Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M28_8
(1296 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535191|ref|NP_496299.1| esterase A precursor family member ... 823 0.0
gi|39597399|emb|CAE59629.1| Hypothetical protein CBG03042 [Caeno... 759 0.0
gi|17538001|ref|NP_496176.1| esterase A family member (52.5 kD) ... 334 2e-90
gi|39587804|emb|CAE67822.1| Hypothetical protein CBG13402 [Caeno... 330 6e-89
gi|39587165|emb|CAE57633.1| Hypothetical protein CBG00618 [Caeno... 327 3e-88
gi|17535177|ref|NP_495790.1| carboxylesterase family member (49.... 327 3e-88
gi|17532285|ref|NP_494863.1| carboxylesterase family member (2F1... 270 5e-71
gi|17538474|ref|NP_503109.1| esterase III family member (48.8 kD... 270 5e-71
gi|39585207|emb|CAE57450.1| Hypothetical protein CBG00413 [Caeno... 259 1e-67
gi|39591148|emb|CAE73201.1| Hypothetical protein CBG20604 [Caeno... 259 1e-67
gi|3649751|emb|CAA78842.1| esterase A [Streptomyces chrysomallus] 181 3e-44
gi|28871261|ref|NP_793880.1| carboxylesterase [Pseudomonas syrin... 180 7e-44
gi|46187963|ref|ZP_00126504.2| COG1680: Beta-lactamase class C a... 178 2e-43
gi|48732845|ref|ZP_00266588.1| COG1680: Beta-lactamase class C a... 175 2e-42
gi|348403|pir||A44832 esterase estA - Pseudomonas sp >gnl|BL_ORD... 172 2e-41
gi|16209565|gb|AAL14234.1| lactone hydrolase [Rhodococcus ruber] 170 6e-41
gi|26987863|ref|NP_743288.1| carboxylesterase [Pseudomonas putid... 170 6e-41
gi|23104094|ref|ZP_00090564.1| COG1680: Beta-lactamase class C a... 169 2e-40
gi|29827845|ref|NP_822479.1| putative esterase A [Streptomyces a... 168 2e-40
gi|740927|prf||2006221A carboxylesterase 167 5e-40
gi|540968|pir||JC2091 carboxylesterase (EC 3.1.1.1) - Pseudomona... 167 5e-40
gi|15596244|ref|NP_249738.1| probable esterase [Pseudomonas aeru... 166 9e-40
gi|21221599|ref|NP_627378.1| putative esterase [Streptomyces coe... 166 9e-40
gi|41408381|ref|NP_961217.1| LipP [Mycobacterium avium subsp. pa... 164 6e-39
gi|29830154|ref|NP_824788.1| putative esterase [Streptomyces ave... 164 6e-39
gi|13475683|ref|NP_107250.1| esterase [Mesorhizobium loti MAFF30... 163 9e-39
gi|46102640|ref|XP_380200.1| hypothetical protein FG00024.1 [Gib... 160 5e-38
gi|16124510|ref|NP_419074.1| esterase A [Caulobacter crescentus ... 160 6e-38
gi|49104174|ref|XP_411222.1| hypothetical protein AN7085.2 [Aspe... 159 2e-37
gi|34610389|gb|AAB37025.2| Hypothetical protein F46H5.8 [Caenorh... 154 3e-36
gi|15609600|ref|NP_216979.1| lipP [Mycobacterium tuberculosis H3... 154 3e-36
gi|49125425|ref|XP_412665.1| hypothetical protein AN8528.2 [Aspe... 154 6e-36
gi|32041047|ref|ZP_00138630.1| COG1680: Beta-lactamase class C a... 150 6e-35
gi|18478336|gb|AAL73134.1| carboxylesterase [Pseudomonas fluores... 148 3e-34
gi|6624956|emb|CAB63910.1| Esterase STE1 [Metarhizium anisopliae... 143 8e-33
gi|48928124|gb|AAT47740.1| esterase [Mycobacterium avium] 130 5e-29
gi|15841395|ref|NP_336432.1| esterase, putative [Mycobacterium t... 130 9e-29
gi|15609060|ref|NP_216439.1| lipD [Mycobacterium tuberculosis H3... 130 9e-29
gi|41407326|ref|NP_960162.1| LipL [Mycobacterium avium subsp. pa... 129 1e-28
gi|31793115|ref|NP_855608.1| PROBABLE LIPASE LIPD [Mycobacterium... 127 4e-28
gi|15840960|ref|NP_335997.1| esterase [Mycobacterium tuberculosi... 123 1e-26
gi|15608635|ref|NP_216013.1| lipL [Mycobacterium tuberculosis H3... 123 1e-26
gi|21218874|ref|NP_624653.1| putative esterase [Streptomyces coe... 118 3e-25
gi|50085111|ref|YP_046621.1| conserved hypothetical protein; put... 110 9e-23
gi|32398350|emb|CAD61039.1| unnamed protein product [Arthrobacte... 105 2e-21
gi|348008|gb|AAA99492.1| carboxylic ester hydrolase 103 7e-21
gi|18420844|ref|NP_568458.1| ABC1 family protein [Arabidopsis th... 99 2e-19
gi|15081731|gb|AAK82520.1| AT5g24810/F6A4_20 [Arabidopsis thaliana] 96 1e-18
gi|4731333|gb|AAD28450.1| unknown [Streptomyces lavendulae] 89 2e-16
gi|46227262|gb|EAK88212.1| conserved possible esterase of the be... 79 2e-13
gi|50083656|ref|YP_045166.1| putative beta-lactamase [Acinetobac... 79 3e-13
gi|41406346|ref|NP_959182.1| LipE [Mycobacterium avium subsp. pa... 70 1e-10
gi|23098122|ref|NP_691588.1| beta-lactamase [Oceanobacillus ihey... 68 5e-10
gi|41689542|ref|ZP_00146075.1| COG1680: Beta-lactamase class C a... 65 3e-09
gi|15610911|ref|NP_218292.1| lipE [Mycobacterium tuberculosis H3... 65 3e-09
gi|1502425|gb|AAB06505.1| esterase [Mycobacterium tuberculosis] 65 3e-09
gi|46204780|ref|ZP_00049498.2| COG1680: Beta-lactamase class C a... 63 1e-08
gi|15826952|ref|NP_301215.1| probable hydrolase [Mycobacterium l... 62 4e-08
gi|32471513|ref|NP_864506.1| putative esterase [Pirellula sp. 1]... 61 5e-08
gi|30962005|gb|AAP40275.1| AmpC [Erwinia rhapontici] 59 2e-07
gi|46106640|ref|ZP_00187566.2| COG1680: Beta-lactamase class C a... 59 3e-07
gi|39934678|ref|NP_946954.1| Beta-lactamase [Rhodopseudomonas pa... 59 3e-07
