Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= R05F9_14
         (384 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535289|ref|NP_494898.1| major Sperm Protein MSP-31, major S...   269   1e-71
gi|17542416|ref|NP_501742.1| major Sperm Protein MSP-78, Major S...   268   1e-71
gi|17543834|ref|NP_501464.1| major Sperm Protein (4J335) [Caenor...   268   2e-71
gi|17535285|ref|NP_494858.1| major Sperm Protein MSP-3, major Sp...   268   2e-71
gi|17535293|ref|NP_494888.1| major Sperm Protein MSP-33, major S...   267   3e-71
gi|17535313|ref|NP_494901.1| major Sperm Protein MSP-152, major ...   267   3e-71
gi|17541646|ref|NP_501781.1| major Sperm Protein MSP-77, Major S...   267   3e-71
gi|17543816|ref|NP_500755.1| major Sperm Protein (14.5 kD) (4G15...   267   4e-71
gi|21730213|pdb|1GRW|A Chain A, C. Elegans Major Sperm Protein >...   267   4e-71
gi|17535301|ref|NP_494970.1| major Sperm Protein MSP-49, major S...   266   5e-71
gi|17535305|ref|NP_495143.1| major Sperm Protein MSP-63, major S...   266   9e-71
gi|17537885|ref|NP_494906.1| predicted CDS, major Sperm Protein ...   265   1e-70
gi|17541634|ref|NP_500711.1| major Sperm Protein MSP-55, Major S...   265   1e-70
gi|17541624|ref|NP_501760.1| major Sperm Protein MSP-10, Major S...   265   2e-70
gi|39589839|emb|CAE60837.1| Hypothetical protein CBG04546 [Caeno...   264   3e-70
gi|39590724|emb|CAE65094.1| Hypothetical protein CBG09953 [Caeno...   263   5e-70
gi|17541380|ref|NP_501849.1| major Sperm Protein MSP-38, Major S...   263   5e-70
gi|156376|gb|AAA28115.1| major sperm protein                          263   8e-70
gi|39596870|emb|CAE59097.1| Hypothetical protein CBG02389 [Caeno...   262   1e-69
gi|39597263|emb|CAE59491.1| Hypothetical protein CBG02876 [Caeno...   262   1e-69
gi|156378|gb|AAA28116.1| major sperm protein                          261   3e-69
gi|39592203|emb|CAE75424.1| Hypothetical protein CBG23417 [Caeno...   259   7e-69
gi|39596998|emb|CAE59225.1| Hypothetical protein CBG02544 [Caeno...   258   2e-68
gi|17535291|ref|NP_494891.1| predicted CDS, major Sperm Protein ...   251   2e-66
gi|127353|sp|P13263|MSP2_ONCVO Major sperm protein 2 (MSP2) >gnl...   234   2e-61
gi|3183538|sp|P27440|MSP2_ASCSU Major sperm protein, isoform bet...   234   2e-61
gi|127350|sp|P13262|MSP1_ONCVO Major sperm protein 1 (MSP1) >gnl...   233   9e-61
gi|42627274|emb|CAF29504.1| major sperm protein [Oesophagostomum...   233   9e-61
gi|42627270|emb|CAF29502.1| major sperm protein [Oesophagostomum...   231   3e-60
gi|42627268|emb|CAF29501.1| major sperm protein [Oesophagostomum...   230   6e-60
gi|2506876|sp|P27439|MSP1_ASCSU Major sperm protein, isoform alp...   228   2e-59
gi|42627276|emb|CAF29505.1| major sperm protein [Oesophagostomum...   228   2e-59
gi|1942980|pdb|1MSP|A Chain A, Major Sperm Protein, Alpha Isofor...   226   6e-59
gi|255455|gb|AAB23264.1| major sperm protein alpha isoform, alph...   224   4e-58
gi|3114299|pdb|2MSP|A Chain A, Major Sperm Protein, Beta Isoform...   224   4e-58
gi|39589838|emb|CAE60836.1| Hypothetical protein CBG04545 [Caeno...   223   7e-58
gi|39589556|emb|CAE66791.1| Hypothetical protein CBG12151 [Caeno...   221   3e-57
gi|39597192|emb|CAE59419.1| Hypothetical protein CBG02788 [Caeno...   211   3e-54
gi|12055875|emb|CAC20742.1| major sperm protein [Onchocerca volv...   197   4e-50
gi|12055873|emb|CAC20741.1| major sperm protein [Onchocerca volv...   196   7e-50
gi|39585146|emb|CAE57389.1| Hypothetical protein CBG00337 [Caeno...   167   1e-49
gi|12055879|emb|CAC20709.1| major sperm protein [Mansonella ozza...   195   2e-49
gi|12055871|emb|CAC20740.1| major sperm protein [Onchocerca volv...   195   2e-49
gi|12055867|emb|CAC20738.1| major sperm protein [Onchocerca volv...   195   2e-49
gi|12055899|emb|CAC20719.1| major sperm protein [Mansonella ozza...   194   3e-49
gi|12055895|emb|CAC20717.1| major sperm protein [Mansonella ozza...   193   6e-49
gi|12055887|emb|CAC20713.1| major sperm protein [Mansonella ozza...   193   6e-49
gi|12055877|emb|CAC20708.1| major sperm protein [Mansonella ozza...   193   8e-49
