Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M195_2
(915 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 205 1e-51
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 198 1e-49
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 137 3e-31
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 131 2e-29
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 110 4e-23
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 110 4e-23
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 108 1e-22
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 108 1e-22
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 108 2e-22
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 108 2e-22
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 108 2e-22
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 108 2e-22
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 107 3e-22
gi|687634|gb|AAA62504.1| collagen 106 6e-22
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 105 1e-21
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 105 2e-21
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 104 2e-21
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 103 7e-21
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 102 9e-21
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 101 2e-20
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 99 1e-19
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 97 4e-19
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 97 7e-19
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 94 3e-18
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 81 3e-14
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 81 4e-14
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 81 4e-14
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 81 4e-14
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 79 2e-13
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 72 2e-13
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 78 2e-13
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 78 2e-13
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 78 2e-13
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 77 5e-13
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 77 7e-13
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 77 7e-13
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 76 9e-13
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 76 9e-13
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 75 2e-12
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 75 2e-12
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 75 2e-12
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 75 2e-12
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 75 2e-12
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 75 3e-12
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 75 3e-12
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 75 3e-12
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 75 3e-12
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 75 3e-12
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 75 3e-12
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 74 3e-12
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 74 5e-12
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 74 6e-12
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 74 6e-12
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 73 8e-12
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 73 8e-12
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 73 1e-11
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 72 1e-11
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 70 5e-11
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 70 9e-11
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 67 6e-10
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 67 6e-10
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 67 6e-10
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 67 7e-10
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 66 1e-09
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 65 3e-09
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 64 5e-09
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 64 5e-09
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 63 1e-08
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 62 1e-08
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 62 2e-08
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 62 2e-08
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 61 3e-08
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 60 5e-08
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 60 7e-08
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 60 9e-08
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 59 2e-07
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 59 2e-07
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 59 2e-07
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 57 4e-07
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 57 6e-07
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 57 6e-07
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 57 8e-07
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 56 1e-06
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 56 1e-06
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 56 1e-06
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 56 1e-06
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 56 1e-06
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 56 1e-06
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 56 1e-06
