Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R05H5_6
(1245 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535461|ref|NP_496201.1| tyrosine kinase family member (2K48... 752 0.0
gi|39589124|emb|CAE57857.1| Hypothetical protein CBG00895 [Caeno... 589 e-167
gi|17538708|ref|NP_499953.1| tyrosine kinase family member (4B34... 538 e-152
gi|39597066|emb|CAE59293.1| Hypothetical protein CBG02628 [Caeno... 528 e-148
gi|17511023|ref|NP_491913.1| tyrosine protein kinase similar to ... 520 e-146
gi|7510847|pir||T29770 hypothetical protein ZC581.7 - Caenorhabd... 507 e-142
gi|39583632|emb|CAE65736.1| Hypothetical protein CBG10819 [Caeno... 392 e-107
gi|39582590|emb|CAE63909.1| Hypothetical protein CBG08480 [Caeno... 201 2e-50
gi|17505883|ref|NP_492826.1| SH2 motif and protein kinase family... 199 1e-49
gi|17539452|ref|NP_500846.1| fer (fps/fes related) tyrosine prot... 199 1e-49
gi|17506773|ref|NP_490975.1| SH2 motif and protein kinase family... 194 3e-48
gi|39595891|emb|CAE67394.1| Hypothetical protein CBG12879 [Caeno... 194 5e-48
gi|17538768|ref|NP_501081.1| SH2 motif and protein kinase family... 193 8e-48
gi|17537903|ref|NP_494994.1| tyrosine kinase (2F585) [Caenorhabd... 192 1e-47
gi|39582584|emb|CAE63903.1| Hypothetical protein CBG08474 [Caeno... 192 1e-47
gi|39584908|emb|CAE64332.1| Hypothetical protein CBG09015 [Caeno... 189 2e-46
gi|17541450|ref|NP_501793.1| SH2 motif and protein kinase family... 187 6e-46
gi|49116711|gb|AAH73445.1| Unknown (protein for MGC:80946) [Xeno... 186 8e-46
gi|4885231|ref|NP_005237.1| fer (fps/fes related) tyrosine kinas... 185 2e-45
gi|6003683|gb|AAF00543.1| protein tyrosine kinase fer [Canis fam... 184 5e-45
gi|400127|sp|P07332|FES_HUMAN Proto-oncogene tyrosine-protein ki... 184 5e-45
gi|4503687|ref|NP_001996.1| V-FES feline sarcoma viral/V-FPS fuj... 183 8e-45
gi|23452674|gb|AAN33122.1| tyrosine kinase Fps/Fes [Mus musculus] 183 8e-45
gi|209722|gb|AAA42415.1| gag-fps polyprotein 181 4e-44
gi|125366|sp|P00541|FPS_AVISP Tyrosine-protein kinase transformi... 181 4e-44
gi|66835|pir||TVCTFF protein-tyrosine kinase (EC 2.7.1.112) fes/... 181 4e-44
gi|1345986|sp|P14238|FES_FELCA Proto-oncogene tyrosine-protein k... 181 4e-44
gi|33859552|ref|NP_034324.1| feline sarcoma oncogene [Mus muscul... 180 7e-44
gi|2117867|pir||I50618 c-fps proto oncogene - chicken >gnl|BL_OR... 179 1e-43
gi|323873|gb|AAA43041.1| gag polyprotein 179 2e-43
gi|17553726|ref|NP_498511.1| SH2 motif and protein kinase family... 179 2e-43
gi|125353|sp|P00542|FES_FSVGA Tyrosine-protein kinase transformi... 179 2e-43
gi|125354|sp|P00543|FES_FSVST Tyrosine-protein kinase transformi... 178 2e-43
gi|66841|pir||OKFFPS protein-tyrosine kinase (EC 2.7.1.112), fps... 178 3e-43
gi|1245415|gb|AAA93470.1| tyrosine kinase [Drosophila melanogaster] 178 3e-43
gi|45549219|ref|NP_524288.3| CG8874-PA [Drosophila melanogaster]... 177 3e-43
gi|24645334|ref|NP_731342.1| CG8874-PC [Drosophila melanogaster]... 177 3e-43
gi|24645336|ref|NP_731343.1| CG8874-PD [Drosophila melanogaster]... 177 3e-43