gi|12055869|emb|CAC20739.1| major sperm protein [Onchocerca volv...   192   1e-48
gi|12055891|emb|CAC20715.1| major sperm protein [Mansonella ozza...   192   1e-48
gi|12055907|emb|CAC20723.1| major sperm protein [Mansonella ozza...   192   2e-48
gi|12055893|emb|CAC20716.1| major sperm protein [Mansonella ozza...   192   2e-48
gi|12055905|emb|CAC20722.1| major sperm protein [Mansonella ozza...   191   2e-48
gi|39590722|emb|CAE65092.1| Hypothetical protein CBG09951 [Caeno...   168   3e-45
gi|1709138|sp|P53022|MSP2_GLORO Major sperm protein 2 >gnl|BL_OR...   173   8e-43
gi|1709136|sp|P53021|MSP1_GLORO Major sperm protein 1 >gnl|BL_OR...   170   5e-42
gi|17544364|ref|NP_502908.1| major Sperm Protein family member (...   170   7e-42
gi|17541610|ref|NP_502824.1| major Sperm Protein family member (...   170   7e-42
gi|1709139|sp|P53023|MSP3_GLORO Major sperm protein 3 >gnl|BL_OR...   169   2e-41
gi|17534493|ref|NP_494960.1| major Sperm Protein (8.7 kD) (2F448...   166   8e-41
gi|1373359|gb|AAB02251.1| major sperm protein                         143   9e-34
gi|39593483|emb|CAE61775.1| Hypothetical protein CBG05735 [Caeno...   143   9e-34
gi|451224|gb|AAB27962.1| diagnostic antigen [Dictyocaulus vivipa...   111   9e-34
gi|17544384|ref|NP_502992.1| predicted CDS, major Sperm Protein ...   140   8e-33
gi|17544392|ref|NP_502995.1| major Sperm Protein (4R769) [Caenor...   140   8e-33
gi|17538101|ref|NP_495165.1| major Sperm Protein family member (...   138   2e-32
gi|1373308|gb|AAB02239.1| major sperm protein >gnl|BL_ORD_ID|869...   136   1e-31
gi|1373357|gb|AAB02250.1| major sperm protein                         132   2e-30
gi|39583946|emb|CAE64036.1| Hypothetical protein CBG08633 [Caeno...   132   2e-30
gi|1373312|gb|AAB02241.1| major sperm protein                         124   3e-28
gi|1373355|gb|AAB02249.1| major sperm protein                         123   1e-27
gi|17565914|ref|NP_506636.1| predicted CDS, major Sperm Protein ...   122   2e-27
gi|1373314|gb|AAB02242.1| major sperm protein                         118   2e-26
gi|39589548|emb|CAE66783.1| Hypothetical protein CBG12140 [Caeno...    98   4e-20
gi|39579270|emb|CAE56957.1| Hypothetical protein CBG24807 [Caeno...    97   6e-20
gi|17539072|ref|NP_502434.1| major Sperm Protein family member (...    87   6e-17
gi|39587522|emb|CAE58460.1| Hypothetical protein CBG01600 [Caeno...    86   2e-16
gi|39594774|emb|CAE70642.1| Hypothetical protein CBG17343 [Caeno...    83   1e-15
gi|39593170|emb|CAE64639.1| Hypothetical protein CBG09401 [Caeno...    75   3e-13
gi|39585546|emb|CAE65306.1| Hypothetical protein CBG10225 [Caeno...    69   2e-11
gi|2499127|sp|Q16943|VP33_APLCA Vesicle-associated membrane prot...    57   1e-07
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U...    54   7e-07
gi|48138819|ref|XP_393426.1| similar to vesicle-associated membr...    52   3e-06
gi|39595297|emb|CAE60334.1| Hypothetical protein CBG03926 [Caeno...    50   8e-06
gi|42734418|ref|NP_956212.2| Unknown (protein for MGC:65776); wu...    49   2e-05
gi|38303797|gb|AAH61951.1| Zgc:77382 protein [Danio rerio]             49   2e-05
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s...    49   3e-05
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom...    49   3e-05
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein...    49   3e-05
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein...    49   3e-05
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein...    47   9e-05
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt...    47   9e-05
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,...    47   1e-04
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu...    47   1e-04
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb...    46   2e-04
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_...    46   2e-04
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus]      46   2e-04
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus]     46   2e-04
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus]     45   3e-04
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n...    44   6e-04