gi|50752815|ref|XP_413759.1| PREDICTED: similar to serine beta l... 56 2e-06
gi|30021328|ref|NP_832959.1| Penicillin-binding protein [Bacillu... 56 2e-06
gi|17567799|ref|NP_509221.1| beta-lactamase family member (XH876... 56 2e-06
gi|14719674|pdb|1I5Q|A Chain A, Crystal Structure Of The E. Coli... 55 3e-06
gi|47225815|emb|CAF98295.1| unnamed protein product [Tetraodon n... 55 4e-06
gi|41409260|ref|NP_962096.1| hypothetical protein MAP3162c [Myco... 55 4e-06
gi|44194086|gb|AAS46849.1| extended-spectrum ampC beta-lactamase... 55 5e-06
gi|42519919|gb|AAS07017.2| class C beta-lactamase SRT-2 [Serrati... 55 5e-06
gi|49478085|ref|YP_037320.1| beta-lactamase [Bacillus thuringien... 55 5e-06
gi|46131374|ref|ZP_00169545.2| COG1680: Beta-lactamase class C a... 55 5e-06
gi|39586820|emb|CAE65863.1| Hypothetical protein CBG11006 [Caeno... 55 5e-06
gi|47564375|ref|ZP_00235420.1| beta-lactamase [Bacillus cereus G... 54 6e-06
gi|2575874|dbj|BAA23131.1| SST-1 [Serratia marcescens] 54 6e-06
gi|46321968|ref|ZP_00222341.1| COG1680: Beta-lactamase class C a... 54 8e-06
gi|46798946|emb|CAG27338.1| beta-lactamase [Serratia marcescens] 54 8e-06
gi|6759593|emb|CAB69829.1| class C beta-lactamase [Serratia marc... 54 1e-05
gi|4691716|gb|AAD28041.1| beta-lactamase precursor [Escherichia ... 54 1e-05
gi|46276335|gb|AAS86426.1| beta-lactamase [Escherichia coli] 53 1e-05
gi|37718709|dbj|BAC99094.1| beta-lactamase [Escherichia coli] 53 1e-05
gi|37222640|gb|AAQ90024.1| expanded spectrum beta-lactamase [Ser... 53 1e-05
gi|2575872|dbj|BAA23130.1| SRT-1 [Serratia marcescens] 53 1e-05
gi|13195447|gb|AAK15701.1| class C beta-lactamase [Serratia marc... 53 1e-05
gi|26251046|ref|NP_757086.1| Beta-lactamase precursor [Escherich... 53 1e-05
gi|1168442|sp|P45460|AMPC_YEREN Beta-lactamase precursor (Cephal... 53 1e-05
gi|24115509|ref|NP_710019.1| beta-lactamase; penicillin resistan... 53 1e-05
gi|3660293|pdb|2BLS|A Chain A, Ampc Beta-Lactamase From Escheric... 53 1e-05
gi|13787067|pdb|1FSW|A Chain A, Ampc Beta-Lactamase From E. Coli... 53 1e-05
gi|46015207|pdb|1PI4|A Chain A, Structure Of N289a Mutant Of Amp... 53 1e-05
gi|23200306|pdb|1L0F|A Chain A, X-Ray Crystal Structure Of Ampc ... 53 1e-05
gi|15804744|ref|NP_290785.1| beta-lactamase; penicillin resistan... 53 1e-05
gi|30065527|ref|NP_839698.1| beta-lactamase [Shigella flexneri 2... 53 1e-05
gi|4691720|gb|AAD28043.1| beta-lactamase precursor [Escherichia ... 53 1e-05
gi|16131975|ref|NP_418574.1| beta-lactamase; penicillin resistan... 53 1e-05
gi|39935217|ref|NP_947493.1| Beta-lactamase [Rhodopseudomonas pa... 53 2e-05
gi|27380820|ref|NP_772349.1| bll5709 [Bradyrhizobium japonicum U... 53 2e-05
gi|42781634|ref|NP_978881.1| fmtA-like protein, putative [Bacill... 53 2e-05
gi|13195449|gb|AAK15702.1| class C beta-lactamase [Serratia marc... 53 2e-05
gi|14517953|gb|AAK64454.1| beta-lactamase; AmpC [Serratia marces... 53 2e-05
gi|30022130|ref|NP_833761.1| Penicillin-binding protein [Bacillu... 52 2e-05
gi|49476726|ref|YP_034509.1| beta-lactamase [Bacillus thuringien... 52 2e-05
gi|20136445|gb|AAM11671.1| AmpC [Escherichia fergusonii] 52 2e-05
gi|21213049|emb|CAD32299.1| beta-lactamase precursor [Enterobact... 52 3e-05
gi|30020851|ref|NP_832482.1| Penicillin-binding protein [Bacillu... 52 3e-05
gi|47565925|ref|ZP_00236964.1| beta-lactamase [Bacillus cereus G... 52 3e-05
gi|4691718|gb|AAD28042.1| beta-lactamase precursor [Escherichia ... 52 4e-05
gi|20151084|pdb|1KVL|A Chain A, X-Ray Crystal Structure Of Ampc ... 52 4e-05
gi|23200302|pdb|1L0D|A Chain A, X-Ray Crystal Structure Of Ampc ... 52 4e-05
gi|23200304|pdb|1L0E|A Chain A, X-Ray Crystal Structure Of Ampc ... 52 4e-05
gi|26051231|ref|NP_116246.2| lactamase, beta isoform a; mitochon... 51 7e-05
gi|21225520|ref|NP_631299.1| putative secreted protein [Streptom... 51 7e-05
gi|26051233|ref|NP_741982.1| lactamase, beta isoform b; mitochon... 51 7e-05
gi|37182540|gb|AAQ89072.1| MRPL56 [Homo sapiens] 51 7e-05
gi|14042761|dbj|BAB55384.1| unnamed protein product [Homo sapiens] 51 7e-05
gi|44194091|gb|AAS46851.1| ampC beta-lactamase [Serratia marcesc... 50 9e-05
gi|15609059|ref|NP_216438.1| hypothetical protein Rv1922 [Mycoba... 50 9e-05
gi|17943441|pdb|1CI9|A Chain A, Dfp-Inhibited Esterase Estb From... 50 9e-05
gi|13507666|ref|NP_109642.1| lactamase, beta; serine beta lactam... 50 9e-05
gi|28374178|gb|AAH46293.1| Lactb protein [Mus musculus] 50 9e-05
gi|16799619|ref|NP_469887.1| similar to penicillin-binding prote... 50 9e-05
gi|12084422|pdb|1FCM|A Chain A, Crystal Structure Of The E.Coli ... 50 9e-05
gi|21213046|emb|CAD32298.1| beta-lactamase precursor [Enterobact... 50 1e-04
gi|34864295|ref|XP_217181.2| similar to serine beta lactamase-li... 50 2e-04
gi|21673163|ref|NP_661228.1| D-alanyl-D-alanine carboxypeptideas... 50 2e-04
gi|47564982|ref|ZP_00236026.1| fmtA-like protein, putative [Baci... 49 2e-04
