Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= M28_8
         (1296 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535191|ref|NP_496299.1| esterase A precursor family member ...   823   0.0
gi|39597399|emb|CAE59629.1| Hypothetical protein CBG03042 [Caeno...   759   0.0
gi|17538001|ref|NP_496176.1| esterase A family member (52.5 kD) ...   334   2e-90
gi|39587804|emb|CAE67822.1| Hypothetical protein CBG13402 [Caeno...   330   6e-89
gi|39587165|emb|CAE57633.1| Hypothetical protein CBG00618 [Caeno...   327   3e-88
gi|17535177|ref|NP_495790.1| carboxylesterase family member (49....   327   3e-88
gi|17532285|ref|NP_494863.1| carboxylesterase family member (2F1...   270   5e-71
gi|17538474|ref|NP_503109.1| esterase III family member (48.8 kD...   270   5e-71
gi|39585207|emb|CAE57450.1| Hypothetical protein CBG00413 [Caeno...   259   1e-67
gi|39591148|emb|CAE73201.1| Hypothetical protein CBG20604 [Caeno...   259   1e-67
gi|3649751|emb|CAA78842.1| esterase A [Streptomyces chrysomallus]     181   3e-44
gi|28871261|ref|NP_793880.1| carboxylesterase [Pseudomonas syrin...   180   7e-44
gi|46187963|ref|ZP_00126504.2| COG1680: Beta-lactamase class C a...   178   2e-43
gi|48732845|ref|ZP_00266588.1| COG1680: Beta-lactamase class C a...   175   2e-42
gi|348403|pir||A44832 esterase estA - Pseudomonas sp >gnl|BL_ORD...   172   2e-41
gi|16209565|gb|AAL14234.1| lactone hydrolase [Rhodococcus ruber]      170   6e-41
gi|26987863|ref|NP_743288.1| carboxylesterase [Pseudomonas putid...   170   6e-41
gi|23104094|ref|ZP_00090564.1| COG1680: Beta-lactamase class C a...   169   2e-40
gi|29827845|ref|NP_822479.1| putative esterase A [Streptomyces a...   168   2e-40
gi|740927|prf||2006221A carboxylesterase                              167   5e-40
gi|540968|pir||JC2091 carboxylesterase (EC 3.1.1.1) - Pseudomona...   167   5e-40
gi|15596244|ref|NP_249738.1| probable esterase [Pseudomonas aeru...   166   9e-40
gi|21221599|ref|NP_627378.1| putative esterase [Streptomyces coe...   166   9e-40
gi|41408381|ref|NP_961217.1| LipP [Mycobacterium avium subsp. pa...   164   6e-39
gi|29830154|ref|NP_824788.1| putative esterase [Streptomyces ave...   164   6e-39
gi|13475683|ref|NP_107250.1| esterase [Mesorhizobium loti MAFF30...   163   9e-39
gi|46102640|ref|XP_380200.1| hypothetical protein FG00024.1 [Gib...   160   5e-38
gi|16124510|ref|NP_419074.1| esterase A [Caulobacter crescentus ...   160   6e-38
gi|49104174|ref|XP_411222.1| hypothetical protein AN7085.2 [Aspe...   159   2e-37
gi|34610389|gb|AAB37025.2| Hypothetical protein F46H5.8 [Caenorh...   154   3e-36
gi|15609600|ref|NP_216979.1| lipP [Mycobacterium tuberculosis H3...   154   3e-36
gi|49125425|ref|XP_412665.1| hypothetical protein AN8528.2 [Aspe...   154   6e-36
gi|32041047|ref|ZP_00138630.1| COG1680: Beta-lactamase class C a...   150   6e-35
gi|18478336|gb|AAL73134.1| carboxylesterase [Pseudomonas fluores...   148   3e-34
gi|6624956|emb|CAB63910.1| Esterase STE1 [Metarhizium anisopliae...   143   8e-33
gi|48928124|gb|AAT47740.1| esterase [Mycobacterium avium]             130   5e-29
gi|15841395|ref|NP_336432.1| esterase, putative [Mycobacterium t...   130   9e-29
gi|15609060|ref|NP_216439.1| lipD [Mycobacterium tuberculosis H3...   130   9e-29
gi|41407326|ref|NP_960162.1| LipL [Mycobacterium avium subsp. pa...   129   1e-28
gi|31793115|ref|NP_855608.1| PROBABLE LIPASE LIPD [Mycobacterium...   127   4e-28
gi|15840960|ref|NP_335997.1| esterase [Mycobacterium tuberculosi...   123   1e-26
gi|15608635|ref|NP_216013.1| lipL [Mycobacterium tuberculosis H3...   123   1e-26
gi|21218874|ref|NP_624653.1| putative esterase [Streptomyces coe...   118   3e-25
gi|50085111|ref|YP_046621.1| conserved hypothetical protein; put...   110   9e-23
gi|32398350|emb|CAD61039.1| unnamed protein product [Arthrobacte...   105   2e-21
gi|348008|gb|AAA99492.1| carboxylic ester hydrolase                   103   7e-21
gi|18420844|ref|NP_568458.1| ABC1 family protein [Arabidopsis th...    99   2e-19
gi|15081731|gb|AAK82520.1| AT5g24810/F6A4_20 [Arabidopsis thaliana]    96   1e-18
gi|4731333|gb|AAD28450.1| unknown [Streptomyces lavendulae]            89   2e-16
gi|46227262|gb|EAK88212.1| conserved possible esterase of the be...    79   2e-13
gi|50083656|ref|YP_045166.1| putative beta-lactamase [Acinetobac...    79   3e-13
gi|41406346|ref|NP_959182.1| LipE [Mycobacterium avium subsp. pa...    70   1e-10
gi|23098122|ref|NP_691588.1| beta-lactamase [Oceanobacillus ihey...    68   5e-10
gi|41689542|ref|ZP_00146075.1| COG1680: Beta-lactamase class C a...    65   3e-09
gi|15610911|ref|NP_218292.1| lipE [Mycobacterium tuberculosis H3...    65   3e-09
gi|1502425|gb|AAB06505.1| esterase [Mycobacterium tuberculosis]        65   3e-09
gi|46204780|ref|ZP_00049498.2| COG1680: Beta-lactamase class C a...    63   1e-08
gi|15826952|ref|NP_301215.1| probable hydrolase [Mycobacterium l...    62   4e-08
gi|32471513|ref|NP_864506.1| putative esterase [Pirellula sp. 1]...    61   5e-08
gi|30962005|gb|AAP40275.1| AmpC [Erwinia rhapontici]                   59   2e-07
gi|46106640|ref|ZP_00187566.2| COG1680: Beta-lactamase class C a...    59   3e-07
gi|39934678|ref|NP_946954.1| Beta-lactamase [Rhodopseudomonas pa...    59   3e-07
gi|50752815|ref|XP_413759.1| PREDICTED: similar to serine beta l...    56   2e-06
gi|30021328|ref|NP_832959.1| Penicillin-binding protein [Bacillu...    56   2e-06