gi|24645330|ref|NP_731341.1| CG8874-PB [Drosophila melanogaster]... 177 3e-43
gi|30109312|gb|AAH51249.1| Fert2 protein [Mus musculus] 175 2e-42
gi|26349973|dbj|BAC38626.1| unnamed protein product [Mus musculus] 175 2e-42
gi|34785613|gb|AAH58100.1| Fert2 protein [Mus musculus] 175 2e-42
gi|1673620|gb|AAB18988.1| Fer [Mus musculus] 175 2e-42
gi|39585622|emb|CAE65382.1| Hypothetical protein CBG10328 [Caeno... 175 2e-42
gi|40796153|ref|NP_955606.1| FBS [Fujinami sarcoma virus] >gnl|B... 174 3e-42
gi|9626155|ref|NP_056889.1| p140 polyprotein [Fujinami sarcoma v... 174 3e-42
gi|66840|pir||TVFVFS protein-tyrosine kinase (EC 2.7.1.112) fps ... 174 4e-42
gi|209689|gb|AAA42403.1| p140 transforming protein 174 4e-42
gi|6679773|ref|NP_032026.1| fer (fms/fps related) protein kinase... 172 1e-41
gi|25287726|pir||C88493 protein F57B9.8 [imported] - Caenorhabdi... 172 2e-41
gi|39595241|emb|CAE60278.1| Hypothetical protein CBG03859 [Caeno... 171 4e-41
gi|39593938|emb|CAE70048.1| Hypothetical protein CBG16480 [Caeno... 167 5e-40
gi|47230350|emb|CAF99543.1| unnamed protein product [Tetraodon n... 166 8e-40
gi|39595643|emb|CAE67145.1| Hypothetical protein CBG12568 [Caeno... 165 2e-39
gi|17540892|ref|NP_501818.1| fer oncogene Related Kinase (44.6 k... 165 2e-39
gi|39585866|emb|CAE61280.1| Hypothetical protein CBG05099 [Caeno... 165 2e-39
gi|31208911|ref|XP_313422.1| ENSANGP00000020160 [Anopheles gambi... 165 2e-39
gi|47216989|emb|CAG04931.1| unnamed protein product [Tetraodon n... 163 9e-39
gi|7548235|gb|AAA43046.2| gag polyprotein [Feline sarcoma virus] 162 1e-38
gi|3550651|emb|CAA76605.1| tyrosine kinase [Sycon raphanus] 162 1e-38
gi|17542548|ref|NP_501994.1| tyrosine kinase family member (62.0... 161 3e-38
gi|32564575|ref|NP_498912.3| SH2 motif and protein kinase family... 160 4e-38
gi|7504091|pir||T29030 hypothetical protein F53G12.6 - Caenorhab... 159 1e-37
gi|125360|sp|P09760|FLK_RAT Tyrosine-protein kinase FLK >gnl|BL_... 159 1e-37
gi|17508735|ref|NP_490680.1| defective SPErmatogenesis SPE-8, pr... 159 1e-37
gi|17541456|ref|NP_501309.1| SH2 motif and protein kinase family... 158 2e-37
gi|3002963|gb|AAC08966.1| Etk/Bmx cytosolic tyrosine kinase [Hom... 157 5e-37
gi|33303803|gb|AAQ02415.1| BMX non-receptor tyrosine kinase [syn... 156 1e-36
gi|39590755|emb|CAE65127.1| Hypothetical protein CBG09992 [Caeno... 156 1e-36
gi|4502435|ref|NP_001712.1| BMX non-receptor tyrosine kinase [Ho... 155 1e-36
gi|17542230|ref|NP_501307.1| SH2 motif and protein kinase family... 155 2e-36
gi|18150842|dbj|BAA81721.3| protein tyrosine kinase [Ephydatia f... 155 2e-36
gi|34857370|ref|XP_214974.2| similar to tyrosine kinase Fps/Fes ... 154 3e-36
gi|30145713|emb|CAB02882.2| Hypothetical protein F01D4.3 [Caenor... 154 4e-36
gi|7506080|pir||T23792 hypothetical protein M176.9 - Caenorhabdi... 153 7e-36
gi|17539630|ref|NP_501934.1| SH2 motif and protein kinase family... 153 7e-36
gi|45550738|ref|NP_650097.2| CG17309-PA [Drosophila melanogaster... 152 2e-35