gi|42783157|ref|NP_980404.1| beta-lactamase [Bacillus cereus ATC... 49 2e-04
gi|37039781|gb|AAQ88181.1| lipase [Micrococcus sp. HL-2003] 49 2e-04
gi|27379137|ref|NP_770666.1| blr4026 [Bradyrhizobium japonicum U... 49 2e-04
gi|27802501|gb|AAO21211.1| beta-lactamase [Yersinia aldovae] 49 3e-04
gi|49477052|ref|YP_035273.1| beta-lactamase [Bacillus thuringien... 49 3e-04
gi|47570164|ref|ZP_00240820.1| penicillin-binding protein [Bacil... 49 3e-04
gi|39584515|emb|CAE74593.1| Hypothetical protein CBG22374 [Caeno... 49 3e-04
gi|22213623|gb|AAM93471.1| beta-lactamase; AmpC [Citrobacter fre... 49 3e-04
gi|46317194|ref|ZP_00217772.1| COG1680: Beta-lactamase class C a... 49 3e-04
gi|48844302|ref|ZP_00298621.1| COG1680: Beta-lactamase class C a... 49 3e-04
gi|47574753|ref|ZP_00244789.1| COG1680: Beta-lactamase class C a... 48 4e-04
gi|15925431|ref|NP_372965.1| hypothetical protein SAV2441 [Staph... 48 4e-04
gi|27542962|gb|AAO16522.1| cephalosporinase AmpC [Enterobacter a... 48 4e-04
gi|227653|prf||1708210A beta lactamase 48 4e-04
gi|113729|sp|P18539|AMPC_SERMA Beta-lactamase precursor (Cephalo... 48 4e-04
gi|27542972|gb|AAO16527.1| cephalosporinase AmpC [Enterobacter a... 48 4e-04
gi|28375572|emb|CAD66516.1| AmpC beta-lactamase [Enterobacter ae... 48 4e-04
gi|27542968|gb|AAO16525.1| cephalosporinase AmpC [Enterobacter a... 48 4e-04
gi|28375570|emb|CAD66515.1| AmpC beta-lactamase [Enterobacter ae... 48 4e-04
gi|27542966|gb|AAO16524.1| cephalosporinase AmpC [Enterobacter a... 48 4e-04
gi|6601479|gb|AAF18992.1| beta-lactamase AmpC [Enterobacter aero... 48 4e-04
gi|21225869|ref|NP_631648.1| putative hydrolase [Streptomyces co... 48 4e-04
gi|15924047|ref|NP_371581.1| autolysis and methicillin resistant... 48 6e-04
gi|27542964|gb|AAO16523.1| cephalosporinase AmpC [Enterobacter a... 48 6e-04
gi|27542970|gb|AAO16526.1| cephalosporinase AmpC [Enterobacter a... 48 6e-04
gi|27542974|gb|AAO16528.1| cephalosporinase AmpC [Enterobacter a... 48 6e-04
gi|27542960|gb|AAO16521.1| cephalosporinase AmpC [Enterobacter a... 48 6e-04
gi|48850999|ref|ZP_00305241.1| COG1680: Beta-lactamase class C a... 48 6e-04
gi|48768396|ref|ZP_00272746.1| COG1680: Beta-lactamase class C a... 48 6e-04
gi|39936347|ref|NP_948623.1| possible penicillin binding protein... 47 8e-04
gi|49483221|ref|YP_040445.1| autolysis and methicillin resistant... 47 0.001
gi|46906785|ref|YP_013174.1| penicillin-binding protein, putativ... 47 0.001
gi|20135564|gb|AAM08944.1| beta-lactamase precursor [Pseudomonas... 47 0.001
gi|49487224|ref|YP_044445.1| putative exported protein [Staphylo... 47 0.001
gi|21284094|ref|NP_647182.1| ORFID:MW2365~hypothetical protein, ... 47 0.001
gi|40809678|emb|CAD32304.2| beta-lactamase precursor [Citrobacte... 47 0.001
gi|27377909|ref|NP_769438.1| bll2798 [Bradyrhizobium japonicum U... 47 0.001
gi|29827802|ref|NP_822436.1| putative beta-lactamase [Streptomyc... 47 0.001
gi|21401125|ref|NP_657110.1| hypothetical protein predicted by G... 47 0.001
gi|42781328|ref|NP_978575.1| conserved hypothetical protein [Bac... 46 0.002
gi|30020324|ref|NP_831955.1| Penicillin-binding protein [Bacillu... 46 0.002
gi|19919854|gb|AAM08410.1| cephalosporinase [Pseudomonas aerugin... 46 0.002
gi|20135560|gb|AAM08942.1| beta-lactamase precursor [Pseudomonas... 46 0.002
gi|47094774|ref|ZP_00232389.1| penicillin-binding protein, putat... 46 0.002
gi|16802583|ref|NP_464068.1| similar to penicillin-binding prote... 46 0.002
gi|15599305|ref|NP_252799.1| beta-lactamase precursor [Pseudomon... 46 0.002
gi|320125|pir||S13408 beta-lactamase (EC 3.5.2.6) precursor - Ps... 46 0.002
gi|1945683|emb|CAB08016.1| penicillin-binding protein [Bacillus ... 46 0.002
gi|49088514|gb|AAT51578.1| PA2315 [synthetic construct] 46 0.002
gi|48729894|ref|ZP_00263643.1| COG1680: Beta-lactamase class C a... 46 0.002
gi|15597511|ref|NP_251005.1| hypothetical protein [Pseudomonas a... 46 0.002
gi|16080497|ref|NP_391324.1| penicillin-binding protein 4* [Baci... 46 0.002
gi|32475497|ref|NP_868491.1| probable beta-lactamase [Pirellula ... 46 0.002
gi|628629|pir||S44094 beta-lactamase (EC 3.5.2.6) - Citrobacter ... 46 0.002
gi|46363805|ref|ZP_00226503.1| COG1680: Beta-lactamase class C a... 46 0.002
gi|15600735|ref|NP_254229.1| hypothetical protein [Pseudomonas a... 46 0.002
gi|20135562|gb|AAM08943.1| beta-lactamase precursor [Pseudomonas... 46 0.002
gi|13096564|pdb|1FR1|A Chain A, Refined Crystal Structure Of Bet... 46 0.002
gi|46313369|ref|ZP_00213959.1| COG1680: Beta-lactamase class C a... 46 0.002
gi|23104980|ref|ZP_00091438.1| COG1680: Beta-lactamase class C a... 46 0.002
gi|17543484|ref|NP_502657.1| lactamase beta (4O546) [Caenorhabdi... 46 0.002
gi|42782230|ref|NP_979477.1| beta-lactamase [Bacillus cereus ATC... 46 0.002
gi|22255882|gb|AAM94804.1| beta-lactamase [Yersinia ruckeri] 46 0.002
gi|20136434|gb|AAM11664.1| AmpC [Citrobacter murliniae] 46 0.002