gi|17567799|ref|NP_509221.1| beta-lactamase family member (XH876...    56   2e-06
gi|14719674|pdb|1I5Q|A Chain A, Crystal Structure Of The E. Coli...    55   3e-06
gi|47225815|emb|CAF98295.1| unnamed protein product [Tetraodon n...    55   4e-06
gi|41409260|ref|NP_962096.1| hypothetical protein MAP3162c [Myco...    55   4e-06
gi|44194086|gb|AAS46849.1| extended-spectrum ampC beta-lactamase...    55   5e-06
gi|42519919|gb|AAS07017.2| class C beta-lactamase SRT-2 [Serrati...    55   5e-06
gi|49478085|ref|YP_037320.1| beta-lactamase [Bacillus thuringien...    55   5e-06
gi|46131374|ref|ZP_00169545.2| COG1680: Beta-lactamase class C a...    55   5e-06
gi|39586820|emb|CAE65863.1| Hypothetical protein CBG11006 [Caeno...    55   5e-06
gi|47564375|ref|ZP_00235420.1| beta-lactamase [Bacillus cereus G...    54   6e-06
gi|2575874|dbj|BAA23131.1| SST-1 [Serratia marcescens]                 54   6e-06
gi|46321968|ref|ZP_00222341.1| COG1680: Beta-lactamase class C a...    54   8e-06
gi|46798946|emb|CAG27338.1| beta-lactamase [Serratia marcescens]       54   8e-06
gi|6759593|emb|CAB69829.1| class C beta-lactamase [Serratia marc...    54   1e-05
gi|4691716|gb|AAD28041.1| beta-lactamase precursor [Escherichia ...    54   1e-05
gi|46276335|gb|AAS86426.1| beta-lactamase [Escherichia coli]           53   1e-05
gi|37718709|dbj|BAC99094.1| beta-lactamase [Escherichia coli]          53   1e-05
gi|37222640|gb|AAQ90024.1| expanded spectrum beta-lactamase [Ser...    53   1e-05
gi|2575872|dbj|BAA23130.1| SRT-1 [Serratia marcescens]                 53   1e-05
gi|13195447|gb|AAK15701.1| class C beta-lactamase [Serratia marc...    53   1e-05
gi|26251046|ref|NP_757086.1| Beta-lactamase precursor [Escherich...    53   1e-05
gi|1168442|sp|P45460|AMPC_YEREN Beta-lactamase precursor (Cephal...    53   1e-05
gi|24115509|ref|NP_710019.1| beta-lactamase; penicillin resistan...    53   1e-05
gi|3660293|pdb|2BLS|A Chain A, Ampc Beta-Lactamase From Escheric...    53   1e-05
gi|13787067|pdb|1FSW|A Chain A, Ampc Beta-Lactamase From E. Coli...    53   1e-05
gi|46015207|pdb|1PI4|A Chain A, Structure Of N289a Mutant Of Amp...    53   1e-05
gi|23200306|pdb|1L0F|A Chain A, X-Ray Crystal Structure Of Ampc ...    53   1e-05
gi|15804744|ref|NP_290785.1| beta-lactamase; penicillin resistan...    53   1e-05
gi|30065527|ref|NP_839698.1| beta-lactamase [Shigella flexneri 2...    53   1e-05
gi|4691720|gb|AAD28043.1| beta-lactamase precursor [Escherichia ...    53   1e-05
gi|16131975|ref|NP_418574.1| beta-lactamase; penicillin resistan...    53   1e-05
gi|39935217|ref|NP_947493.1| Beta-lactamase [Rhodopseudomonas pa...    53   2e-05
gi|27380820|ref|NP_772349.1| bll5709 [Bradyrhizobium japonicum U...    53   2e-05
gi|42781634|ref|NP_978881.1| fmtA-like protein, putative [Bacill...    53   2e-05
gi|13195449|gb|AAK15702.1| class C beta-lactamase [Serratia marc...    53   2e-05
gi|14517953|gb|AAK64454.1| beta-lactamase; AmpC [Serratia marces...    53   2e-05
gi|30022130|ref|NP_833761.1| Penicillin-binding protein [Bacillu...    52   2e-05
gi|49476726|ref|YP_034509.1| beta-lactamase [Bacillus thuringien...    52   2e-05
gi|20136445|gb|AAM11671.1| AmpC [Escherichia fergusonii]               52   2e-05
gi|21213049|emb|CAD32299.1| beta-lactamase precursor [Enterobact...    52   3e-05
gi|30020851|ref|NP_832482.1| Penicillin-binding protein [Bacillu...    52   3e-05
gi|47565925|ref|ZP_00236964.1| beta-lactamase [Bacillus cereus G...    52   3e-05
gi|4691718|gb|AAD28042.1| beta-lactamase precursor [Escherichia ...    52   4e-05
gi|20151084|pdb|1KVL|A Chain A, X-Ray Crystal Structure Of Ampc ...    52   4e-05
gi|23200302|pdb|1L0D|A Chain A, X-Ray Crystal Structure Of Ampc ...    52   4e-05
gi|23200304|pdb|1L0E|A Chain A, X-Ray Crystal Structure Of Ampc ...    52   4e-05
gi|26051231|ref|NP_116246.2| lactamase, beta isoform a; mitochon...    51   7e-05
gi|21225520|ref|NP_631299.1| putative secreted protein [Streptom...    51   7e-05
gi|26051233|ref|NP_741982.1| lactamase, beta isoform b; mitochon...    51   7e-05
gi|37182540|gb|AAQ89072.1| MRPL56 [Homo sapiens]                       51   7e-05
gi|14042761|dbj|BAB55384.1| unnamed protein product [Homo sapiens]     51   7e-05
gi|44194091|gb|AAS46851.1| ampC beta-lactamase [Serratia marcesc...    50   9e-05
gi|15609059|ref|NP_216438.1| hypothetical protein Rv1922 [Mycoba...    50   9e-05
gi|17943441|pdb|1CI9|A Chain A, Dfp-Inhibited Esterase Estb From...    50   9e-05
gi|13507666|ref|NP_109642.1| lactamase, beta; serine beta lactam...    50   9e-05
gi|28374178|gb|AAH46293.1| Lactb protein [Mus musculus]                50   9e-05
gi|16799619|ref|NP_469887.1| similar to penicillin-binding prote...    50   9e-05
gi|12084422|pdb|1FCM|A Chain A, Crystal Structure Of The E.Coli ...    50   9e-05
gi|21213046|emb|CAD32298.1| beta-lactamase precursor [Enterobact...    50   1e-04
gi|34864295|ref|XP_217181.2| similar to serine beta lactamase-li...    50   2e-04
gi|21673163|ref|NP_661228.1| D-alanyl-D-alanine carboxypeptideas...    50   2e-04
gi|47564982|ref|ZP_00236026.1| fmtA-like protein, putative [Baci...    49   2e-04
gi|42783157|ref|NP_980404.1| beta-lactamase [Bacillus cereus ATC...    49   2e-04
gi|37039781|gb|AAQ88181.1| lipase [Micrococcus sp. HL-2003]            49   2e-04
gi|27379137|ref|NP_770666.1| blr4026 [Bradyrhizobium japonicum U...    49   2e-04
gi|27802501|gb|AAO21211.1| beta-lactamase [Yersinia aldovae]           49   3e-04