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 55 2e-06
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 55 2e-06
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 55 2e-06
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 54 4e-06
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 54 4e-06
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 54 4e-06
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 54 4e-06
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 54 6e-06
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 54 6e-06
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 54 6e-06
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 53 8e-06
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 53 8e-06
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 52 1e-05
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 52 1e-05
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 52 2e-05
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 52 2e-05
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 52 2e-05
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 52 2e-05
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 52 2e-05
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 52 2e-05
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 51 3e-05
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 51 4e-05
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 51 4e-05
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 50 7e-05
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 50 7e-05
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 50 7e-05
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 50 7e-05
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 50 9e-05
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 50 9e-05
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 50 9e-05
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 49 1e-04
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 49 1e-04
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 49 1e-04
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 49 1e-04
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 49 2e-04
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 49 2e-04
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 49 2e-04
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 48 3e-04
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 48 3e-04
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 48 3e-04
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 48 3e-04
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 47 5e-04
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 47 5e-04
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 47 5e-04
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 47 5e-04
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 47 5e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 47 5e-04
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 47 6e-04
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 47 6e-04
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 47 6e-04
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 47 6e-04
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 47 6e-04
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 47 6e-04
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 47 8e-04
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 47 8e-04
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 47 8e-04
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 46 0.001
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 46 0.001
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 46 0.001
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 46 0.001
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 46 0.001
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 45 0.002
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 45 0.002
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 45 0.002
gi|24660935|ref|NP_648226.2| CG7015-PA [Drosophila melanogaster]... 45 0.002
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 45 0.002
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 45 0.002
gi|47026413|gb|AAT08469.1| RE66582p [Drosophila melanogaster] 45 0.002
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 45 0.003
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 45 0.003
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 45 0.003
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 45 0.003
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 45 0.003
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 44 0.004
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 44 0.004
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 44 0.004
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 44 0.004
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 44 0.005
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 44 0.005
gi|39598359|emb|CAE69052.1| Hypothetical protein CBG15061 [Caeno... 44 0.005
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 44 0.007
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 44 0.007
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 44 0.007
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 44 0.007
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 44 0.007
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 43 0.009
gi|24664668|ref|NP_730054.1| CG7439-PC [Drosophila melanogaster]... 43 0.009
gi|24664664|ref|NP_648775.1| CG7439-PB [Drosophila melanogaster]... 43 0.009
gi|28317062|gb|AAO39550.1| RE04347p [Drosophila melanogaster] 43 0.009
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 43 0.009