gi|27380819|ref|NP_772348.1| bll5708 [Bradyrhizobium japonicum U... 46 0.002
gi|1389618|dbj|BAA12916.1| beta-lactamase [Citrobacter freundii] 46 0.002
gi|30314629|dbj|BAC76072.1| AmpC beta-lactamase CFE-1 [Escherich... 46 0.002
gi|49480116|ref|YP_034766.1| beta-lactamase (penicillin-binding ... 45 0.003
gi|46164820|ref|ZP_00205195.1| COG1680: Beta-lactamase class C a... 45 0.003
gi|48870670|ref|ZP_00323390.1| COG1680: Beta-lactamase class C a... 45 0.003
gi|49484658|ref|YP_041882.1| putative exported protein [Staphylo... 45 0.003
gi|47092805|ref|ZP_00230589.1| penicillin-binding protein, putat... 45 0.003
gi|9246437|gb|AAF86053.1| fmtA-like protein [Staphylococcus aureus] 45 0.003
gi|30021593|ref|NP_833224.1| Penicillin-binding protein [Bacillu... 45 0.003
gi|21243533|ref|NP_643115.1| beta-lactamase [Xanthomonas axonopo... 45 0.004
gi|15807882|ref|NP_285541.1| conserved hypothetical protein [Dei... 45 0.004
gi|13605348|gb|AAK32688.1| class C beta-lactamase [Citrobacter f... 45 0.004
gi|13605346|gb|AAK32687.1| class C beta-lactamase [Citrobacter f... 45 0.004
gi|40287460|gb|AAQ16660.2| CMY-13 [Escherichia coli] 45 0.004
gi|20136440|gb|AAM11668.1| AmpC [Citrobacter braakii] 45 0.004
gi|49477560|ref|YP_036347.1| penicillin-binding protein [Bacillu... 45 0.005
gi|32477786|ref|NP_870780.1| conserved hypothetical protein-puta... 45 0.005
gi|32039288|ref|ZP_00137560.1| COG1680: Beta-lactamase class C a... 45 0.005
gi|16127858|ref|NP_422422.1| conserved hypothetical protein [Cau... 45 0.005
gi|16264788|ref|NP_437580.1| putative exported beta-lactamase pr... 45 0.005
gi|4731343|gb|AAD28460.1| MitL [Streptomyces lavendulae] 45 0.005
gi|9294834|gb|AAF86700.1| AMPC cephalosporinase precursor protei... 45 0.005
gi|27468925|ref|NP_765562.1| beta-lactamase [Staphylococcus epid... 45 0.005
gi|30018689|ref|NP_830320.1| Penicillin-binding protein [Bacillu... 45 0.005
gi|2569957|emb|CAA75401.1| beta lactamase class C [Citrobacter f... 45 0.005
gi|78234|pir||S08296 beta-lactamase (EC 3.5.2.6) precursor - Cit... 45 0.005
gi|548461|sp|Q06317|PBP4_NOCLA Penicillin-binding protein 4 (PBP... 45 0.005
gi|216403|dbj|BAA02494.1| beta-lactamase precursor [Citrobacter ... 45 0.005
gi|47168782|pdb|1RGY|A Chain A, Citrobacter Freundii Gn346 Class... 45 0.005
gi|21400114|ref|NP_656099.1| hypothetical protein predicted by G... 44 0.006
gi|39997145|ref|NP_953096.1| conserved hypothetical protein [Geo... 44 0.006
gi|25004792|emb|CAD56688.1| PbpX protein [Bacillus amyloliquefac... 44 0.006
gi|5419925|emb|CAB46491.1| AmpC beta-lactamase ACC-1 [Klebsiella... 44 0.006
gi|29841350|gb|AAP06382.1| hypothetical protein [Schistosoma jap... 44 0.006
gi|47567267|ref|ZP_00237981.1| penicillin-binding protein, putat... 44 0.006
gi|9294822|gb|AAF86694.1| AMPC cephalosporinase precursor protei... 44 0.006
gi|6225052|sp|O69773|AMPC_PROST Beta-lactamase precursor (Cephal... 44 0.006
gi|9294818|gb|AAF86692.1| AMPC cephalosporinase precursor protei... 44 0.006
gi|9294830|gb|AAF86698.1| AMPC cephalosporinase precursor protei... 44 0.006
gi|6225053|sp|O05465|AMPC_PSYIM Beta-lactamase precursor (Cephal... 44 0.006
gi|30021297|ref|NP_832928.1| Penicillin-binding protein [Bacillu... 44 0.006
gi|23100815|ref|NP_694282.1| hypothetical protein OB3360 [Oceano... 44 0.006
gi|14520356|ref|NP_125831.1| hypothetical beta-lactamase precurs... 44 0.008
gi|16200253|emb|CAC94553.1| class C beta-lactamase [Buttiauxella... 44 0.008
gi|9294826|gb|AAF86696.1| AMPC cephalosporinase precursor protei... 44 0.008
gi|5514768|emb|CAB50867.1| beta-lactamase CMY-5 [Klebsiella oxyt... 44 0.008
gi|49183501|ref|YP_026753.1| penicillin-binding protein, putativ... 44 0.011
gi|21398447|ref|NP_654432.1| hypothetical protein predicted by G... 44 0.011
gi|15599543|ref|NP_253037.1| hypothetical protein [Pseudomonas a... 44 0.011
gi|9294824|gb|AAF86695.1| AMPC cephalosporinase precursor protei... 44 0.011
gi|21401419|ref|NP_657404.1| hypothetical protein predicted by G... 44 0.011
gi|21232067|ref|NP_637984.1| beta-lactamase [Xanthomonas campest... 43 0.014
gi|27380652|ref|NP_772181.1| blr5541 [Bradyrhizobium japonicum U... 43 0.014
gi|42779635|ref|NP_976882.1| penicillin-binding protein, putativ... 43 0.014
gi|21224952|ref|NP_630731.1| conserved hypothetical protein SC5A... 43 0.014
gi|50365417|ref|YP_053842.1| putative beta-lactamase [Mesoplasma... 43 0.014
gi|48473849|emb|CAG34070.1| class C beta-lactamase [Citrobacter ... 43 0.014
gi|113725|sp|P05193|AMPC_CITFR Beta-lactamase precursor (Cephalo... 43 0.014
gi|20136443|gb|AAM11670.1| AmpC [Citrobacter werkmanii] 43 0.014
gi|14590084|ref|NP_142148.1| hypothetical protein PH0142 [Pyroco... 43 0.014
gi|23104937|ref|ZP_00091397.1| COG1680: Beta-lactamase class C a... 43 0.019
gi|40641656|emb|CAF04085.1| beta-lactamase precursor [Morganella... 43 0.019