gi|49477052|ref|YP_035273.1| beta-lactamase [Bacillus thuringien...    49   3e-04
gi|47570164|ref|ZP_00240820.1| penicillin-binding protein [Bacil...    49   3e-04
gi|39584515|emb|CAE74593.1| Hypothetical protein CBG22374 [Caeno...    49   3e-04
gi|22213623|gb|AAM93471.1| beta-lactamase; AmpC [Citrobacter fre...    49   3e-04
gi|46317194|ref|ZP_00217772.1| COG1680: Beta-lactamase class C a...    49   3e-04
gi|48844302|ref|ZP_00298621.1| COG1680: Beta-lactamase class C a...    49   3e-04
gi|47574753|ref|ZP_00244789.1| COG1680: Beta-lactamase class C a...    48   4e-04
gi|15925431|ref|NP_372965.1| hypothetical protein SAV2441 [Staph...    48   4e-04
gi|27542962|gb|AAO16522.1| cephalosporinase AmpC [Enterobacter a...    48   4e-04
gi|227653|prf||1708210A beta lactamase                                 48   4e-04
gi|113729|sp|P18539|AMPC_SERMA Beta-lactamase precursor (Cephalo...    48   4e-04
gi|27542972|gb|AAO16527.1| cephalosporinase AmpC [Enterobacter a...    48   4e-04
gi|28375572|emb|CAD66516.1| AmpC beta-lactamase [Enterobacter ae...    48   4e-04
gi|27542968|gb|AAO16525.1| cephalosporinase AmpC [Enterobacter a...    48   4e-04
gi|28375570|emb|CAD66515.1| AmpC beta-lactamase [Enterobacter ae...    48   4e-04
gi|27542966|gb|AAO16524.1| cephalosporinase AmpC [Enterobacter a...    48   4e-04
gi|6601479|gb|AAF18992.1| beta-lactamase AmpC [Enterobacter aero...    48   4e-04
gi|21225869|ref|NP_631648.1| putative hydrolase [Streptomyces co...    48   4e-04
gi|15924047|ref|NP_371581.1| autolysis and methicillin resistant...    48   6e-04
gi|27542964|gb|AAO16523.1| cephalosporinase AmpC [Enterobacter a...    48   6e-04
gi|27542970|gb|AAO16526.1| cephalosporinase AmpC [Enterobacter a...    48   6e-04
gi|27542974|gb|AAO16528.1| cephalosporinase AmpC [Enterobacter a...    48   6e-04
gi|27542960|gb|AAO16521.1| cephalosporinase AmpC [Enterobacter a...    48   6e-04
gi|48850999|ref|ZP_00305241.1| COG1680: Beta-lactamase class C a...    48   6e-04
gi|48768396|ref|ZP_00272746.1| COG1680: Beta-lactamase class C a...    48   6e-04
gi|39936347|ref|NP_948623.1| possible penicillin binding protein...    47   8e-04
gi|49483221|ref|YP_040445.1| autolysis and methicillin resistant...    47   0.001
gi|46906785|ref|YP_013174.1| penicillin-binding protein, putativ...    47   0.001
gi|20135564|gb|AAM08944.1| beta-lactamase precursor [Pseudomonas...    47   0.001
gi|49487224|ref|YP_044445.1| putative exported protein [Staphylo...    47   0.001
gi|21284094|ref|NP_647182.1| ORFID:MW2365~hypothetical protein, ...    47   0.001
gi|40809678|emb|CAD32304.2| beta-lactamase precursor [Citrobacte...    47   0.001
gi|27377909|ref|NP_769438.1| bll2798 [Bradyrhizobium japonicum U...    47   0.001
gi|29827802|ref|NP_822436.1| putative beta-lactamase [Streptomyc...    47   0.001
gi|21401125|ref|NP_657110.1| hypothetical protein predicted by G...    47   0.001
gi|42781328|ref|NP_978575.1| conserved hypothetical protein [Bac...    46   0.002
gi|30020324|ref|NP_831955.1| Penicillin-binding protein [Bacillu...    46   0.002
gi|19919854|gb|AAM08410.1| cephalosporinase [Pseudomonas aerugin...    46   0.002
gi|20135560|gb|AAM08942.1| beta-lactamase precursor [Pseudomonas...    46   0.002
gi|47094774|ref|ZP_00232389.1| penicillin-binding protein, putat...    46   0.002
gi|16802583|ref|NP_464068.1| similar to penicillin-binding prote...    46   0.002
gi|15599305|ref|NP_252799.1| beta-lactamase precursor [Pseudomon...    46   0.002
gi|320125|pir||S13408 beta-lactamase (EC 3.5.2.6) precursor - Ps...    46   0.002
gi|1945683|emb|CAB08016.1| penicillin-binding protein [Bacillus ...    46   0.002
gi|49088514|gb|AAT51578.1| PA2315 [synthetic construct]                46   0.002
gi|48729894|ref|ZP_00263643.1| COG1680: Beta-lactamase class C a...    46   0.002
gi|15597511|ref|NP_251005.1| hypothetical protein [Pseudomonas a...    46   0.002
gi|16080497|ref|NP_391324.1| penicillin-binding protein 4* [Baci...    46   0.002
gi|32475497|ref|NP_868491.1| probable beta-lactamase [Pirellula ...    46   0.002
gi|628629|pir||S44094 beta-lactamase (EC 3.5.2.6) - Citrobacter ...    46   0.002
gi|46363805|ref|ZP_00226503.1| COG1680: Beta-lactamase class C a...    46   0.002
gi|15600735|ref|NP_254229.1| hypothetical protein [Pseudomonas a...    46   0.002
gi|20135562|gb|AAM08943.1| beta-lactamase precursor [Pseudomonas...    46   0.002
gi|13096564|pdb|1FR1|A Chain A, Refined Crystal Structure Of Bet...    46   0.002
gi|46313369|ref|ZP_00213959.1| COG1680: Beta-lactamase class C a...    46   0.002
gi|23104980|ref|ZP_00091438.1| COG1680: Beta-lactamase class C a...    46   0.002
gi|17543484|ref|NP_502657.1| lactamase beta (4O546) [Caenorhabdi...    46   0.002
gi|42782230|ref|NP_979477.1| beta-lactamase [Bacillus cereus ATC...    46   0.002
gi|22255882|gb|AAM94804.1| beta-lactamase [Yersinia ruckeri]           46   0.002
gi|20136434|gb|AAM11664.1| AmpC [Citrobacter murliniae]                46   0.002
gi|27380819|ref|NP_772348.1| bll5708 [Bradyrhizobium japonicum U...    46   0.002
gi|1389618|dbj|BAA12916.1| beta-lactamase [Citrobacter freundii]       46   0.002
gi|30314629|dbj|BAC76072.1| AmpC beta-lactamase CFE-1 [Escherich...    46   0.002
gi|49480116|ref|YP_034766.1| beta-lactamase (penicillin-binding ...    45   0.003
gi|46164820|ref|ZP_00205195.1| COG1680: Beta-lactamase class C a...    45   0.003
gi|48870670|ref|ZP_00323390.1| COG1680: Beta-lactamase class C a...    45   0.003