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 43 0.011
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 43 0.011
gi|42782378|ref|NP_979625.1| lipoprotein, putative [Bacillus cer... 43 0.011
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 43 0.011
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 43 0.011
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 42 0.015
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 42 0.015
gi|1513206|gb|AAC48704.1| involucrin 42 0.019
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 42 0.019
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 42 0.019
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 42 0.019
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 42 0.019
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 42 0.019
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 42 0.025
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 42 0.025
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 42 0.025
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 42 0.025
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 42 0.025
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 41 0.033
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 41 0.033
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 41 0.033
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para... 41 0.033
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 41 0.033
gi|24640194|ref|NP_572344.1| CG14441-PA [Drosophila melanogaster... 41 0.033
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 41 0.033
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 41 0.043
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster... 41 0.043
gi|48867374|ref|ZP_00320910.1| hypothetical protein Hinf80100166... 41 0.043
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 41 0.043
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 41 0.043
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 41 0.043
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 41 0.043
gi|28828696|gb|AAM33200.2| similar to Dictyostelium discoideum (... 41 0.043
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 40 0.056
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 40 0.056
gi|32403194|ref|XP_322210.1| predicted protein [Neurospora crass... 40 0.056
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 40 0.056
gi|50405279|ref|YP_054371.1| hypothetical protein, coiled-coil d... 40 0.056
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 40 0.056
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 40 0.056
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 40 0.056
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 40 0.056
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 40 0.056
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae] 40 0.056
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 40 0.056
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust... 40 0.073
gi|4336734|gb|AAD17923.1| Pax transcription activation domain in... 40 0.073
gi|42734451|ref|NP_061366.2| Pax transcription activation domain... 40 0.073
gi|49457168|emb|CAE51341.1| Phagocytosis 2 [Dictyostelium discoi... 40 0.073
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 40 0.073
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 40 0.073
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 40 0.073
gi|37544663|gb|AAN10184.1| hepatocyte nuclear factor 1 [Branchio... 40 0.073
gi|34853688|ref|XP_231271.2| similar to Pax transcription activa... 40 0.095
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 40 0.095
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 40 0.095
gi|28829631|gb|AAO52148.1| similar to Arabidopsis thaliana (Mous... 40 0.095
gi|121857|sp|P20398|GV7_XENLA Developmental protein xLGV7 >gnl|B... 40 0.095
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 40 0.095
gi|46227023|gb|EAK87973.1| ubiquitin C-terminal hydrolase of the... 40 0.095
gi|28828687|gb|AAM33192.2| similar to Dictyostelium discoideum (... 40 0.095
gi|28830197|gb|AAO52648.1| similar to Dictyostelium discoideum (... 40 0.095
gi|41053748|ref|NP_956554.1| similar to protein phosphatase 4, r... 40 0.095
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto... 40 0.095
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (... 40 0.095
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 40 0.095
gi|39579137|emb|CAE75527.1| Hypothetical protein CBG23549 [Caeno... 40 0.095
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 39 0.12
gi|50550003|ref|XP_502474.1| hypothetical protein [Yarrowia lipo... 39 0.12
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 39 0.12
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 39 0.12
gi|50312163|ref|XP_456113.1| unnamed protein product [Kluyveromy... 39 0.12
gi|17537743|ref|NP_497048.1| low density lipoprotein receptor (2... 39 0.12
gi|32420087|ref|XP_330487.1| predicted protein [Neurospora crass... 39 0.12
gi|19310546|gb|AAL85006.1| unknown protein [Arabidopsis thaliana] 39 0.16
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 39 0.16
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus] 39 0.16
gi|30687943|ref|NP_851046.1| auxin-responsive factor (ARF7) [Ara... 39 0.16
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 39 0.16
gi|4103243|gb|AAD04807.1| BIPOSTO [Arabidopsis thaliana] 39 0.16
gi|30687957|ref|NP_568400.2| auxin-responsive factor (ARF7) [Ara... 39 0.16
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 39 0.16
gi|38639024|gb|AAR25686.1| class I helical cytokine receptor num... 39 0.16
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 39 0.16