gi|20806757|ref|NP_621928.1| Beta-lactamase class C and other pe... 43 0.019
gi|48772571|ref|ZP_00276913.1| COG1680: Beta-lactamase class C a... 43 0.019
gi|2959390|emb|CAA76382.1| beta-lactamase class C [Proteus mirab... 43 0.019
gi|23127421|ref|ZP_00109292.1| COG1680: Beta-lactamase class C a... 43 0.019
gi|46126743|ref|XP_387925.1| hypothetical protein FG07749.1 [Gib... 43 0.019
gi|13591815|gb|AAK31368.1| extended-spectrum beta-lactamase prec... 42 0.024
gi|1524113|emb|CAA63264.1| ES-beta-lactamase [Klebsiella pneumon... 42 0.024
gi|13591819|gb|AAK31370.1| extended-spectrum beta-lactamase prec... 42 0.024
gi|17227649|ref|NP_484197.1| penicillin-binding protein [Nostoc ... 42 0.024
gi|18313926|ref|NP_560593.1| beta-lactamase-like protein [Pyroba... 42 0.024
gi|16078758|ref|NP_389577.1| penicillin-binding protein [Bacillu... 42 0.024
gi|41019334|gb|AAR98572.1| beta-lactamase [Escherichia coli] 42 0.024
gi|18376597|emb|CAC85357.1| beta-lactamase [Enterobacter hormaec... 42 0.024
gi|4456089|emb|CAB36902.1| beta-lactamase [Escherichia coli] 42 0.024
gi|2598417|emb|CAA75611.1| beta-lactamase LAT-4 protein [Escheri... 42 0.024
gi|46357594|emb|CAD88479.1| ampC-type beta-lactamase [Proteus mi... 42 0.024
gi|46357592|emb|CAD88477.1| ampC-type beta-lactamase [Proteus mi... 42 0.024
gi|1212998|emb|CAA62957.1| extended spectrum beta-lactamase [Kle... 42 0.024
gi|42357703|gb|AAS13399.1| beta-lactamase [Escherichia coli] 42 0.024
gi|1359903|emb|CAA65752.1| LAT-2 b-lactamase [Klebsiella pneumon... 42 0.024
gi|2570065|emb|CAA75402.1| beta-lactamase class C [Proteus mirab... 42 0.024
gi|2511454|gb|AAB80855.1| bla LAT-3 [Salmonella enterica subsp. ... 42 0.024
gi|4456085|emb|CAB36900.1| beta-lactamase [Escherichia coli] >gn... 42 0.024
gi|628809|pir||S45109 beta-lactamase (EC 3.5.2.6) precursor - Kl... 42 0.024
gi|6952809|gb|AAD50818.2| AmpC-type class C beta-lactamase [Kleb... 42 0.032
gi|11761378|dbj|BAA02563.2| beta-lactamase [Klebsiella pneumoniae] 42 0.032
gi|26248304|ref|NP_754344.1| Hypothetical protein [Escherichia c... 42 0.032
gi|48845113|ref|ZP_00299401.1| COG1680: Beta-lactamase class C a... 42 0.032
gi|23307624|gb|AAN17791.1| AmpC [Buttiauxella agrestis] 42 0.032
gi|16266766|dbj|BAB69972.1| penicillin-binding protein homolog [... 42 0.032
gi|47564622|ref|ZP_00235667.1| beta-lactamase [Bacillus cereus G... 42 0.032
gi|481726|pir||S39196 beta-lactamase (EC 3.5.2.6) - Escherichia ... 42 0.032
gi|45547814|ref|ZP_00187855.1| COG1680: Beta-lactamase class C a... 42 0.032
gi|49479259|ref|YP_037586.1| possible beta-lactamase [Bacillus t... 42 0.032
gi|17046114|dbj|BAB72158.1| class C beta-lactamase [Escherichia ... 42 0.041
gi|11544707|emb|CAC17626.1| beta-lactamase class C [Ochrobactrum... 42 0.041
gi|11544709|emb|CAC17627.1| beta-lactamase class C [Ochrobactrum... 42 0.041
gi|9909831|emb|CAC04522.1| AmpC beta-lactamase class C [Ochrobac... 42 0.041
gi|11544703|emb|CAC17624.1| beta-lactamase class C [Ochrobactrum... 42 0.041
gi|16125815|ref|NP_420379.1| conserved hypothetical protein [Cau... 42 0.041
gi|21232304|ref|NP_638221.1| beta-lactamase [Xanthomonas campest... 42 0.041
gi|48782617|ref|ZP_00279123.1| COG1680: Beta-lactamase class C a... 41 0.054
gi|11544701|emb|CAC17623.1| beta-lactamase class C [Ochrobactrum... 41 0.054
gi|21225825|ref|NP_631604.1| putative esterase [Streptomyces coe... 41 0.054
gi|42782558|ref|NP_979805.1| penicillin-binding protein, putativ... 41 0.054
gi|4210926|gb|AAD12161.1| dipeptidil carboxypeptidase [Streptomy... 41 0.054
gi|5420303|emb|CAB37344.2| hypothetical protein [Streptomyces fr... 41 0.054
gi|42781358|ref|NP_978605.1| penicillin-binding protein, putativ... 41 0.071
gi|48727636|gb|AAT46120.1| beta-lactamase [Enterobacter cloacae] 41 0.071
gi|46140649|ref|ZP_00152258.2| COG1680: Beta-lactamase class C a... 41 0.071
gi|21401102|ref|NP_657087.1| beta-lactamase, Beta-lactamase [Bac... 41 0.071
gi|42561393|ref|NP_975844.1| CONSERVED HYPOTHETICAL PROTEIN [Myc... 41 0.071
gi|42561380|ref|NP_975831.1| CONSERVED HYPOTHETICAL PROTEIN [Myc... 41 0.071
gi|41971|emb|CAA30879.1| beta-lactamase precursor [Enterobacter ... 41 0.071
gi|3097069|emb|CAA06639.1| AmpC-type beta-lactamase [Enterobacte... 41 0.071
gi|67776|pir||PNKBM beta-lactamase (EC 3.5.2.6) precursor - Ente... 41 0.071
gi|9294816|gb|AAF86691.1| AMPC cephalosporinase ACC-2 [Hafnia al... 40 0.092
gi|1060878|dbj|BAA07922.1| class C beta-lactamase precursor [Ent... 40 0.092
gi|29832321|ref|NP_826955.1| putative esterase [Streptomyces ave... 40 0.092
gi|47168783|pdb|1RGZ|A Chain A, Enterobacter Cloacae Gc1 Class C... 40 0.092
gi|15896063|ref|NP_349412.1| Beta-lactamase class C domain (PBPX... 40 0.092
gi|7619811|dbj|BAA94704.1| D-Amino acid amidase [Ochrobactrum an... 40 0.092
gi|5822076|pdb|1GCE|A Chain A, Structure Of The Beta-Lactamase O... 40 0.092
gi|10178867|emb|CAC08444.1| class C beta-lactamase [Enterobacter... 40 0.092