gi|49484658|ref|YP_041882.1| putative exported protein [Staphylo...    45   0.003
gi|47092805|ref|ZP_00230589.1| penicillin-binding protein, putat...    45   0.003
gi|9246437|gb|AAF86053.1| fmtA-like protein [Staphylococcus aureus]    45   0.003
gi|30021593|ref|NP_833224.1| Penicillin-binding protein [Bacillu...    45   0.003
gi|21243533|ref|NP_643115.1| beta-lactamase [Xanthomonas axonopo...    45   0.004
gi|15807882|ref|NP_285541.1| conserved hypothetical protein [Dei...    45   0.004
gi|13605348|gb|AAK32688.1| class C beta-lactamase [Citrobacter f...    45   0.004
gi|13605346|gb|AAK32687.1| class C beta-lactamase [Citrobacter f...    45   0.004
gi|40287460|gb|AAQ16660.2| CMY-13 [Escherichia coli]                   45   0.004
gi|20136440|gb|AAM11668.1| AmpC [Citrobacter braakii]                  45   0.004
gi|49477560|ref|YP_036347.1| penicillin-binding protein [Bacillu...    45   0.005
gi|32477786|ref|NP_870780.1| conserved hypothetical protein-puta...    45   0.005
gi|32039288|ref|ZP_00137560.1| COG1680: Beta-lactamase class C a...    45   0.005
gi|16127858|ref|NP_422422.1| conserved hypothetical protein [Cau...    45   0.005
gi|16264788|ref|NP_437580.1| putative exported beta-lactamase pr...    45   0.005
gi|4731343|gb|AAD28460.1| MitL [Streptomyces lavendulae]               45   0.005
gi|9294834|gb|AAF86700.1| AMPC cephalosporinase precursor protei...    45   0.005
gi|27468925|ref|NP_765562.1| beta-lactamase [Staphylococcus epid...    45   0.005
gi|30018689|ref|NP_830320.1| Penicillin-binding protein [Bacillu...    45   0.005
gi|2569957|emb|CAA75401.1| beta lactamase class C [Citrobacter f...    45   0.005
gi|78234|pir||S08296 beta-lactamase (EC 3.5.2.6) precursor - Cit...    45   0.005
gi|548461|sp|Q06317|PBP4_NOCLA Penicillin-binding protein 4 (PBP...    45   0.005
gi|216403|dbj|BAA02494.1| beta-lactamase precursor [Citrobacter ...    45   0.005
gi|47168782|pdb|1RGY|A Chain A, Citrobacter Freundii Gn346 Class...    45   0.005
gi|21400114|ref|NP_656099.1| hypothetical protein predicted by G...    44   0.006
gi|39997145|ref|NP_953096.1| conserved hypothetical protein [Geo...    44   0.006
gi|25004792|emb|CAD56688.1| PbpX protein [Bacillus amyloliquefac...    44   0.006
gi|5419925|emb|CAB46491.1| AmpC beta-lactamase ACC-1 [Klebsiella...    44   0.006
gi|29841350|gb|AAP06382.1| hypothetical protein [Schistosoma jap...    44   0.006
gi|47567267|ref|ZP_00237981.1| penicillin-binding protein, putat...    44   0.006
gi|9294822|gb|AAF86694.1| AMPC cephalosporinase precursor protei...    44   0.006
gi|6225052|sp|O69773|AMPC_PROST Beta-lactamase precursor (Cephal...    44   0.006
gi|9294818|gb|AAF86692.1| AMPC cephalosporinase precursor protei...    44   0.006
gi|9294830|gb|AAF86698.1| AMPC cephalosporinase precursor protei...    44   0.006
gi|6225053|sp|O05465|AMPC_PSYIM Beta-lactamase precursor (Cephal...    44   0.006
gi|30021297|ref|NP_832928.1| Penicillin-binding protein [Bacillu...    44   0.006
gi|23100815|ref|NP_694282.1| hypothetical protein OB3360 [Oceano...    44   0.006
gi|14520356|ref|NP_125831.1| hypothetical beta-lactamase precurs...    44   0.008
gi|16200253|emb|CAC94553.1| class C beta-lactamase [Buttiauxella...    44   0.008
gi|9294826|gb|AAF86696.1| AMPC cephalosporinase precursor protei...    44   0.008
gi|5514768|emb|CAB50867.1| beta-lactamase CMY-5 [Klebsiella oxyt...    44   0.008
gi|49183501|ref|YP_026753.1| penicillin-binding protein, putativ...    44   0.011
gi|21398447|ref|NP_654432.1| hypothetical protein predicted by G...    44   0.011
gi|15599543|ref|NP_253037.1| hypothetical protein [Pseudomonas a...    44   0.011
gi|9294824|gb|AAF86695.1| AMPC cephalosporinase precursor protei...    44   0.011
gi|21401419|ref|NP_657404.1| hypothetical protein predicted by G...    44   0.011
gi|21232067|ref|NP_637984.1| beta-lactamase [Xanthomonas campest...    43   0.014
gi|27380652|ref|NP_772181.1| blr5541 [Bradyrhizobium japonicum U...    43   0.014
gi|42779635|ref|NP_976882.1| penicillin-binding protein, putativ...    43   0.014
gi|21224952|ref|NP_630731.1| conserved hypothetical protein SC5A...    43   0.014
gi|50365417|ref|YP_053842.1| putative beta-lactamase [Mesoplasma...    43   0.014
gi|48473849|emb|CAG34070.1| class C beta-lactamase [Citrobacter ...    43   0.014
gi|113725|sp|P05193|AMPC_CITFR Beta-lactamase precursor (Cephalo...    43   0.014
gi|20136443|gb|AAM11670.1| AmpC [Citrobacter werkmanii]                43   0.014
gi|14590084|ref|NP_142148.1| hypothetical protein PH0142 [Pyroco...    43   0.014
gi|23104937|ref|ZP_00091397.1| COG1680: Beta-lactamase class C a...    43   0.019
gi|40641656|emb|CAF04085.1| beta-lactamase precursor [Morganella...    43   0.019
gi|20806757|ref|NP_621928.1| Beta-lactamase class C and other pe...    43   0.019
gi|48772571|ref|ZP_00276913.1| COG1680: Beta-lactamase class C a...    43   0.019
gi|2959390|emb|CAA76382.1| beta-lactamase class C [Proteus mirab...    43   0.019
gi|23127421|ref|ZP_00109292.1| COG1680: Beta-lactamase class C a...    43   0.019
gi|46126743|ref|XP_387925.1| hypothetical protein FG07749.1 [Gib...    43   0.019
gi|13591815|gb|AAK31368.1| extended-spectrum beta-lactamase prec...    42   0.024
gi|1524113|emb|CAA63264.1| ES-beta-lactamase [Klebsiella pneumon...    42   0.024
gi|13591819|gb|AAK31370.1| extended-spectrum beta-lactamase prec...    42   0.024