gi|24646022|ref|NP_731607.1| CG17309-PB [Drosophila melanogaster... 152 2e-35
gi|40215698|gb|AAR82769.1| LP09923p [Drosophila melanogaster] 152 2e-35
gi|34880098|ref|XP_346303.1| similar to protein tyrosine kinase ... 150 5e-35
gi|6753196|ref|NP_033889.1| BMX non-receptor tyrosine kinase [Mu... 150 5e-35
gi|17544596|ref|NP_502037.1| tyrosine kinase family member (4L70... 150 8e-35
gi|17508233|ref|NP_492004.1| tyrosine kinase (kin-14) [Caenorhab... 149 1e-34
gi|31746497|gb|AAP68901.1| Fes-like tyrosine kinase protein [Sch... 146 9e-34
gi|17541454|ref|NP_501761.1| tyrosine kinase family member (kin-... 146 1e-33
gi|39587880|emb|CAE67898.1| Hypothetical protein CBG13495 [Caeno... 144 4e-33
gi|39595711|emb|CAE67214.1| Hypothetical protein CBG12650 [Caeno... 143 7e-33
gi|17544448|ref|NP_503024.1| protein kinase and SH2 motif family... 143 7e-33
gi|17544472|ref|NP_503039.1| protein kinase and SH2 motif family... 143 7e-33
gi|30145800|emb|CAB55139.2| Hypothetical protein Y116A8C.38 [Cae... 143 7e-33
gi|13242263|ref|NP_077344.1| src related tyrosine kinase [Rattus... 142 1e-32
gi|40352731|gb|AAH64688.1| MGC69056 protein [Xenopus laevis] 142 2e-32
gi|47225646|emb|CAG07989.1| unnamed protein product [Tetraodon n... 142 2e-32
gi|32563673|ref|NP_492594.2| protein kinase transforming protein... 140 5e-32
gi|50751126|ref|XP_422269.1| PREDICTED: similar to v-abl Abelson... 139 1e-31
gi|31542823|ref|NP_034367.2| fyn-related kinase; B-cell src-homo... 139 1e-31
gi|736264|emb|CAA88658.1| intestinal tyrosine kinase [Mus musculus] 139 1e-31
gi|17541902|ref|NP_500644.1| fps oncogene analog family member (... 139 2e-31
gi|38073524|ref|XP_136360.2| v-abl Abelson murine leukemia viral... 138 2e-31
gi|1174439|sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform ... 138 2e-31
gi|2117804|pir||I49552 protein-tyrosine kinase (EC 2.7.1.112) bs... 138 2e-31
gi|125133|sp|P00522|ABL_DROME Tyrosine-protein kinase Abl (D-ash... 138 2e-31
gi|24665444|ref|NP_524843.2| CG4032-PA [Drosophila melanogaster]... 138 2e-31
gi|6382060|ref|NP_005149.2| v-abl Abelson murine leukemia viral ... 138 3e-31
gi|31874804|emb|CAD98092.1| hypothetical protein [Homo sapiens] 138 3e-31
gi|42406387|gb|AAH65912.1| ABL2 protein [Homo sapiens] 138 3e-31
gi|17534145|ref|NP_493812.1| SH2 motif and protein kinase family... 138 3e-31
gi|6382062|ref|NP_009298.1| v-abl Abelson murine leukemia viral ... 138 3e-31
gi|32264368|gb|AAP78682.1| MBSRC1 [Monosiga brevicollis] 137 4e-31
gi|39586256|emb|CAE66667.1| Hypothetical protein CBG12006 [Caeno... 137 7e-31
gi|31212217|ref|XP_315093.1| ENSANGP00000002451 [Anopheles gambi... 137 7e-31
gi|33304127|gb|AAQ02571.1| fyn-related kinase [synthetic construct] 136 1e-30
gi|4503787|ref|NP_002022.1| fyn-related kinase; tyrosine-protein... 136 1e-30
gi|157176|gb|AAA28443.1| dash peptide 136 1e-30
gi|40796142|ref|NP_955595.1| ABL [Abelson murine leukemia virus]... 135 3e-30
gi|5912560|emb|CAB56204.1| unnamed protein product [Abelson muri... 135 3e-30