gi|24663924|ref|NP_729928.1| CG32132-PA [Drosophila melanogaster... 39 0.16
gi|30687949|ref|NP_851047.1| auxin-responsive factor (ARF7) [Ara... 39 0.16
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 39 0.21
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 39 0.21
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 39 0.21
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 39 0.21
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 39 0.21
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 39 0.21
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 39 0.21
gi|42733819|gb|AAS38737.1| similar to Dictyostelium discoideum (... 39 0.21
gi|33332347|gb|AAQ11380.1| hepatocyte nuclear factor 1 [Branchio... 39 0.21
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 39 0.21
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 39 0.21
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 39 0.21
gi|1513204|gb|AAC48703.1| involucrin 39 0.21
gi|50259690|gb|EAL22360.1| hypothetical protein CNBB5330 [Crypto... 39 0.21
gi|36956732|gb|AAQ87011.1| Jsd-like X-linked protein [Mus musculus] 39 0.21
gi|18652045|gb|AAL76931.1| chromogranin B [Rana ridibunda] 39 0.21
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 39 0.21
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 38 0.28
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 38 0.28
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 38 0.28
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 38 0.28
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 38 0.28
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 38 0.28
gi|39596301|emb|CAE69939.1| Hypothetical protein CBG16321 [Caeno... 38 0.28
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 38 0.28
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen... 38 0.28
gi|34868438|ref|XP_232942.2| similar to RIKEN cDNA 2610207I16 [R... 38 0.28
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 38 0.28
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 38 0.28
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 38 0.28
gi|21956190|gb|AAM83255.1| ARC105 [Xenopus laevis] 38 0.28
gi|4104929|gb|AAD02218.1| auxin response factor 7 [Arabidopsis t... 38 0.28
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi... 38 0.28
gi|42734056|gb|AAS38928.1| similar to Dictyostelium discoideum (... 38 0.28
gi|32418608|ref|XP_329782.1| hypothetical protein [Neurospora cr... 38 0.28
gi|50260271|gb|EAL22930.1| hypothetical protein CNBA6990 [Crypto... 38 0.28
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 38 0.36
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (... 38 0.36
gi|6678922|ref|NP_032646.1| macrophage activation 2; guanylate-b... 38 0.36
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 38 0.36
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 38 0.36
gi|24641054|ref|NP_572640.1| CG9817-PA [Drosophila melanogaster]... 38 0.36
gi|28571881|ref|NP_651342.2| CG11848-PA [Drosophila melanogaster... 38 0.36
gi|20151461|gb|AAM11090.1| GH28553p [Drosophila melanogaster] 38 0.36
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 38 0.36
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 38 0.36
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus] 38 0.36
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 38 0.36
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 37 0.47
gi|50545996|ref|XP_500535.1| hypothetical protein [Yarrowia lipo... 37 0.47
gi|20502826|gb|AAM22643.1| cGMP-dependent protein kinase [Eimeri... 37 0.47
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 37 0.47
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 37 0.47
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 37 0.47
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 37 0.47
gi|2565054|gb|AAB91438.1| CAGH26 [Homo sapiens] 37 0.47
gi|39586913|emb|CAE62848.1| Hypothetical protein CBG07027 [Caeno... 37 0.47
gi|416785|sp|Q01522|CF23_DROME Chorion transcription factor Cf2,... 37 0.47
gi|542553|pir||C36901 chorion transcription factor CF2-III (alte... 37 0.47
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 37 0.47
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 37 0.47
gi|2429350|gb|AAB70921.1| NE-rich protein [Plasmodium chabaudi c... 37 0.47
gi|542552|pir||B36901 chorion transcription factor CF2-II (alter... 37 0.47
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 37 0.47
gi|17507949|ref|NP_491960.1| putative protein, with a coiled coi... 37 0.47
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 37 0.47
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 37 0.47
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 37 0.47
gi|28850455|gb|AAO53219.1| similar to Plasmodium falciparum (iso... 37 0.47
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel... 37 0.47
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 37 0.47
gi|21702733|ref|NP_065898.1| trinucleotide repeat containing 6; ... 37 0.47
gi|542551|pir||A36901 chorion transcription factor CF2-I (altern... 37 0.47
gi|416786|sp|P20385|CF2_DROME Chorion transcription factor Cf2, ... 37 0.47
gi|290214|gb|AAA28395.1| DNA-binding protein isoform II 37 0.47
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 37 0.47
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster... 37 0.47
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ... 37 0.47
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 37 0.47
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 37 0.62
gi|37626197|gb|AAQ96572.1| hypothetical protein [Vibrio parahaem... 37 0.62
gi|15425633|dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glyc... 37 0.62
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 37 0.62