gi|17227649|ref|NP_484197.1| penicillin-binding protein [Nostoc ...    42   0.024
gi|18313926|ref|NP_560593.1| beta-lactamase-like protein [Pyroba...    42   0.024
gi|16078758|ref|NP_389577.1| penicillin-binding protein [Bacillu...    42   0.024
gi|41019334|gb|AAR98572.1| beta-lactamase [Escherichia coli]           42   0.024
gi|18376597|emb|CAC85357.1| beta-lactamase [Enterobacter hormaec...    42   0.024
gi|4456089|emb|CAB36902.1| beta-lactamase [Escherichia coli]           42   0.024
gi|2598417|emb|CAA75611.1| beta-lactamase LAT-4 protein [Escheri...    42   0.024
gi|46357594|emb|CAD88479.1| ampC-type beta-lactamase [Proteus mi...    42   0.024
gi|46357592|emb|CAD88477.1| ampC-type beta-lactamase [Proteus mi...    42   0.024
gi|1212998|emb|CAA62957.1| extended spectrum beta-lactamase [Kle...    42   0.024
gi|42357703|gb|AAS13399.1| beta-lactamase [Escherichia coli]           42   0.024
gi|1359903|emb|CAA65752.1| LAT-2 b-lactamase [Klebsiella pneumon...    42   0.024
gi|2570065|emb|CAA75402.1| beta-lactamase class C [Proteus mirab...    42   0.024
gi|2511454|gb|AAB80855.1| bla LAT-3 [Salmonella enterica subsp. ...    42   0.024
gi|4456085|emb|CAB36900.1| beta-lactamase [Escherichia coli] >gn...    42   0.024
gi|628809|pir||S45109 beta-lactamase (EC 3.5.2.6) precursor - Kl...    42   0.024
gi|6952809|gb|AAD50818.2| AmpC-type class C beta-lactamase [Kleb...    42   0.032
gi|11761378|dbj|BAA02563.2| beta-lactamase [Klebsiella pneumoniae]     42   0.032
gi|26248304|ref|NP_754344.1| Hypothetical protein [Escherichia c...    42   0.032
gi|48845113|ref|ZP_00299401.1| COG1680: Beta-lactamase class C a...    42   0.032
gi|23307624|gb|AAN17791.1| AmpC [Buttiauxella agrestis]                42   0.032
gi|16266766|dbj|BAB69972.1| penicillin-binding protein homolog [...    42   0.032
gi|47564622|ref|ZP_00235667.1| beta-lactamase [Bacillus cereus G...    42   0.032
gi|481726|pir||S39196 beta-lactamase (EC 3.5.2.6) - Escherichia ...    42   0.032
gi|45547814|ref|ZP_00187855.1| COG1680: Beta-lactamase class C a...    42   0.032
gi|49479259|ref|YP_037586.1| possible beta-lactamase [Bacillus t...    42   0.032
gi|17046114|dbj|BAB72158.1| class C beta-lactamase [Escherichia ...    42   0.041
gi|11544707|emb|CAC17626.1| beta-lactamase class C [Ochrobactrum...    42   0.041
gi|11544709|emb|CAC17627.1| beta-lactamase class C [Ochrobactrum...    42   0.041
gi|9909831|emb|CAC04522.1| AmpC beta-lactamase class C [Ochrobac...    42   0.041
gi|11544703|emb|CAC17624.1| beta-lactamase class C [Ochrobactrum...    42   0.041
gi|16125815|ref|NP_420379.1| conserved hypothetical protein [Cau...    42   0.041
gi|21232304|ref|NP_638221.1| beta-lactamase [Xanthomonas campest...    42   0.041
gi|48782617|ref|ZP_00279123.1| COG1680: Beta-lactamase class C a...    41   0.054
gi|11544701|emb|CAC17623.1| beta-lactamase class C [Ochrobactrum...    41   0.054
gi|21225825|ref|NP_631604.1| putative esterase [Streptomyces coe...    41   0.054
gi|42782558|ref|NP_979805.1| penicillin-binding protein, putativ...    41   0.054
gi|4210926|gb|AAD12161.1| dipeptidil carboxypeptidase [Streptomy...    41   0.054
gi|5420303|emb|CAB37344.2| hypothetical protein [Streptomyces fr...    41   0.054
gi|42781358|ref|NP_978605.1| penicillin-binding protein, putativ...    41   0.071
gi|48727636|gb|AAT46120.1| beta-lactamase [Enterobacter cloacae]       41   0.071
gi|46140649|ref|ZP_00152258.2| COG1680: Beta-lactamase class C a...    41   0.071
gi|21401102|ref|NP_657087.1| beta-lactamase, Beta-lactamase [Bac...    41   0.071
gi|42561393|ref|NP_975844.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    41   0.071
gi|42561380|ref|NP_975831.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    41   0.071
gi|41971|emb|CAA30879.1| beta-lactamase precursor [Enterobacter ...    41   0.071
gi|3097069|emb|CAA06639.1| AmpC-type beta-lactamase [Enterobacte...    41   0.071
gi|67776|pir||PNKBM beta-lactamase (EC 3.5.2.6) precursor - Ente...    41   0.071
gi|9294816|gb|AAF86691.1| AMPC cephalosporinase ACC-2 [Hafnia al...    40   0.092
gi|1060878|dbj|BAA07922.1| class C beta-lactamase precursor [Ent...    40   0.092
gi|29832321|ref|NP_826955.1| putative esterase [Streptomyces ave...    40   0.092
gi|47168783|pdb|1RGZ|A Chain A, Enterobacter Cloacae Gc1 Class C...    40   0.092
gi|15896063|ref|NP_349412.1| Beta-lactamase class C domain (PBPX...    40   0.092
gi|7619811|dbj|BAA94704.1| D-Amino acid amidase [Ochrobactrum an...    40   0.092
gi|5822076|pdb|1GCE|A Chain A, Structure Of The Beta-Lactamase O...    40   0.092
gi|10178867|emb|CAC08444.1| class C beta-lactamase [Enterobacter...    40   0.092
gi|49477771|ref|YP_036679.1| conserved hypothetical protein, pos...    40   0.092
gi|2598415|emb|CAA75610.1| beta-lactamase LAT-3 protein [Escheri...    40   0.092
gi|15705879|gb|AAL05857.1| beta-lactamase AmpC precursor [Entero...    40   0.092
gi|22213626|gb|AAM93473.1| beta-lactamase; AmpC [Enterobacter cl...    40   0.092
gi|10178870|emb|CAC08446.1| class C beta-lactamase [Enterobacter...    40   0.092
gi|15705875|gb|AAL05855.1| beta-lactamase AmpC precursor [Entero...    40   0.092
gi|27802509|gb|AAO21212.1| beta-lactamase [Yersinia bercovieri]        40   0.12
gi|50842989|ref|YP_056216.1| putative 6-aminohexanoate-dimer hyd...    40   0.12
gi|48825710|ref|ZP_00286950.1| COG1680: Beta-lactamase class C a...    40   0.12
gi|34496765|ref|NP_900980.1| beta-lactamase [Chromobacterium vio...    40   0.12
