|CAA73842.1| EAG channel [Bos taurus] 38 0.39
gi|27805967|ref|NP_776797.1| potassium voltage-gated channel, su... 38 0.39
gi|4323298|gb|AAD16279.1| pulvinus outward-rectifying channel fo... 38 0.39
gi|6754422|ref|NP_034730.1| potassium voltage-gated channel, sub... 38 0.39
gi|49079900|ref|XP_403540.1| hypothetical protein UM05925.1 [Ust... 38 0.39
gi|27437001|ref|NP_758872.1| potassium voltage-gated channel, su... 38 0.39
gi|19552003|ref|NP_600005.1| predicted NAD-binding component of ... 38 0.39
gi|13929046|ref|NP_113930.1| potassium voltage-gated channel, su... 38 0.39
gi|4504831|ref|NP_002229.1| potassium voltage-gated channel, sub... 38 0.39
gi|50549977|ref|XP_502461.1| hypothetical protein [Yarrowia lipo... 38 0.51
gi|17549943|ref|NP_508108.1| putative protein, with at least 3 t... 38 0.51
gi|45532509|ref|ZP_00183513.1| COG1226: Kef-type K+ transport sy... 37 0.66
gi|17229750|ref|NP_486298.1| serine/threonine kinase with two-co... 37 0.66
gi|47228939|emb|CAG09454.1| unnamed protein product [Tetraodon n... 37 0.66
gi|7546841|gb|AAF63707.1| potassium channel TASK3 [Cavia porcellus] 37 0.66
gi|45383059|ref|NP_989893.1| potassium channel subunit [Gallus g... 37 0.87
gi|7489262|pir||T07396 probable outward rectifying potassium cha... 37 0.87
gi|42490787|gb|AAH66138.1| Hypothetical protein 6430546I09 [Mus ... 37 0.87
gi|6625694|gb|AAF19354.1| potasium channel Eag2 [Rattus norvegicus] 37 0.87
gi|27370198|ref|NP_766393.1| hypothetical protein 6430546I09 [Mu... 37 0.87
gi|22024390|ref|NP_647479.2| potassium voltage-gated channel, su... 37 0.87
gi|26006802|sp|Q8NCM2|KCH5_HUMAN Potassium voltage-gated channel... 37 0.87
gi|19424324|ref|NP_598294.1| potassium voltage-gated channel, su... 37 0.87
gi|23125946|ref|ZP_00107859.1| COG1226: Kef-type K+ transport sy... 37 0.87
gi|27886648|ref|NP_758964.1| potassium voltage-gated channel, su... 37 0.87
gi|27886646|ref|NP_758963.1| potassium voltage-gated channel, su... 37 0.87
gi|50748810|ref|XP_421414.1| PREDICTED: similar to potassium vol... 37 0.87
gi|45526586|ref|ZP_00177790.1| COG1226: Kef-type K+ transport sy... 37 0.87
gi|15236780|ref|NP_193550.1| outward rectifying potassium channe... 37 0.87
gi|24652410|ref|NP_610576.1| CG12904-PA [Drosophila melanogaster... 37 0.87
gi|21224644|ref|NP_630423.1| putative membrane protein [Streptom... 37 0.87
gi|21224301|ref|NP_630080.1| putative membrane protein [Streptom... 37 0.87
gi|10801600|dbj|BAB16711.1| TWIK-related acid-sensitive K+ chann... 37 0.87
gi|14285403|sp|Q9NR82|CIQ5_HUMAN Potassium voltage-gated channel... 37 1.1
gi|38049363|ref|XP_355195.1| similar to Dendritic cell protein G... 37 1.1
gi|8132997|gb|AAF73446.1| voltage-gated potassium channel KCNQ5 ... 37 1.1
gi|48837563|ref|ZP_00294538.1| COG1226: Kef-type K+ transport sy... 37 1.1
gi|29791782|gb|AAH50689.1| Unknown (protein for IMAGE:6137109) [... 37 1.1