gi|49477771|ref|YP_036679.1| conserved hypothetical protein, pos... 40 0.092
gi|2598415|emb|CAA75610.1| beta-lactamase LAT-3 protein [Escheri... 40 0.092
gi|15705879|gb|AAL05857.1| beta-lactamase AmpC precursor [Entero... 40 0.092
gi|22213626|gb|AAM93473.1| beta-lactamase; AmpC [Enterobacter cl... 40 0.092
gi|10178870|emb|CAC08446.1| class C beta-lactamase [Enterobacter... 40 0.092
gi|15705875|gb|AAL05855.1| beta-lactamase AmpC precursor [Entero... 40 0.092
gi|27802509|gb|AAO21212.1| beta-lactamase [Yersinia bercovieri] 40 0.12
gi|50842989|ref|YP_056216.1| putative 6-aminohexanoate-dimer hyd... 40 0.12
gi|48825710|ref|ZP_00286950.1| COG1680: Beta-lactamase class C a... 40 0.12
gi|34496765|ref|NP_900980.1| beta-lactamase [Chromobacterium vio... 40 0.12
gi|21243784|ref|NP_643366.1| beta-lactamase [Xanthomonas axonopo... 40 0.12
gi|11544699|emb|CAC17622.1| beta-lactamase class C [Ochrobactrum... 40 0.12
gi|67777|pir||PNKBQ beta-lactamase (EC 3.5.2.6) precursor - Ente... 40 0.12
gi|46015735|pdb|1S6R|A Chain A, 908r Class C Beta-Lactamase Boun... 40 0.12
gi|33241019|ref|NP_875961.1| Beta-lactamase class C and other pe... 40 0.16
gi|24379342|ref|NP_721297.1| putative penicillin-binding protein... 40 0.16
gi|15841192|ref|NP_336229.1| penicillin-binding protein 4 [Mycob... 40 0.16
gi|18376595|emb|CAC85359.1| beta-lactamase [Enterobacter dissolv... 40 0.16
gi|11544705|emb|CAC17625.1| beta-lactamase class C [Ochrobactrum... 40 0.16
gi|15608868|ref|NP_216246.1| hypothetical protein Rv1730c [Mycob... 40 0.16
gi|21220752|ref|NP_626531.1| possible secreted esterase [Strepto... 40 0.16
gi|33089940|gb|AAP93850.1| beta-lactamase [Enterobacter cloacae] 40 0.16
gi|17432186|emb|CAC85157.1| AmpC beta-lactamase [Enterobacter as... 40 0.16
gi|46315694|ref|ZP_00216275.1| COG1680: Beta-lactamase class C a... 39 0.21
gi|16125749|ref|NP_420313.1| conserved hypothetical protein [Cau... 39 0.21
gi|27380403|ref|NP_771932.1| blr5292 [Bradyrhizobium japonicum U... 39 0.21
gi|1345941|sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptida... 39 0.21
gi|1127200|pdb|3PTE| The Refined Crystallographic Structure Of ... 39 0.21
gi|28558952|ref|NP_788212.1| RC225 [Ruegeria sp. PR1b] >gnl|BL_O... 39 0.21
gi|46366167|ref|ZP_00191524.2| COG1680: Beta-lactamase class C a... 39 0.27
gi|29150698|gb|AAO64361.1| beta-lactamase [Yokenella regensburgei] 39 0.27
gi|46431530|gb|EAK91081.1| hypothetical protein CaO19.376 [Candi... 39 0.27
gi|46431548|gb|EAK91098.1| hypothetical protein CaO19.8008 [Cand... 39 0.27
gi|6724239|gb|AAF26905.1| unknown [Polyangium cellulosum] 39 0.27
gi|46366909|ref|ZP_00192227.3| COG1680: Beta-lactamase class C a... 39 0.27
gi|27382094|ref|NP_773623.1| blr6983 [Bradyrhizobium japonicum U... 39 0.27
gi|46314939|ref|ZP_00215523.1| COG1680: Beta-lactamase class C a... 39 0.35
gi|20806739|ref|NP_621910.1| Beta-lactamase class C and other pe... 39 0.35
gi|16801096|ref|NP_471364.1| similar to peptidase [Listeria inno... 39 0.35
gi|48848754|ref|ZP_00302999.1| COG1680: Beta-lactamase class C a... 39 0.35
gi|16127316|ref|NP_421880.1| conserved hypothetical protein [Cau... 39 0.35
gi|7258342|emb|CAB77444.1| beta-lactamase class C [Acinetobacter... 39 0.35
gi|38195949|gb|AAR13676.1| beta-lactamase [Acinetobacter baumannii] 39 0.35
gi|37524184|ref|NP_927528.1| hypothetical protein [Photorhabdus ... 39 0.35
gi|21400461|ref|NP_656446.1| hypothetical protein predicted by G... 39 0.35
gi|4827075|gb|AAC45086.2| beta-lactamase ACT-1 [Klebsiella pneum... 39 0.35
gi|39935876|ref|NP_948152.1| Beta-lactamase [Rhodopseudomonas pa... 39 0.35
gi|29828325|ref|NP_822959.1| hypothetical protein SAV1783 [Strep... 39 0.35
gi|47096499|ref|ZP_00234091.1| peptidase, putative [Listeria mon... 38 0.46
gi|50086547|ref|YP_048057.1| beta-lactamase class C [Acinetobact... 38 0.46
gi|27381951|ref|NP_773480.1| blr6840 [Bradyrhizobium japonicum U... 38 0.46
gi|38141539|emb|CAE53429.1| putative alkaline D-stereospecific e... 38 0.46
gi|30262645|ref|NP_845022.1| alkaline D-peptidase [Bacillus anth... 38 0.46
gi|49477818|ref|YP_036766.1| alkaline D-peptidase (D-stereospeci... 38 0.46
gi|21400552|ref|NP_656537.1| hypothetical protein predicted by G... 38 0.46
gi|50096079|gb|AAT70411.1| ADC-7 beta-lactamase precursor; cepha... 38 0.46
gi|32436408|emb|CAE00827.1| beta-lactamase [Acinetobacter genomo... 38 0.46
gi|37524186|ref|NP_927530.1| hypothetical protein [Photorhabdus ... 38 0.46
gi|26246375|ref|NP_752414.1| Penicillin-binding protein ampH [Es... 38 0.46
gi|3395665|dbj|BAA32077.1| ampC [Enterobacter cloacae] 38 0.46
gi|28625511|gb|AAO42602.1| beta-lactamase Mir2 [Enterobacter clo... 38 0.46
gi|4558519|gb|AAD22636.1| beta-lactamase [Klebsiella pneumoniae] 38 0.46
gi|22972320|ref|ZP_00019205.1| hypothetical protein [Chloroflexu... 38 0.46
gi|50424337|ref|XP_460755.1| unnamed protein product [Debaryomyc... 38 0.60