gi|21243784|ref|NP_643366.1| beta-lactamase [Xanthomonas axonopo...    40   0.12
gi|11544699|emb|CAC17622.1| beta-lactamase class C [Ochrobactrum...    40   0.12
gi|67777|pir||PNKBQ beta-lactamase (EC 3.5.2.6) precursor - Ente...    40   0.12
gi|46015735|pdb|1S6R|A Chain A, 908r Class C Beta-Lactamase Boun...    40   0.12
gi|33241019|ref|NP_875961.1| Beta-lactamase class C and other pe...    40   0.16
gi|24379342|ref|NP_721297.1| putative penicillin-binding protein...    40   0.16
gi|15841192|ref|NP_336229.1| penicillin-binding protein 4 [Mycob...    40   0.16
gi|18376595|emb|CAC85359.1| beta-lactamase [Enterobacter dissolv...    40   0.16
gi|11544705|emb|CAC17625.1| beta-lactamase class C [Ochrobactrum...    40   0.16
gi|15608868|ref|NP_216246.1| hypothetical protein Rv1730c [Mycob...    40   0.16
gi|21220752|ref|NP_626531.1| possible secreted esterase [Strepto...    40   0.16
gi|33089940|gb|AAP93850.1| beta-lactamase [Enterobacter cloacae]       40   0.16
gi|17432186|emb|CAC85157.1| AmpC beta-lactamase [Enterobacter as...    40   0.16
gi|46315694|ref|ZP_00216275.1| COG1680: Beta-lactamase class C a...    39   0.21
gi|16125749|ref|NP_420313.1| conserved hypothetical protein [Cau...    39   0.21
gi|27380403|ref|NP_771932.1| blr5292 [Bradyrhizobium japonicum U...    39   0.21
gi|1345941|sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptida...    39   0.21
gi|1127200|pdb|3PTE|  The Refined Crystallographic Structure Of ...    39   0.21
gi|28558952|ref|NP_788212.1| RC225 [Ruegeria sp. PR1b] >gnl|BL_O...    39   0.21
gi|46366167|ref|ZP_00191524.2| COG1680: Beta-lactamase class C a...    39   0.27
gi|29150698|gb|AAO64361.1| beta-lactamase [Yokenella regensburgei]     39   0.27
gi|46431530|gb|EAK91081.1| hypothetical protein CaO19.376 [Candi...    39   0.27
gi|46431548|gb|EAK91098.1| hypothetical protein CaO19.8008 [Cand...    39   0.27
gi|6724239|gb|AAF26905.1| unknown [Polyangium cellulosum]              39   0.27
gi|46366909|ref|ZP_00192227.3| COG1680: Beta-lactamase class C a...    39   0.27
gi|27382094|ref|NP_773623.1| blr6983 [Bradyrhizobium japonicum U...    39   0.27
gi|46314939|ref|ZP_00215523.1| COG1680: Beta-lactamase class C a...    39   0.35
gi|20806739|ref|NP_621910.1| Beta-lactamase class C and other pe...    39   0.35
gi|16801096|ref|NP_471364.1| similar to peptidase [Listeria inno...    39   0.35
gi|48848754|ref|ZP_00302999.1| COG1680: Beta-lactamase class C a...    39   0.35
gi|16127316|ref|NP_421880.1| conserved hypothetical protein [Cau...    39   0.35
gi|7258342|emb|CAB77444.1| beta-lactamase class C [Acinetobacter...    39   0.35
gi|38195949|gb|AAR13676.1| beta-lactamase [Acinetobacter baumannii]    39   0.35
gi|37524184|ref|NP_927528.1| hypothetical protein [Photorhabdus ...    39   0.35
gi|21400461|ref|NP_656446.1| hypothetical protein predicted by G...    39   0.35
gi|4827075|gb|AAC45086.2| beta-lactamase ACT-1 [Klebsiella pneum...    39   0.35
gi|39935876|ref|NP_948152.1| Beta-lactamase [Rhodopseudomonas pa...    39   0.35
gi|29828325|ref|NP_822959.1| hypothetical protein SAV1783 [Strep...    39   0.35
gi|47096499|ref|ZP_00234091.1| peptidase, putative [Listeria mon...    38   0.46
gi|50086547|ref|YP_048057.1| beta-lactamase class C [Acinetobact...    38   0.46
gi|27381951|ref|NP_773480.1| blr6840 [Bradyrhizobium japonicum U...    38   0.46
gi|38141539|emb|CAE53429.1| putative alkaline D-stereospecific e...    38   0.46
gi|30262645|ref|NP_845022.1| alkaline D-peptidase [Bacillus anth...    38   0.46
gi|49477818|ref|YP_036766.1| alkaline D-peptidase (D-stereospeci...    38   0.46
gi|21400552|ref|NP_656537.1| hypothetical protein predicted by G...    38   0.46
gi|50096079|gb|AAT70411.1| ADC-7 beta-lactamase precursor; cepha...    38   0.46
gi|32436408|emb|CAE00827.1| beta-lactamase [Acinetobacter genomo...    38   0.46
gi|37524186|ref|NP_927530.1| hypothetical protein [Photorhabdus ...    38   0.46
gi|26246375|ref|NP_752414.1| Penicillin-binding protein ampH [Es...    38   0.46
gi|3395665|dbj|BAA32077.1| ampC [Enterobacter cloacae]                 38   0.46
gi|28625511|gb|AAO42602.1| beta-lactamase Mir2 [Enterobacter clo...    38   0.46
gi|4558519|gb|AAD22636.1| beta-lactamase [Klebsiella pneumoniae]       38   0.46
gi|22972320|ref|ZP_00019205.1| hypothetical protein [Chloroflexu...    38   0.46
gi|50424337|ref|XP_460755.1| unnamed protein product [Debaryomyc...    38   0.60
gi|27467672|ref|NP_764309.1| autolysis and methicillin resistant...    38   0.60
gi|40548852|gb|AAR87489.1| AmpC [Klebsiella pneumoniae]                38   0.60
gi|2853122|emb|CAA76196.1| beta-lactamase class C [Salmonella en...    38   0.60
gi|40781702|emb|CAF04713.1| beta-lactamase, class C [Morganella ...    38   0.60
gi|6225051|sp|P94958|AMPC_MORMO Beta-lactamase precursor (Cephal...    38   0.60
gi|29569155|gb|AAO84036.1| beta-lactamase class C [Morganella mo...    38   0.60
gi|50425851|ref|XP_461522.1| unnamed protein product [Debaryomyc...    38   0.60
gi|42782125|ref|NP_979372.1| alkaline D-peptidase [Bacillus cere...    38   0.60
gi|30021128|ref|NP_832759.1| D-alanyl-D-alanine carboxypeptidase...    38   0.60
gi|30171154|gb|AAO59457.1| beta-lactamase [Acinetobacter baumannii]    38   0.60
gi|30407691|gb|AAP30025.1| esterase [Pseudomonas chlororaphis]         38   0.60
gi|30171147|gb|AAO43172.1| beta-lactamase; Aba-1 [Oligella ureth...    38   0.60