gi|28202039|ref|NP_780671.1| potassium channel, subfamily T, mem... 37 1.1
gi|15600964|ref|NP_232594.1| potassium channel protein, putative... 37 1.1
gi|34541624|ref|NP_906103.1| ion transporter [Porphyromonas ging... 37 1.1
gi|39597105|emb|CAE59332.1| Hypothetical protein CBG02674 [Caeno... 37 1.1
gi|28373065|ref|NP_062816.2| potassium voltage-gated channel, KQ... 37 1.1
gi|9651967|gb|AAF91335.1| voltage-gated potassium channel [Homo ... 37 1.1
gi|14285398|sp|Q9JK45|CIQ5_MOUSE Potassium voltage-gated channel... 37 1.1
gi|34874570|ref|XP_237012.2| similar to voltage-gated potassium ... 37 1.1
gi|47570514|ref|ZP_00241142.1| potassium channel, putative [Baci... 36 1.5
gi|41408577|ref|NP_961413.1| hypothetical protein MAP2479 [Mycob... 36 1.5
gi|48870188|ref|ZP_00322916.1| COG1226: Kef-type K+ transport sy... 36 1.5
gi|38073461|ref|XP_136252.3| similar to potassium channel subuni... 36 1.5
gi|46434032|gb|EAK93454.1| hypothetical protein CaO19.4175 [Cand... 36 1.5
gi|41718792|ref|ZP_00147749.1| COG1226: Kef-type K+ transport sy... 36 1.5
gi|23129256|ref|ZP_00111088.1| COG1226: Kef-type K+ transport sy... 36 1.5
gi|16801231|ref|NP_471499.1| similar to potassium channel subuni... 36 1.5
gi|41057800|ref|XP_029962.4| potassium channel, subfamily T, mem... 36 1.9
gi|31198679|ref|XP_308287.1| ENSANGP00000023759 [Anopheles gambi... 36 1.9
gi|29830302|ref|NP_824936.1| hypothetical protein SAV3759 [Strep... 36 1.9
gi|21397377|ref|NP_653362.1| hypothetical protein predicted by G... 36 1.9
gi|31198681|ref|XP_308288.1| ENSANGP00000009368 [Anopheles gambi... 36 1.9
gi|42527939|ref|NP_973037.1| conserved hypothetical protein [Tre... 36 1.9
gi|14520711|ref|NP_126186.1| hypothetical protein PAB0334 [Pyroc... 36 1.9
gi|15237429|ref|NP_199448.1| outward rectifying potassium channe... 36 1.9
gi|9366844|emb|CAB95606.1| conserved hypothetical protein [Trypa... 36 1.9
gi|17384429|emb|CAD13242.1| bA100C15.2 (potassium channel subuni... 36 1.9
gi|46201458|ref|ZP_00054971.2| COG1226: Kef-type K+ transport sy... 36 1.9
gi|7512004|pir||T13168 probable potassium channel elk chain - fr... 32 2.2
gi|17136946|ref|NP_477009.1| CG5076-PA [Drosophila melanogaster]... 32 2.2
gi|15668309|ref|NP_247105.1| potassium channel protein [Methanoc... 35 2.5
gi|21225475|ref|NP_631254.1| putative ion transport integral mem... 35 2.5
gi|15678533|ref|NP_275648.1| potassium channel related protein [... 35 2.5
gi|16329750|ref|NP_440478.1| potassium channel [Synechocystis sp... 35 2.5
gi|13276863|emb|CAC34339.1| K+ channel protein [Solanum tuberosum] 35 2.5
gi|4151117|emb|CAA12225.1| K+ channel protein [Solanum tuberosum] 35 2.5
gi|47566930|ref|ZP_00237647.1| potassium channel, putative [Baci... 35 2.5
gi|50739068|ref|XP_426109.1| PREDICTED: similar to potassium cha... 35 2.5
gi|42784081|ref|NP_981328.1| conserved hypothetical protein [Bac... 35 2.5