gi|17538762|ref|NP_501084.1| putative protein (4H777) [Caenorhab...    44   7e-04
gi|45360485|ref|NP_988905.1| hypothetical protein MGC76271 [Xeno...    43   0.002
gi|7677066|gb|AAF67013.1| VAMP-associated 33 kDa protein [Homo s...    42   0.003
gi|49328137|gb|AAT58835.1| 'unknown protein, contains major sper...    42   0.003
gi|27371213|gb|AAH41550.1| MGC53868 protein [Xenopus laevis]           41   0.006
gi|47086745|ref|NP_997812.1| vesicle-associated membrane protein...    40   0.008
gi|31543940|ref|NP_062780.2| vesicle-associated membrane protein...    40   0.008
gi|11177880|ref|NP_068619.1| VAMP-associated protein B; vesicle-...    40   0.008
gi|24638341|sp|Q9QY76|VAPB_MOUSE Vesicle-associated membrane pro...    40   0.011
gi|1373413|gb|AAB02262.1| Ppmsp-4                                      40   0.011
gi|17507123|ref|NP_491704.1| VAMP-associated protein (26.9 kD) (...    40   0.014
gi|47220459|emb|CAG03239.1| unnamed protein product [Tetraodon n...    39   0.018
gi|39595373|emb|CAE60411.1| Hypothetical protein CBG04017 [Caeno...    39   0.031
gi|33328907|gb|AAQ09860.1| CG7919 [Drosophila yakuba]                  38   0.054
gi|42761338|dbj|BAD11591.1| 27k vesicle-associated membrane prot...    35   0.45
gi|17510227|ref|NP_493034.1| heat shock factor 2 (1M562) [Caenor...    34   0.59
gi|11994635|dbj|BAB02787.1| unnamed protein product [Arabidopsis...    33   1.0
gi|38345482|emb|CAE01696.2| OSJNBa0010H02.20 [Oryza sativa (japo...    33   1.0
gi|15238034|ref|NP_199529.1| vesicle-associated membrane family ...    33   1.0
gi|15232143|ref|NP_189369.1| zinc finger (C3HC4-type RING finger...    33   1.0
gi|37536644|ref|NP_922624.1| putative membrane protein [Oryza sa...    33   1.0
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ...    33   1.0
gi|18415696|ref|NP_567627.1| vesicle-associated membrane family ...    33   1.3
gi|29247880|gb|EAA39429.1| GLP_762_1744_6912 [Giardia lamblia AT...    33   1.3
gi|42661013|ref|XP_377407.1| similar to hypothetical protein 473...    33   1.3
gi|14140121|emb|CAC39038.1| putative vesicle-associated membrane...    33   1.3
gi|49387510|dbj|BAD24975.1| putative vesicle-associated membrane...    33   1.3
gi|42572975|ref|NP_974584.1| vesicle-associated membrane family ...    33   1.3
gi|8809582|dbj|BAA97133.1| membrane associated protein [Arabidop...    32   2.2
gi|24660611|ref|NP_524657.2| CG7919-PA [Drosophila melanogaster]...    32   2.2
gi|50255293|gb|EAL18028.1| hypothetical protein CNBK0490 [Crypto...    32   2.2
gi|1373417|gb|AAB02264.1| Ppmsp-6                                      32   2.2
gi|38102501|gb|EAA49335.1| hypothetical protein MG00993.4 [Magna...    32   2.2
gi|18423592|ref|NP_568804.1| vesicle-associated membrane family ...    32   2.2
gi|16127790|ref|NP_422354.1| response regulator/sensor histidine...    32   2.9
gi|50549933|ref|XP_502438.1| hypothetical protein [Yarrowia lipo...    32   2.9
gi|45198558|ref|NP_985587.1| AFR040Wp [Eremothecium gossypii] >g...    32   3.8
gi|46314906|ref|ZP_00215490.1| COG3938: Proline racemase [Burkho...    32   3.8
gi|46321091|ref|ZP_00221471.1| COG0611: Thiamine monophosphate k...    32   3.8
gi|50759754|ref|XP_417766.1| PREDICTED: similar to glutamate rec...    31   5.0
gi|19552739|ref|NP_600741.1| ABC-type transporter, ATPase compon...    31   5.0
gi|34901800|ref|NP_912246.1| hypothetical protein [Oryza sativa ...    31   5.0
gi|37675744|ref|NP_936140.1| hypothetical protein VVA0084 [Vibri...    31   6.5
gi|34911150|ref|NP_916922.1| B1144G04.22 [Oryza sativa (japonica...    31   6.5
gi|49093614|ref|XP_408268.1| hypothetical protein AN4131.2 [Aspe...    31   6.5
gi|17509787|ref|NP_491010.1| major sperm protein  domain contain...    31   6.5
gi|50549925|ref|XP_502434.1| hypothetical protein [Yarrowia lipo...    30   8.5
gi|11289272|pir||T49483 hypothetical protein B14D6.350 [imported...    30   8.5
gi|41017498|sp|Q8WNM1|PGHD_GORGO Prostaglandin-H2 D-isomerase pr...    30   8.5
gi|13475700|ref|NP_107267.1| hypothetical protein mll6838 [Mesor...    30   8.5
gi|29832266|ref|NP_826900.1| putative acyl-CoA synthetase, long-...    30   8.5