gi|30171152|gb|AAO59456.1| beta-lactamase [Acinetobacter baumannii]    38   0.60
gi|15800102|ref|NP_286114.1| putative enzyme [Escherichia coli O...    38   0.60
gi|1657571|gb|AAB18099.1| hypothetical protein in sbmA 3' region...    38   0.60
gi|41407211|ref|NP_960047.1| hypothetical protein MAP1113c [Myco...    38   0.60
gi|46908149|ref|YP_014538.1| peptidase, putative [Listeria monoc...    37   0.78
gi|47093833|ref|ZP_00231578.1| peptidase, putative [Listeria mon...    37   0.78
gi|30020597|ref|NP_832228.1| D-alanyl-D-alanine carboxypeptidase...    37   0.78
gi|42781640|ref|NP_978887.1| penicillin-binding protein, putativ...    37   0.78
gi|48890972|ref|ZP_00324563.1| COG1680: Beta-lactamase class C a...    37   0.78
gi|999836|pdb|2BLT|A Chain A, Beta-Lactamase (E.C.3.5.2.6) (Ceph...    37   0.78
gi|38141541|emb|CAE53430.1| D-stereospecific endopeptidase [Baci...    37   0.78
gi|11527187|gb|AAG36927.1| cephalosporinase DHA-2 [Klebsiella pn...    37   0.78
gi|24111682|ref|NP_706192.1| putative enzyme [Shigella flexneri ...    37   0.78
gi|113727|sp|P05364|AMPC_ENTCL Beta-lactamase precursor (Cephalo...    37   0.78
gi|39933537|ref|NP_945813.1| putative esterase [Rhodopseudomonas...    37   1.0
gi|38141543|emb|CAE53431.1| D-stereospecific endopeptidase [Baci...    37   1.0
gi|47568609|ref|ZP_00239307.1| beta-lactamase [Bacillus cereus G...    37   1.0
gi|29377077|ref|NP_816231.1| conserved hypothetical protein [Ent...    37   1.0
gi|49125996|ref|XP_412699.1| hypothetical protein AN8562.2 [Aspe...    37   1.3
gi|47574396|ref|ZP_00244432.1| COG1680: Beta-lactamase class C a...    37   1.3
gi|28378656|ref|NP_785548.1| serine-type D-Ala-D-Ala carboxypept...    37   1.3
gi|37524189|ref|NP_927533.1| hypothetical protein [Photorhabdus ...    37   1.3
gi|40781704|emb|CAF04714.1| beta-lactamase, class C [Morganella ...    37   1.3
gi|46559328|dbj|BAD16740.1| beta-lactamase precursor [Chromohalo...    37   1.3
gi|18376627|emb|CAC95129.2| beta-lactamase [Enterobacter cancero...    37   1.3
gi|48870018|ref|ZP_00322750.1| COG1680: Beta-lactamase class C a...    37   1.3
gi|20136437|gb|AAM11666.1| AmpC [Enterobacter cancerogenus]            37   1.3
gi|2499154|sp|Q45129|YGRA_BACPF Hypothetical 37.7 kDa protein in...    36   1.7
gi|23468582|ref|ZP_00123917.1| COG1680: Beta-lactamase class C a...    36   1.7
gi|16125814|ref|NP_420378.1| conserved hypothetical protein [Cau...    36   1.7
gi|39996480|ref|NP_952431.1| beta-lactamase [Geobacter sulfurred...    36   1.7
gi|14600642|ref|NP_147159.1| beta-lactamase [Aeropyrum pernix K1...    36   1.7
gi|7529645|emb|CAA43847.1| triacylglycerol lipase [Pseudomonas s...    36   1.7
gi|46102717|ref|XP_380233.1| hypothetical protein FG00057.1 [Gib...    36   1.7
gi|15614830|ref|NP_243133.1| penicillin-binding protein [Bacillu...    36   2.3
gi|46119888|ref|XP_384989.1| hypothetical protein FG04813.1 [Gib...    36   2.3
gi|16127420|ref|NP_421984.1| conserved hypothetical protein [Cau...    36   2.3
gi|29347849|ref|NP_811352.1| beta-N-acetylglucosaminidase [Bacte...    36   2.3
gi|16759353|ref|NP_454970.1| penicillin-binding protein AmpH [Sa...    36   2.3
gi|16803955|ref|NP_465440.1| similar to peptidase [Listeria mono...    35   3.0
gi|16125122|ref|NP_419686.1| conserved hypothetical protein [Cau...    35   3.0
gi|48871178|ref|ZP_00323894.1| COG1680: Beta-lactamase class C a...    35   3.0
gi|3915467|sp|P77619|YFEW_ECOLI Hypothetical UPF0214 protein yfe...    35   3.9
gi|21225787|ref|NP_631566.1| putative secreted peptidase [Strept...    35   3.9
gi|48851089|ref|ZP_00305331.1| COG1680: Beta-lactamase class C a...    35   3.9
gi|27375926|ref|NP_767455.1| blr0815 [Bradyrhizobium japonicum U...    35   3.9
gi|16077235|ref|NP_388048.1| ybbE [Bacillus subtilis subsp. subt...    35   3.9
gi|16130355|ref|NP_416925.1| putative beta-lactamase; putative b...    35   3.9
gi|46198704|ref|YP_004371.1| putative exported protein [Thermus ...    35   3.9
gi|33089938|gb|AAP93849.1| beta-lactamase [Enterobacter cloacae]       35   3.9
gi|20530946|gb|AAM27298.1| beta-lactamase [Escherichia coli]           35   3.9
gi|29832334|ref|NP_826968.1| hypothetical protein SAV5791 [Strep...    35   3.9
gi|11992014|gb|AAG42401.1| triacylglycerol lipase [Zymomonas mob...    35   5.1
gi|24373935|ref|NP_717978.1| beta-lactamase [Shewanella oneidens...    35   5.1
gi|42522046|ref|NP_967426.1| putative penicillin-binding protein...    35   5.1
gi|16763755|ref|NP_459370.1| penicillin-binding protein [Salmone...    35   5.1
gi|4958924|dbj|BAA78097.1| 1,4-butanediol diacrylate esterase [B...    35   5.1
gi|37524187|ref|NP_927531.1| hypothetical protein [Photorhabdus ...    34   6.6
gi|29247656|gb|EAA39211.1| GLP_239_7886_10504 [Giardia lamblia A...    34   6.6
gi|15840826|ref|NP_335863.1| transesterase [Mycobacterium tuberc...    34   8.6
gi|49074794|ref|XP_401506.1| hypothetical protein UM03891.1 [Ust...    34   8.6
gi|39595190|emb|CAE60227.1| Hypothetical protein CBG03798 [Caeno...    34   8.6
gi|15608507|ref|NP_215883.1| hypothetical protein Rv1367c [Mycob...    34   8.6
gi|23023988|ref|ZP_00063214.1| COG1680: Beta-lactamase class C a...    34   8.6
gi|31792563|ref|NP_855056.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    34   8.6
gi|29832461|ref|NP_827095.1| putative secreted esterase [Strepto...    34   8.6
gi|13475563|ref|NP_107127.1| hypothetical protein mll6665 [Mesor...    34   8.6