gi|33594472|ref|NP_882116.1| putative potassium channel protein ... 35 2.5
gi|33595148|ref|NP_882791.1| putative potassium channel protein ... 35 2.5
gi|33599430|ref|NP_886990.1| putative potassium channel protein ... 35 2.5
gi|16758400|ref|NP_446060.1| potassium inwardly-rectifying chann... 35 2.5
gi|28144878|gb|AAO32309.1| putative outward rectifying potassium... 35 2.5
gi|27696693|gb|AAH43409.1| Unknown (protein for IMAGE:6065549) [... 35 2.5
gi|47223983|emb|CAG06160.1| unnamed protein product [Tetraodon n... 35 2.5
gi|37680454|ref|NP_935063.1| putative potassium channel protein ... 35 2.5
gi|27365504|ref|NP_761032.1| Potassium channel related protein [... 35 2.5
gi|30018851|ref|NP_830482.1| Potassium channel protein [Bacillus... 35 2.5
gi|21592756|gb|AAM64705.1| outward rectifying potassium channel ... 35 2.5
gi|15668310|ref|NP_247106.1| potassium channel protein [Methanoc... 35 2.5
gi|17228574|ref|NP_485122.1| probable potassium channel protein ... 35 2.5
gi|28493541|ref|NP_787702.1| unknown [Tropheryma whipplei str. T... 35 2.5
gi|31794377|ref|NP_856870.1| POSSIBLE TRANSMEMBRANE CATION TRANS... 35 2.5
gi|15610336|ref|NP_217716.1| hypothetical protein Rv3200c [Mycob... 35 2.5
gi|20094044|ref|NP_613891.1| Kef-type K+ transport systems, pred... 35 2.5
gi|29893185|gb|AAP03079.1| antigen [Taenia cellulosae] 35 3.3
gi|5830781|emb|CAB54856.1| potassium channel protein ZMK2 [Zea m... 35 3.3
gi|39937293|ref|NP_949569.1| Cyclic nucleotide regulated K+ chan... 35 3.3
gi|46314962|ref|ZP_00215546.1| COG1226: Kef-type K+ transport sy... 35 3.3
gi|21244155|ref|NP_643737.1| ion transporter [Xanthomonas axonop... 35 3.3
gi|23102494|ref|ZP_00089000.1| COG4208: ABC-type sulfate transpo... 35 3.3
gi|7445895|pir||T07651 potassium channel protein SKT1 - potato >... 35 3.3
gi|47216753|emb|CAG03757.1| unnamed protein product [Tetraodon n... 35 3.3
gi|7489806|pir||T03391 potassium channel - maize (fragment) >gnl... 35 3.3
gi|14475603|dbj|BAB60857.1| hypothetical protein [Bacillus cereus] 35 3.3
gi|46119130|ref|ZP_00201440.1| hypothetical protein Cwat024732 [... 35 4.3
gi|45915678|ref|ZP_00194393.2| COG1226: Kef-type K+ transport sy... 35 4.3
gi|31211073|ref|XP_314503.1| ENSANGP00000020564 [Anopheles gambi... 35 4.3
gi|50740359|ref|XP_419440.1| PREDICTED: similar to Potassium vol... 35 4.3
gi|45513140|ref|ZP_00164706.1| COG1226: Kef-type K+ transport sy... 35 4.3
gi|48854478|ref|ZP_00308640.1| COG1226: Kef-type K+ transport sy... 35 4.3
gi|48850977|ref|ZP_00305219.1| COG1226: Kef-type K+ transport sy... 35 4.3
gi|47218192|emb|CAF97056.1| unnamed protein product [Tetraodon n... 35 4.3
gi|45508583|ref|ZP_00160921.1| COG0843: Heme/copper-type cytochr... 35 4.3
gi|47568805|ref|ZP_00239499.1| potassium channel protein [Bacill... 35 4.3
gi|8980432|emb|CAA65254.1| potassium channel [Lycopersicon escul... 35 4.3