gi|27467672|ref|NP_764309.1| autolysis and methicillin resistant... 38 0.60
gi|40548852|gb|AAR87489.1| AmpC [Klebsiella pneumoniae] 38 0.60
gi|2853122|emb|CAA76196.1| beta-lactamase class C [Salmonella en... 38 0.60
gi|40781702|emb|CAF04713.1| beta-lactamase, class C [Morganella ... 38 0.60
gi|6225051|sp|P94958|AMPC_MORMO Beta-lactamase precursor (Cephal... 38 0.60
gi|29569155|gb|AAO84036.1| beta-lactamase class C [Morganella mo... 38 0.60
gi|50425851|ref|XP_461522.1| unnamed protein product [Debaryomyc... 38 0.60
gi|42782125|ref|NP_979372.1| alkaline D-peptidase [Bacillus cere... 38 0.60
gi|30021128|ref|NP_832759.1| D-alanyl-D-alanine carboxypeptidase... 38 0.60
gi|30171154|gb|AAO59457.1| beta-lactamase [Acinetobacter baumannii] 38 0.60
gi|30407691|gb|AAP30025.1| esterase [Pseudomonas chlororaphis] 38 0.60
gi|30171147|gb|AAO43172.1| beta-lactamase; Aba-1 [Oligella ureth... 38 0.60
gi|30171152|gb|AAO59456.1| beta-lactamase [Acinetobacter baumannii] 38 0.60
gi|15800102|ref|NP_286114.1| putative enzyme [Escherichia coli O... 38 0.60
gi|1657571|gb|AAB18099.1| hypothetical protein in sbmA 3' region... 38 0.60
gi|41407211|ref|NP_960047.1| hypothetical protein MAP1113c [Myco... 38 0.60
gi|46908149|ref|YP_014538.1| peptidase, putative [Listeria monoc... 37 0.78
gi|47093833|ref|ZP_00231578.1| peptidase, putative [Listeria mon... 37 0.78
gi|30020597|ref|NP_832228.1| D-alanyl-D-alanine carboxypeptidase... 37 0.78
gi|42781640|ref|NP_978887.1| penicillin-binding protein, putativ... 37 0.78
gi|48890972|ref|ZP_00324563.1| COG1680: Beta-lactamase class C a... 37 0.78
gi|999836|pdb|2BLT|A Chain A, Beta-Lactamase (E.C.3.5.2.6) (Ceph... 37 0.78
gi|38141541|emb|CAE53430.1| D-stereospecific endopeptidase [Baci... 37 0.78
gi|11527187|gb|AAG36927.1| cephalosporinase DHA-2 [Klebsiella pn... 37 0.78
gi|24111682|ref|NP_706192.1| putative enzyme [Shigella flexneri ... 37 0.78
gi|113727|sp|P05364|AMPC_ENTCL Beta-lactamase precursor (Cephalo... 37 0.78
gi|39933537|ref|NP_945813.1| putative esterase [Rhodopseudomonas... 37 1.0
gi|38141543|emb|CAE53431.1| D-stereospecific endopeptidase [Baci... 37 1.0
gi|47568609|ref|ZP_00239307.1| beta-lactamase [Bacillus cereus G... 37 1.0
gi|29377077|ref|NP_816231.1| conserved hypothetical protein [Ent... 37 1.0
gi|49125996|ref|XP_412699.1| hypothetical protein AN8562.2 [Aspe... 37 1.3
gi|47574396|ref|ZP_00244432.1| COG1680: Beta-lactamase class C a... 37 1.3
gi|28378656|ref|NP_785548.1| serine-type D-Ala-D-Ala carboxypept... 37 1.3
gi|37524189|ref|NP_927533.1| hypothetical protein [Photorhabdus ... 37 1.3
gi|40781704|emb|CAF04714.1| beta-lactamase, class C [Morganella ... 37 1.3
gi|46559328|dbj|BAD16740.1| beta-lactamase precursor [Chromohalo... 37 1.3
gi|18376627|emb|CAC95129.2| beta-lactamase [Enterobacter cancero... 37 1.3
gi|48870018|ref|ZP_00322750.1| COG1680: Beta-lactamase class C a... 37 1.3
gi|20136437|gb|AAM11666.1| AmpC [Enterobacter cancerogenus] 37 1.3
gi|2499154|sp|Q45129|YGRA_BACPF Hypothetical 37.7 kDa protein in... 36 1.7
gi|23468582|ref|ZP_00123917.1| COG1680: Beta-lactamase class C a... 36 1.7
gi|16125814|ref|NP_420378.1| conserved hypothetical protein [Cau... 36 1.7
gi|39996480|ref|NP_952431.1| beta-lactamase [Geobacter sulfurred... 36 1.7
gi|14600642|ref|NP_147159.1| beta-lactamase [Aeropyrum pernix K1... 36 1.7
gi|7529645|emb|CAA43847.1| triacylglycerol lipase [Pseudomonas s... 36 1.7
gi|46102717|ref|XP_380233.1| hypothetical protein FG00057.1 [Gib... 36 1.7
gi|15614830|ref|NP_243133.1| penicillin-binding protein [Bacillu... 36 2.3
gi|46119888|ref|XP_384989.1| hypothetical protein FG04813.1 [Gib... 36 2.3
gi|16127420|ref|NP_421984.1| conserved hypothetical protein [Cau... 36 2.3
gi|29347849|ref|NP_811352.1| beta-N-acetylglucosaminidase [Bacte... 36 2.3
gi|16759353|ref|NP_454970.1| penicillin-binding protein AmpH [Sa... 36 2.3
gi|16803955|ref|NP_465440.1| similar to peptidase [Listeria mono... 35 3.0
gi|16125122|ref|NP_419686.1| conserved hypothetical protein [Cau... 35 3.0
gi|48871178|ref|ZP_00323894.1| COG1680: Beta-lactamase class C a... 35 3.0
gi|3915467|sp|P77619|YFEW_ECOLI Hypothetical UPF0214 protein yfe... 35 3.9
gi|21225787|ref|NP_631566.1| putative secreted peptidase [Strept... 35 3.9
gi|48851089|ref|ZP_00305331.1| COG1680: Beta-lactamase class C a... 35 3.9
gi|27375926|ref|NP_767455.1| blr0815 [Bradyrhizobium japonicum U... 35 3.9
gi|16077235|ref|NP_388048.1| ybbE [Bacillus subtilis subsp. subt... 35 3.9
gi|16130355|ref|NP_416925.1| putative beta-lactamase; putative b... 35 3.9
gi|46198704|ref|YP_004371.1| putative exported protein [Thermus ... 35 3.9
gi|33089938|gb|AAP93849.1| beta-lactamase [Enterobacter cloacae] 35 3.9
gi|20530946|gb|AAM27298.1| beta-lactamase [Escherichia coli] 35 3.9
gi|29832334|ref|NP_826968.1| hypothetical protein SAV5791 [Strep... 35 3.9
gi|11992014|gb|AAG42401.1| triacylglycerol lipase [Zymomonas mob... 35 5.1