>gi|17535191|ref|NP_496299.1| esterase A precursor family member
            (2K944) [Caenorhabditis elegans]
 gi|7506096|pir||T23809 hypothetical protein M28.6 - Caenorhabditis
            elegans
 gi|3878692|emb|CAA90128.1| Hypothetical protein M28.6 [Caenorhabditis
            elegans]
          Length = 431

 Score =  823 bits (2127), Expect = 0.0
 Identities = 407/431 (94%), Positives = 407/431 (94%)
 Frame = -1

Query: 1296 MQQFSXXXXXXXXXXXLSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE 1117
            MQQFS           LSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE
Sbjct: 1    MQQFSLLFKLFLATVLLSVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWE 60

Query: 1116 IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL 937
            IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL
Sbjct: 61   IEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKL 120

Query: 936  RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP 757
            RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP
Sbjct: 121  RYDDPVSKYWPGFGTHGRDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEP 180

Query: 756  KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR 577
            KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR
Sbjct: 181  KWAPGTKTGYHAYTFGWLVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHR 240

Query: 576  VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD 397
            VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD
Sbjct: 241  VARISTPNMLNRLDEMWTDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPD 300

Query: 396  YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG 217
            YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG
Sbjct: 301  YHRLEQAAALGMGNARSLASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHG 360

Query: 216  FFHLPIHRAXXXXXXXXXXXXXQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV 37
            FFHLPIHRA             QMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV
Sbjct: 361  FFHLPIHRAGTQFGFGHTGHGCQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSV 420

Query: 36   YDVIEQINIQS 4
            YDVIEQINIQS
Sbjct: 421  YDVIEQINIQS 431


>gi|39597399|emb|CAE59629.1| Hypothetical protein CBG03042
            [Caenorhabditis briggsae]
          Length = 428

 Score =  759 bits (1960), Expect = 0.0
 Identities = 366/411 (89%), Positives = 387/411 (94%)
 Frame = -1

Query: 1245 SVTYRFVCDRLYSNHKSDVSGFVDERFEKVREVFKKNFENGWEIEGSAFAVFVDGKKVVD 1066
            SV YRF CDRLYSNHK +++GFVDERF KVREVF KNFE GWE EGSAFAVFVDGKKVVD
Sbjct: 18   SVAYRFFCDRLYSNHKPEINGFVDERFTKVREVFMKNFEKGWESEGSAFAVFVDGKKVVD 77

Query: 1065 LWGGYADKQAARKWAEDTITVTFSTTKAAASLAVALLYEQGKLRYDDPVSKYWPGFGTHG 886
            LWGGYADKQAARKWAEDTITVTFSTTKAAA+LAVALLYEQGKL YDDPVSKYWPGFGTHG
Sbjct: 78   LWGGYADKQAARKWAEDTITVTFSTTKAAAALAVALLYEQGKLSYDDPVSKYWPGFGTHG 137

Query: 885  RDNVTINMALSHMSGMAWFDTPITEEIAADHEKMRQIIEEEEPKWAPGTKTGYHAYTFGW 706
            RDNVTI MALSHMSGMAWFDTPITEEIAADHE+MRQIIE+EEPKWAPGTKTGYHAYT+GW
Sbjct: 138  RDNVTIQMALSHMSGMAWFDTPITEEIAADHEQMRQIIEKEEPKWAPGTKTGYHAYTYGW 197

Query: 705  LVDQIVRHTDDQKRGIGQFFREEIATKLDVDYHIGLPVSEQHRVARISTPNMLNRLDEMW 526
            LVDQIVRHTDD+KRGIGQ+FREEIA+KLDVDYHIGLP+SEQHRVARISTPNMLNR+DEM
Sbjct: 198  LVDQIVRHTDDRKRGIGQYFREEIASKLDVDYHIGLPLSEQHRVARISTPNMLNRIDEML 257

Query: 525  TDVRVVKYMKSLFKLMTDHPLSHIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS 346
            TD+RV+KYMKSL KLMTDHPL+HIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS
Sbjct: 258  TDIRVLKYMKSLIKLMTDHPLAHIVKNPSWLEAVSRCTINNPDYHRLEQAAALGMGNARS 317

Query: 345  LASLFDKVNRGKLLNQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPIHRAXXXXXXXX 166
            LASLFDKV+RG+L+NQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPI+RA
Sbjct: 318  LASLFDKVSRGQLVNQATLNTISKPFVNESDFIFDDTVAKGHGFFHLPINRAGAQFGFGH 377

Query: 165  XXXXXQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQTSVYDVIEQIN 13
                 QMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQ+SVYDVIEQ+N
Sbjct: 378  TGHGCQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQSSVYDVIEQVN 428




[DB home][top]