>gi|17535289|ref|NP_494898.1| major Sperm Protein MSP-31, major
           Sperm Protein (14.2 kD) (msp-31) [Caenorhabditis
           elegans]
 gi|17535295|ref|NP_494865.1| major Sperm Protein MSP-40, major
           Sperm Protein (14.2 kD) (msp-40) [Caenorhabditis
           elegans]
 gi|17535299|ref|NP_494959.1| major Sperm Protein MSP-45, major
           Sperm Protein (14.2 kD) (msp-45) [Caenorhabditis
           elegans]
 gi|17535303|ref|NP_494972.1| major Sperm Protein, Major Sperm
           Protein MSP-50 (14.2 kD) (msp-50) [Caenorhabditis
           elegans]
 gi|17535307|ref|NP_495149.1| major Sperm Protein MSP-64, major
           Sperm Protein (14.2 kD) (msp-64) [Caenorhabditis
           elegans]
 gi|17535311|ref|NP_495144.1| major Sperm Protein MSP-142, major
           Sperm Protein (14.2 kD) (msp-142) [Caenorhabditis
           elegans]
 gi|17541626|ref|NP_500760.1| major Sperm Protein MSP-19, Major
           Sperm Protein (14.2 kD) (msp-19) [Caenorhabditis
           elegans]
 gi|17541630|ref|NP_500771.1| major Sperm Protein MSP-51, Major
           Sperm Protein (14.2 kD) (msp-51) [Caenorhabditis
           elegans]
 gi|17541632|ref|NP_500714.1| major Sperm Protein MSP-53, Major
           Sperm Protein (14.2 kD) (msp-53) [Caenorhabditis
           elegans]
 gi|17541640|ref|NP_500778.1| major Sperm Protein MSP-59, Major
           Sperm Protein (msp-59) [Caenorhabditis elegans]
 gi|17541642|ref|NP_500780.1| major Sperm Protein MSP-65, Major
           Sperm Protein (14.2 kD) (msp-65) [Caenorhabditis
           elegans]
 gi|17541650|ref|NP_501759.1| major Sperm Protein MSP-81, Major
           Sperm Protein (14.2 kD) (msp-81) [Caenorhabditis
           elegans]
 gi|17541652|ref|NP_500773.1| major Sperm Protein MSP-113, Major
           Sperm Protein (14.2 kD) (msp-113) [Caenorhabditis
           elegans]
 gi|1709104|sp|P53017|MS19_CAEEL Major sperm protein
           19/31/40/45/50/51/53/59/61/65/81/113/142 (MSP)
 gi|25344636|pir||G88145 protein F58A6.8 [imported] - Caenorhabditis
           elegans
 gi|25344641|pir||A88165 protein ZK1248.6 [imported] -
           Caenorhabditis elegans
 gi|25344645|pir||G88686 protein msp-19 [imported] - Caenorhabditis
           elegans
 gi|25344646|pir||C88688 protein msp-113 [imported] - Caenorhabditis
           elegans
 gi|25344648|pir||H88688 protein msp-59 [imported] - Caenorhabditis
           elegans
 gi|25344650|pir||B88689 protein msp-65 [imported] - Caenorhabditis
           elegans
 gi|25344652|pir||C88689 protein msp-51 [imported] - Caenorhabditis
           elegans
 gi|25344654|pir||H88792 protein K07F5.1 [imported] - Caenorhabditis
           elegans
 gi|25344658|pir||H88146 protein C34F11.4 [imported] -
           Caenorhabditis elegans
 gi|25344660|pir||E88134 protein msp-40 [imported] - Caenorhabditis
           elegans
 gi|25344662|pir||F88138 protein MSP-31 [imported] - Caenorhabditis
           elegans
 gi|25344664|pir||D88164 protein msp-142 [imported] - Caenorhabditis
           elegans
 gi|862495|gb|AAC71087.1| Major sperm protein protein 64
           [Caenorhabditis elegans]
 gi|868174|gb|AAA68711.1| Major sperm protein protein 142
           [Caenorhabditis elegans]
 gi|1109821|gb|AAA83175.1| Major sperm protein protein 31
           [Caenorhabditis elegans]
 gi|1166627|gb|AAA85761.1| Major sperm protein protein 50
           [Caenorhabditis elegans]
 gi|1255857|gb|AAA96204.1| Major sperm protein protein 45
           [Caenorhabditis elegans]
 gi|1825631|gb|AAB42253.1| Major sperm protein protein 59
           [Caenorhabditis elegans]
 gi|1825632|gb|AAB42254.1| Major sperm protein protein 51
           [Caenorhabditis elegans]
 gi|1825633|gb|AAB42255.1| Major sperm protein protein 113
           [Caenorhabditis elegans]
 gi|1825634|gb|AAB42256.1| Major sperm protein protein 65
           [Caenorhabditis elegans]
 gi|3329619|gb|AAC26926.1| Major sperm protein protein 19
           [Caenorhabditis elegans]
 gi|3878316|emb|CAA94282.1| C. elegans MSP-81 protein (corresponding
           sequence K07F5.1) [Caenorhabditis elegans]
 gi|13592379|gb|AAK31477.1| Major sperm protein protein 40
           [Caenorhabditis elegans]
 gi|15150686|gb|AAK85493.1| Major sperm protein protein 53
           [Caenorhabditis elegans]
          Length = 127