gi|46908294|ref|YP_014683.1| ion transport protein, putative [Li... 35 4.3
gi|47097473|ref|ZP_00235016.1| ion transport protein, putative [... 35 4.3
gi|16804098|ref|NP_465583.1| similar to potassium channel subuni... 35 4.3
gi|11466171|ref|NP_047104.1| CAKC2; L9003.1 [Leishmania major] >... 35 4.3
gi|17230224|ref|NP_486772.1| cytochrome c oxidase subunit I [Nos... 35 4.3
gi|38176034|gb|AAK68392.2| Hypothetical protein R05G9.2 [Caenorh... 35 4.3
gi|47209870|emb|CAF90439.1| unnamed protein product [Tetraodon n... 34 5.6
gi|46139449|ref|XP_391415.1| hypothetical protein FG11239.1 [Gib... 34 5.6
gi|34899396|ref|NP_911044.1| putative outward-rectifying potassi... 34 5.6
gi|13878564|sp|Q9QZ65|IRKD_CAVPO Inward rectifier potassium chan... 34 5.6
gi|6466201|gb|AAF12823.1| inwardly rectifying potassium channel ... 34 5.6
gi|34396048|gb|AAQ65226.1| K+-channel protein PAK6.1 [Paramecium... 34 5.6
gi|13878543|sp|O60928|IRKD_HUMAN Inward rectifier potassium chan... 34 5.6
gi|3650320|emb|CAA07552.1| inwardly-rectifying potassium channel... 34 5.6
gi|27734715|ref|NP_002233.1| potassium inwardly-rectifying chann... 34 5.6
gi|17564900|ref|NP_506103.1| TWiK family of potassium channels (... 34 5.6
gi|48781501|ref|ZP_00278109.1| COG1226: Kef-type K+ transport sy... 34 5.6
gi|34396038|gb|AAQ65221.1| K+-channel protein PAK2.4 [Paramecium... 34 5.6
gi|48854600|ref|ZP_00308762.1| COG2244: Membrane protein involve... 34 5.6
gi|13488501|ref|NP_109508.1| unknown protein [Mesorhizobium loti... 34 5.6
gi|17552334|ref|NP_498055.1| putative endoplasmic reticulum prot... 34 5.6
gi|3929231|gb|AAC79846.1| potassium channel [Rattus norvegicus] 34 7.3
gi|23509844|ref|NP_702511.1| hypothetical protein [Plasmodium fa... 34 7.3
gi|13541819|ref|NP_111507.1| Kef-type K+ transport system, predi... 34 7.3
gi|27805971|ref|NP_776799.1| potassium voltage-gated channel, KQ... 34 7.3
gi|23488842|gb|EAA21419.1| hypothetical protein [Plasmodium yoel... 34 7.3
gi|34499017|ref|NP_903232.1| probable ion transporter [Chromobac... 34 7.3
gi|15826856|ref|NP_113785.2| potassium voltage-gated channel, su... 34 7.3
gi|46312707|ref|ZP_00213301.1| COG1226: Kef-type K+ transport sy... 34 7.3
gi|16550932|gb|AAL25648.1| inward-rectifying K+ channel [Eucalyp... 34 7.3
gi|16550935|gb|AAL25649.1| inward-rectifying K+ channel [Eucalyp... 34 7.3
gi|23097333|ref|NP_690887.1| potassium voltage-gated channel, su... 34 7.3
gi|21225921|ref|NP_631700.1| voltage-gated potassium channel [St... 34 7.3
gi|50744806|ref|XP_419883.1| PREDICTED: similar to Potassium vol... 34 7.3
gi|4758630|ref|NP_004510.1| potassium voltage-gated channel KQT-... 34 7.3
gi|7445894|pir||T03939 potassium channel protein - maize >gnl|BL... 34 7.3
gi|48833229|ref|ZP_00290251.1| COG1226: Kef-type K+ transport sy... 34 7.3
gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassiu... 34 7.3