gi|125137|sp|P00520|ABL1_MOUSE Proto-oncogene tyrosine-protein k... 135 3e-30
gi|33859504|ref|NP_033724.1| v-abl Abelson murine leukemia oncog... 135 3e-30
gi|37590684|gb|AAH59260.1| Abl1 protein [Mus musculus] 135 3e-30
gi|514268|gb|AAB60393.1| proto-oncogene tyrosine-protein kinase ... 135 3e-30
gi|9626954|ref|NP_057866.1| p120 polyprotein [Abelson murine leu... 135 3e-30
gi|39597469|emb|CAE59699.1| Hypothetical protein CBG03127 [Caeno... 135 3e-30
gi|2144425|pir||TVHUA protein-tyrosine kinase (EC 2.7.1.112) abl... 135 3e-30
gi|514267|gb|AAB60394.1| proto-oncogene tyrosine-protein kinase ... 135 3e-30
gi|125135|sp|P00519|ABL1_HUMAN Proto-oncogene tyrosine-protein k... 135 3e-30
gi|61488|emb|CAA24781.1| oncogene v-abl [Abelson murine leukemia... 135 3e-30
gi|50757306|ref|XP_415463.1| PREDICTED: similar to Proto-oncogen... 134 3e-30
gi|220614|dbj|BAA03129.1| tyrosine kinase [Mus musculus] >gnl|BL... 134 3e-30
gi|6754386|ref|NP_034713.1| IL2-inducible T-cell kinase [Mus mus... 134 3e-30
gi|37776869|emb|CAE51198.1| src tyrosine kinase [Schistosoma man... 134 3e-30
gi|18150824|dbj|BAA81712.3| protein tyrosine kinase [Ephydatia f... 134 3e-30
gi|34871240|ref|XP_343881.1| similar to tyrosine kinase [Rattus ... 134 4e-30
gi|732528|gb|AAC50116.1| Rak 134 4e-30
gi|18858911|ref|NP_571179.1| IL2-inducible T-cell kinase; tec-fa... 134 6e-30
gi|125134|sp|P10447|ABL_FSVHY Tyrosine-protein kinase transformi... 134 6e-30
gi|18150838|dbj|BAA81719.3| protein tyrosine kinase [Ephydatia f... 134 6e-30
gi|625609|pir||A26132 gag-abl-pol polyprotein - feline sarcoma v... 134 6e-30
gi|49617834|gb|AAT67600.1| Src tyrosine kinase 2 [Suberites domu... 134 6e-30
gi|15718680|ref|NP_005537.3| IL2-inducible T-cell kinase; homolo... 133 8e-30
gi|7705029|gb|AAB28072.2| EMT [Homo sapiens] 133 8e-30
gi|9837322|gb|AAG00530.1| TEC kinase [Rattus norvegicus] 133 8e-30
gi|6382058|ref|NP_009297.1| v-abl Abelson murine leukemia viral ... 133 8e-30
gi|39595514|emb|CAE60552.1| Hypothetical protein CBG04179 [Caeno... 133 8e-30
gi|16197923|gb|AAL13726.1| LD03455p [Drosophila melanogaster] 133 8e-30
gi|33304019|gb|AAQ02517.1| IL2-inducible T-cell kinase [syntheti... 133 8e-30
gi|12655286|emb|CAC27542.1| bA702N8.1 (fyn-related kinase) [Homo... 133 8e-30
gi|4885045|ref|NP_005148.1| v-abl Abelson murine leukemia viral ... 133 8e-30
gi|10835731|pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase ... 133 8e-30
gi|30749934|pdb|1OPK|A Chain A, Structural Basis For The Auto-In... 133 1e-29
gi|41352671|gb|AAS01044.1| C-terminal Src kinase [Asterina miniata] 133 1e-29
gi|48101228|ref|XP_392652.1| similar to CG4032-PA [Apis mellifera] 133 1e-29
gi|30749935|pdb|1OPL|A Chain A, Structural Basis For The Auto-In... 133 1e-29
gi|4507429|ref|NP_003206.1| tec protein tyrosine kinase [Homo sa... 133 1e-29
gi|33304179|gb|AAQ02597.1| tec protein tyrosine kinase [syntheti... 133 1e-29
gi|17505885|ref|NP_492827.1| tyrosine kinase family member (1L38... 132 1e-29
gi|26332200|dbj|BAC29830.1| unnamed protein product [Mus musculus] 132 2e-29