gi|24373935|ref|NP_717978.1| beta-lactamase [Shewanella oneidens... 35 5.1
gi|42522046|ref|NP_967426.1| putative penicillin-binding protein... 35 5.1
gi|16763755|ref|NP_459370.1| penicillin-binding protein [Salmone... 35 5.1
gi|4958924|dbj|BAA78097.1| 1,4-butanediol diacrylate esterase [B... 35 5.1
gi|37524187|ref|NP_927531.1| hypothetical protein [Photorhabdus ... 34 6.6
gi|29247656|gb|EAA39211.1| GLP_239_7886_10504 [Giardia lamblia A... 34 6.6
gi|15840826|ref|NP_335863.1| transesterase [Mycobacterium tuberc... 34 8.6
gi|49074794|ref|XP_401506.1| hypothetical protein UM03891.1 [Ust... 34 8.6
gi|39595190|emb|CAE60227.1| Hypothetical protein CBG03798 [Caeno... 34 8.6
gi|15608507|ref|NP_215883.1| hypothetical protein Rv1367c [Mycob... 34 8.6
gi|23023988|ref|ZP_00063214.1| COG1680: Beta-lactamase class C a... 34 8.6
gi|31792563|ref|NP_855056.1| CONSERVED HYPOTHETICAL PROTEIN [Myc... 34 8.6
gi|29832461|ref|NP_827095.1| putative secreted esterase [Strepto... 34 8.6
gi|13475563|ref|NP_107127.1| hypothetical protein mll6665 [Mesor... 34 8.6
>gi|17535191|ref|NP_496299.1| esterase A precursor family member
(2K944) [Caenorhabditis elegans]
gi|7506096|pir||T23809 hypothetical protein M28.6 - Caenorhabditis
elegans
gi|3878692|emb|CAA90128.1| Hypothetical protein M28.6 [Caenorhabditis
elegans]
Length = 431
Score = 823 bits (2127), Expect = 0.0
Identities = 407/431 (94%), Positives = 407/431 (94%)
Frame = -1
Query: 1296 MQQFSXXXXXXXXXXXLSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE 1117
MQQFS LSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE
Sbjct: 1 MQQFSLLFKLFLATVLLSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE 60
Query: 1116 IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL 937
IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL
Sbjct: 61 IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL 120
Query: 936 RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP 757
RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP
Sbjct: 121 RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP 180
Query: 756 KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR 577
KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR
Sbjct: 181 KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR 240
Query: 576 VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD 397
VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD
Sbjct: 241 VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD 300
Query: 396 YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG 217
YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG
Sbjct: 301 YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG 360
Query: 216 FFHLPIHRAXXXXXXXXXXXXXQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV 37
FFHLPIHRA QMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV
Sbjct: 361 FFHLPIHRAGTQFGFGHTGHGCQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV 420
Query: 36 YDVIEQINIQS 4
YDVIEQINIQS
Sbjct: 421 YDVIEQINIQS 431
>gi|39597399|emb|CAE59629.1| Hypothetical protein CBG03042
[Caenorhabditis briggsae]
Length = 428
Score = 759 bits (1960), Expect = 0.0
Identities = 366/411 (89%), Positives = 387/411 (94%)
Frame = -1
Query: 1245 SVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWEIEGSAFAVFVDGKKVVD 1066
SV YRF CDRLYSNHK +++GFVDERF KVREVF KNFE GWE EGSAFAVFVDGKKVVD
Sbjct: 18 SVAYRFFCDRLYSNHKPEINGFVDERFTKVREVFMKNFEKGWESEGSAFAVFVDGKKVVD 77
Query: 1065 LWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKLRYDDPVSKYWPGFGTHG 886
LWGGYADKQAARKWAEDTITVTFSTTKAAA+LAVALLYEQGKL YDDPVSKYWPGFGTHG
Sbjct: 78 LWGGYADKQAARKWAEDTITVTFSTTKAAAALAVALLYEQGKLSYDDPVSKYWPGFGTHG 137
Query: 885 RDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEPKWAPGTKTGYHAYTFGW 706
RDNVTI MALSHMSGMAWFDTPITEEIAADHE+MRQIIE+EEPKWAPGTKTGYHAYT+GW
Sbjct: 138 RDNVTIQMALSHMSGMAWFDTPITEEIAADHEQMRQIIEKEEPKWAPGTKTGYHAYTYGW 197
Query: 705 LVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHRVARISTPNMLNRLDEMW 526
LVDQIVRHTDD+KRGIGQ+FREEIA+KLDVDYHIGLP+SEQHRVARISTPNMLNR+DEM
Sbjct: 198 LVDQIVRHTDDRKRGIGQYFREEIASKLDVDYHIGLPLSEQHRVARISTPNMLNRIDEML 257
Query: 525 TDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS 346
TD+RV+KYMKSL KLMTDHPL+HIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS
Sbjct: 258 TDIRVLKYMKSLIKLMTDHPLAHIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS 317
Query: 345 LASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPIHRAXXXXXXXX 166
LASLFDKV+RG+L+NQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPI+RA
Sbjct: 318 LASLFDKVSRGQLVNQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPINRAGAQFGFGH 377
Query: 165 XXXXXQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSVYDVIEQIN 13
QMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQ+SVYDVIEQ+N
Sbjct: 378 TGHGCQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQSSVYDVIEQVN 428