gi|37520502|ref|NP_923879.1| potassium channel protein [Gloeobac... 34 7.3
gi|48127465|ref|XP_396610.1| similar to ENSANGP00000023759 [Apis... 34 7.3
gi|2181186|emb|CAA65988.1| outward rectifying potassium channel ... 34 7.3
gi|34911758|ref|NP_917226.1| putative AKT1-like potassium channe... 34 7.3
gi|15240552|ref|NP_200374.1| outward rectifying potassium channe... 34 7.3
gi|33357898|pdb|1P7B|A Chain A, Crystal Structure Of An Inward R... 34 7.3
gi|2801450|gb|AAB97314.1| potassium channel homolog; KvEBN2 [Hom... 34 7.3
gi|47224306|emb|CAG09152.1| unnamed protein product [Tetraodon n... 34 7.3
gi|17887457|gb|AAL40894.1| AKT1-like potassium channel [Oryza sa... 34 7.3
gi|24380209|ref|NP_722164.1| hypothetical protein [Streptococcus... 34 7.3
gi|50731960|ref|XP_418434.1| PREDICTED: similar to potassium vol... 34 7.3
gi|50876151|emb|CAG35991.1| related to voltage-gated potassium c... 34 7.3
gi|16760140|ref|NP_455757.1| possible membrane transport protein... 33 9.6
gi|1763617|gb|AAB39749.1| potassium channel gamma subunit [Polyo... 33 9.6
>gi|17536609|ref|NP_495727.1| TWiK family of potassium channels
(twk-14) [Caenorhabditis elegans]
gi|7506031|pir||T23746 hypothetical protein M110.2 - Caenorhabditis
elegans
gi|3878719|emb|CAA90259.1| C. elegans TWK-3 protein (corresponding
sequence M110.2) [Caenorhabditis elegans]
Length = 383
Score = 724 bits (1868), Expect = 0.0
Identities = 370/383 (96%), Positives = 370/383 (96%)
Frame = -1
Query: 1152 MTVSMEENSKIQMLSATSKDKKVATDRSLLNKYHLGPLALHTGLVLSCVTYALGGAYLFL 973
MTVSMEENSKIQMLSATSKDKKVATDRSLLNKYHLGPLALHTGLVLSCVTYALGGAYLFL
Sbjct: 1 MTVSMEENSKIQMLSATSKDKKVATDRSLLNKYHLGPLALHTGLVLSCVTYALGGAYLFL 60
Query: 972 SIEHPEELKRREKAIREFQDLKQQFMGNITSGIENSEQSIEIYTKKLILMLEDAHNAHAF 793
SIEHPEELKRREKAIREFQDLKQQFMGNITSGIENSEQSIEIYTKKLILMLEDAHNAHAF
Sbjct: 61 SIEHPEELKRREKAIREFQDLKQQFMGNITSGIENSEQSIEIYTKKLILMLEDAHNAHAF 120
Query: 792 EYFFLNHEIPKDMWTFSSALVFTTTTVIPVGYGYIFPVSAYGRMCLIAYALLGIPLTLVT 613
EYFFLNHEIPKDMWTFSSALVFTTTTVIPVGYGYIFPVSAYGRMCLIAYALLGIPLTLVT
Sbjct: 121 EYFFLNHEIPKDMWTFSSALVFTTTTVIPVGYGYIFPVSAYGRMCLIAYALLGIPLTLVT 180
Query: 612 MADTGKFAAQLVTRWFGDNNMAIPAAIFVCLLFAYPLVVGFILCSTSNITYLDSVYFSLT 433
MADTGKFAAQLVTRWFGDNNMAIPAAIFVCLLFAYPLVVGFILCSTSNITYLDSVYFSLT
Sbjct: 181 MADTGKFAAQLVTRWFGDNNMAIPAAIFVCLLFAYPLVVGFILCSTSNITYLDSVYFSLT 240
Query: 432 SIFTIGFGDLTPDMNVIHMVLFLAVGVILVTITLDIVAAEMIDRVHYMGRHVGKAKELAG 253
SIFTIGFGDLTPDMNVIHMVLFLAVGVILVTITLDIVAAEMIDRVHYMGRHVGKAKELAG
Sbjct: 241 SIFTIGFGDLTPDMNVIHMVLFLAVGVILVTITLDIVAAEMIDRVHYMGRHVGKAKELAG 300
Query: 252 KMFQLAQSLNMKQGLVSGVGQLHALARFGMLVGREEVDKTQEDGIIAFSPDVMDGLEFMD 73
KMFQLAQSLNMKQGLVSGVGQLHALARFGMLVGREEVDKTQEDGIIAFSPDVMDGLEFMD
Sbjct: 301 KMFQLAQSLNMKQGLVSGVGQLHALARFGMLVGREEVDKTQEDGIIAFSPDVMDGLEFMD 360
Query: 72 TLSIYXXXXXXXXXXXXXNLFLS 4
TLSIY NLFLS
Sbjct: 361 TLSIYSRRSRRSAENSARNLFLS 383