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g... 37 0.62
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 37 0.62
gi|45549144|ref|NP_523422.3| CG1676-PA [Drosophila melanogaster]... 37 0.62
gi|50510433|dbj|BAD32202.1| mKIAA0266 protein [Mus musculus] 37 0.62
gi|23599203|ref|XP_135857.2| RIKEN cDNA 2700066J21 [Mus musculus] 37 0.62
gi|41055634|ref|NP_957240.1| similar to crooked neck protein [Da... 37 0.62
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 37 0.62
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 37 0.62
gi|47123917|gb|AAH70536.1| ARC105 protein [Xenopus laevis] 37 0.81
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 37 0.81
gi|24954594|gb|AAN64683.1| M protein [Streptococcus pyogenes] 37 0.81
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 37 0.81
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 37 0.81
gi|15232576|ref|NP_188159.1| anther development protein, putativ... 37 0.81
gi|2565048|gb|AAB91435.1| CAGF9 [Homo sapiens] 37 0.81
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 37 0.81
gi|45553499|ref|NP_996286.1| CG5794-PD [Drosophila melanogaster]... 37 0.81
gi|14669814|dbj|BAB62017.1| DCAPL1 [Drosophila melanogaster] 37 0.81
gi|24652386|ref|NP_610571.2| CG18408-PA [Drosophila melanogaster... 37 0.81
gi|3037135|gb|AAC12944.1| TPA inducible protein [Homo sapiens] 37 0.81
gi|29747039|ref|XP_049037.7| trinucleotide repeat containing 9 [... 37 0.81
gi|2708813|gb|AAC50042.1| ATA20 [Arabidopsis thaliana] 37 0.81
gi|11078661|gb|AAG29138.1| Ras guanine nucleotide exchange facto... 37 0.81
gi|24286634|gb|AAN46871.1| nucleotide exchange factor RasGEF B [... 37 0.81
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 37 0.81
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 37 0.81
gi|27734440|sp|Q96RN5|PCAP_HUMAN Positive cofactor 2 glutamine/Q... 37 0.81
gi|23270751|gb|AAH17110.1| PCQAP protein [Homo sapiens] 37 0.81
gi|45708378|gb|AAH03078.1| Unknown (protein for IMAGE:3504608) [... 37 0.81
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 37 0.81
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 37 0.81
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 37 0.81
gi|14276857|gb|AAK58423.1| PC2-glutamine-rich-associated protein... 37 0.81
gi|21312134|ref|NP_056973.2| positive cofactor 2, glutamine/Q-ri... 37 0.81
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 37 0.81
gi|28379279|ref|NP_786171.1| cell surface protein precursor [Lac... 37 0.81
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei... 37 0.81
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 37 0.81
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 37 0.81
gi|24649733|ref|NP_733022.1| CG5794-PB [Drosophila melanogaster]... 37 0.81
gi|50555071|ref|XP_504944.1| hypothetical protein [Yarrowia lipo... 37 0.81
gi|41191873|ref|XP_372978.1| similar to ENSANGP00000007346 [Homo... 36 1.1
gi|32451779|gb|AAH54779.1| Pcqap protein [Mus musculus] 36 1.1
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 36 1.1
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops... 36 1.1
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 36 1.1
gi|17137794|ref|NP_477504.1| CG9280-PA [Drosophila melanogaster]... 36 1.1
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 36 1.1
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 36 1.1
gi|42734053|gb|AAS38925.1| hypothetical protein [Dictyostelium d... 36 1.1
gi|28850298|gb|AAM45327.2| similar to Plasmodium falciparum. Hyp... 36 1.1
gi|47115570|sp|O00841|CUDA_DICDI Putative transcriptional regula... 36 1.1
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera] 36 1.1
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 36 1.1
gi|11345232|gb|AAG34654.1| involucrin [Mus musculus] 36 1.1
gi|49078472|ref|XP_402985.1| hypothetical protein UM05370.1 [Ust... 36 1.1
gi|41052654|dbj|BAD07502.1| hypothetical protein [Oryza sativa (... 36 1.1
gi|38109728|gb|EAA55553.1| hypothetical protein MG01204.4 [Magna... 36 1.1
gi|7484702|pir||T10738 hypothetical protein FbLate-2 - sea-islan... 36 1.1
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 36 1.1
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485... 36 1.1
gi|28828411|gb|AAL96711.2| similar to Arabidopsis thaliana (Mous... 36 1.1
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 36 1.1
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 36 1.1
gi|47564442|ref|ZP_00235487.1| putative surface/cell-adhesion pr... 36 1.1
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 36 1.4
gi|1663694|dbj|BAA12112.1| Product has a CAG repeat region simil... 36 1.4
gi|30145821|emb|CAD89753.1| Hypothetical protein Y67H2A.10 [Caen... 36 1.4
gi|48099454|ref|XP_397543.1| hypothetical protein XP_397543 [Api... 36 1.4
gi|2565059|gb|AAB91440.1| CAGH45 [Homo sapiens] 36 1.4
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (... 36 1.4
gi|4827042|ref|NP_005111.1| trinucleotide repeat containing 11 (... 36 1.4
gi|33354107|dbj|BAC81137.1| TNRC11 [Homo sapiens] 36 1.4
gi|30705097|gb|AAH52044.1| Hypothetical protein C230068E13 [Mus ... 36 1.4
gi|33354109|dbj|BAC81138.1| TNRC11 [Pan troglodytes] 36 1.4
gi|27370402|ref|NP_766501.1| hypothetical protein C230068E13 [Mu... 36 1.4
gi|5524203|gb|AAD44162.1| OPA-containing protein [Homo sapiens] 36 1.4
gi|3426320|gb|AAC83163.1| OPA-containing protein [Homo sapiens] 36 1.4
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 36 1.4
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 36 1.4
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 36 1.4
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr... 36 1.4
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ... 36 1.4
gi|32408943|ref|XP_324952.1| hypothetical protein [Neurospora cr... 36 1.4