 Score =  269 bits (687), Expect = 1e-71
 Identities = 127/127 (100%), Positives = 127/127 (100%)
 Frame = -1

Query: 384 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 205
           MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
Sbjct: 1   MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 60

Query: 204 GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 25
           GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
Sbjct: 61  GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 120

Query: 24  LPIEYNP 4
           LPIEYNP
Sbjct: 121 LPIEYNP 127


>gi|17542416|ref|NP_501742.1| major Sperm Protein MSP-78, Major
           Sperm Protein (14.2 kD) (msp-78) [Caenorhabditis
           elegans]
 gi|24638054|sp|Q94053|MS78_CAEEL Major sperm protein 78 (MSP)
 gi|7507783|pir||T24885 hypothetical protein T13F2.11 -
           Caenorhabditis elegans
 gi|3879838|emb|CAB03362.1| Hypothetical protein T13F2.11
           [Caenorhabditis elegans]
          Length = 127

 Score =  268 bits (686), Expect = 1e-71
 Identities = 126/127 (99%), Positives = 127/127 (99%)
 Frame = -1

Query: 384 MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 205
           MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
Sbjct: 1   MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC 60

Query: 204 GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN 25
           GVLDPKEAVLLAVSCDAFAFGQEDTNNDRIT+EWTNTPDGAAKQFRREWFQGDGMVRRKN
Sbjct: 61  GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITIEWTNTPDGAAKQFRREWFQGDGMVRRKN 120

Query: 24  LPIEYNP 4
           LPIEYNP
Sbjct: 121 LPIEYNP 127




[DB home][top]