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 36 1.4
gi|24660458|ref|NP_729301.1| CG17888-PD [Drosophila melanogaster... 35 1.8
gi|46441609|gb|EAL00905.1| hypothetical protein CaO19.14090 [Can... 35 1.8
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 35 1.8
gi|4566516|gb|AAD23383.1| gamete-specific homeodomain protein GS... 35 1.8
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 35 1.8
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 35 1.8
gi|38107659|gb|EAA53803.1| hypothetical protein MG09553.4 [Magna... 35 1.8
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 35 1.8
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 35 1.8
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]... 35 1.8
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 35 1.8
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 35 1.8
gi|32422843|ref|XP_331865.1| hypothetical protein [Neurospora cr... 35 1.8
gi|28829248|gb|AAM08764.2| similar to Plasmodium falciparum (iso... 35 1.8
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 35 1.8
gi|38567183|emb|CAE76476.1| related to zinc finger protein crol ... 35 1.8
gi|7335658|gb|AAC27083.2| M protein [Streptococcus pyogenes] 35 1.8
gi|15612924|ref|NP_241227.1| BH0361~unknown [Bacillus halodurans... 35 1.8
gi|91094|pir||A26892 Mopa box protein - mouse (fragment) >gnl|BL... 35 1.8
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 35 1.8
gi|50308049|ref|XP_454025.1| unnamed protein product [Kluyveromy... 35 1.8
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 35 2.3
gi|42733860|gb|AAS38778.1| similar to exonuclease ii [Schizosacc... 35 2.3
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 35 2.3
gi|24639800|ref|NP_726971.1| CG6824-PB [Drosophila melanogaster]... 35 2.3
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 35 2.3
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 35 2.3
gi|32420907|ref|XP_330897.1| predicted protein [Neurospora crass... 35 2.3
gi|21425693|emb|CAD23206.1| shavenbaby [Drosophila melanogaster] 35 2.3
gi|24584069|ref|NP_723801.1| CG6043-PA [Drosophila melanogaster]... 35 2.3
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 35 2.3
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 35 2.3
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 35 2.3
gi|129260|sp|P10451|OSTP_HUMAN Osteopontin precursor (Bone sialo... 35 2.3
gi|992948|dbj|BAA05949.1| OPN-a [Homo sapiens] 35 2.3
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi... 35 2.3
gi|50305031|ref|XP_452473.1| unnamed protein product [Kluyveromy... 35 2.3
gi|13878207|ref|NP_113559.1| testis expressed gene 16 [Mus muscu... 35 2.3
gi|24584067|ref|NP_609629.1| CG6043-PD [Drosophila melanogaster]... 35 2.3
gi|3617817|emb|CAA12197.1| SRF related protein [Dictyostelium di... 35 2.3
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 35 2.3
gi|34849874|gb|AAH57119.1| Tnrc11 protein [Mus musculus] 35 2.3
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna... 35 2.3
gi|34784300|gb|AAH57085.1| Unknown (protein for MGC:67526) [Mus ... 35 2.3
gi|4456074|emb|CAB36921.1| ovo protein [Drosophila melanogaster] 35 2.3
gi|1709507|sp|P51521|OVO_DROME Ovo protein (Shaven baby protein)... 35 2.3
gi|50290087|ref|XP_447475.1| unnamed protein product [Candida gl... 35 2.3
gi|45185342|ref|NP_983059.1| ABR112Cp [Eremothecium gossypii] >g... 35 2.3
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 35 2.3
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa... 35 2.3
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo... 35 2.3
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 35 2.3
gi|24639804|ref|NP_525077.2| CG6824-PA [Drosophila melanogaster]... 35 2.3
gi|103290|pir||S16356 ovo protein - fruit fly (Drosophila melano... 35 2.3
gi|21711749|gb|AAM75065.1| RE28238p [Drosophila melanogaster] 35 2.3
gi|24584075|ref|NP_723804.1| CG6043-PC [Drosophila melanogaster]... 35 2.3
gi|33468967|ref|NP_067496.1| trinucleotide repeat containing 11 ... 35 2.3
gi|18857871|emb|CAD23207.1| ovoA protein [Drosophila melanogaster] 35 2.3
gi|24639802|ref|NP_726972.1| CG6824-PC [Drosophila melanogaster]... 35 2.3
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 35 2.3
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass... 35 2.3
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su... 35 2.3
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 35 2.3
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 35 2.3
gi|27819785|gb|AAO24941.1| RE65015p [Drosophila melanogaster] 35 2.3
gi|39597865|emb|CAE68557.1| Hypothetical protein CBG14390 [Caeno... 35 2.3
gi|49074246|ref|XP_401271.1| hypothetical protein UM03656.1 [Ust... 35 2.3
>gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD)
(col-77) [Caenorhabditis elegans]
gi|7506088|pir||T23801 hypothetical protein M195.1 - Caenorhabditis
elegans
gi|3878726|emb|CAA91290.1| Hypothetical protein M195.1
[Caenorhabditis elegans]
Length = 304
Score = 205 bits (522), Expect = 1e-51
Identities = 112/160 (70%), Positives = 112/160 (70%)
Frame = -1
Query: 915 MYQQDEKKLMQEAEGLRKIAFFGICISTVATLTAIVAIPSLYNYMQTVQSTLQTEVDFCV 736
MYQQDEKKLMQEAEGLRKIAFFGICISTVATLTAIVAIPSLYNYMQTVQSTLQTEVDFCV
Sbjct: 1 MYQQDEKKLMQEAEGLRKIAFFGICISTVATLTAIVAIPSLYNYMQTVQSTLQTEVDFCV 60
Query: 735 HRTNGLFEQYERIKGVKKLVKRQAGYGAPAEYSTDXXXXXXXXXXXXXXXXXXXXXXXXX 556
HRTNGLFEQYERIKGVKKLVKRQAGYGAPAEYSTD
Sbjct: 61 HRTNGLFEQYERIKGVKKLVKRQAGYGAPAEYSTDAAVSAGGSEAGGQCCSCGSGPAGPP 120
Query: 555 XXXGEXXXXXXXXXXXXXXXXXXXXPAEAIPTADDFCFDC 436
GE PAEAIPTADDFCFDC
Sbjct: 121 GTPGEDGRDGNDGQPGPDGQPGSDAPAEAIPTADDFCFDC 160
Score = 38.1 bits (87), Expect = 0.28
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1
Query: 42 CDHCPPPRTAPGY 4
CDHCPPPRTAPGY
Sbjct: 292 CDHCPPPRTAPGY 304