gi|7499927|pir||T21417 hypothetical protein F26E4.5 - Caenorhabd... 132 2e-29
gi|38566061|gb|AAH62884.1| Tec protein [Mus musculus] 131 3e-29
gi|5453033|gb|AAD43406.1| protein tyrosine kinase TecIII [Mus mu... 131 3e-29
gi|39580736|emb|CAE64122.1| Hypothetical protein CBG08738 [Caeno... 131 3e-29
gi|7305569|ref|NP_038717.1| cytoplasmic tyrosine kinase, Dscr28C... 131 3e-29
gi|34877298|ref|XP_341209.1| similar to protein tyrosine kinase ... 131 3e-29
gi|1174631|sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec >gnl|... 131 3e-29
gi|5453029|gb|AAD43402.1| protein tyrosine kinase TecIV [Mus mus... 131 3e-29
gi|31240083|ref|XP_320455.1| ENSANGP00000009228 [Anopheles gambi... 131 4e-29
gi|49617828|gb|AAT67597.1| Src tyrosine kinase 2 [Suberites domu... 131 4e-29
gi|32490474|dbj|BAC79157.1| putative serine/threonine-protein ki... 130 5e-29
gi|25141286|ref|NP_491620.2| fps oncogene analog family member (... 130 6e-29
gi|7504726|pir||T29911 hypothetical protein F59A3.8 - Caenorhabd... 130 6e-29
gi|50744566|ref|XP_419779.1| PREDICTED: similar to src related t... 130 6e-29
gi|18151363|dbj|BAA81722.3| protein tyrosine kinase [Ephydatia f... 130 6e-29
gi|17508235|ref|NP_493502.1| src family, fyn and suppressor of p... 129 1e-28
gi|4507743|ref|NP_003319.1| TXK tyrosine kinase; PTK4 protein ty... 129 1e-28
gi|1161364|gb|AAB60412.1| tyrosine kinase 129 1e-28
gi|33304173|gb|AAQ02594.1| TXK tyrosine kinase [synthetic constr... 129 1e-28
gi|18146650|dbj|BAB82422.1| protein tyrosine kinase [Ephydatia f... 129 2e-28
gi|630739|pir||S44734 probable protein-tyrosine kinase (EC 2.7.1... 128 2e-28
gi|39581072|emb|CAE57374.1| Hypothetical protein CBG00320 [Caeno... 128 2e-28
gi|20152059|gb|AAM11389.1| LP03070p [Drosophila melanogaster] 128 2e-28
gi|25287725|pir||G88535 protein B0523.1 [imported] - Caenorhabdi... 128 2e-28
gi|21358251|ref|NP_652600.1| CG8250-PA [Drosophila melanogaster]... 128 2e-28
gi|625222|pir||TVCHSR kinase-related protein ros precursor - chi... 128 2e-28
gi|7499628|pir||T21235 hypothetical protein F22B3.8 - Caenorhabd... 128 3e-28
gi|575890|gb|AAC51347.1| Bruton's agammaglobulinemia tyrosine ki... 128 3e-28
gi|4557377|ref|NP_000052.1| Bruton agammaglobulinemia tyrosine k... 128 3e-28
gi|33304137|gb|AAQ02576.1| Bruton agammaglobulinemia tyrosine ki... 128 3e-28
gi|5453032|gb|AAD43405.1| protein tyrosine kinase TecIIB [Mus mu... 127 5e-28
gi|5453034|gb|AAD43407.1| protein tyrosine kinase TecIIA [Mus mu... 127 5e-28
gi|91867|pir||JU0215 protein-tyrosine kinase (EC 2.7.1.112) tec,... 127 5e-28
gi|37926807|pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (... 127 5e-28
gi|48106047|ref|XP_396043.1| similar to ENSANGP00000005994 [Apis... 127 5e-28
gi|125333|sp|P29317|EPA2_HUMAN Ephrin type-A receptor 2 precurso... 127 5e-28
gi|32967311|ref|NP_004422.2| ephrin receptor EphA2; epithelial c... 127 5e-28
gi|45383436|ref|NP_989691.1| protein tyrosine kinase EphA9 [Gall... 127 7e-28
gi|34555810|emb|CAA92740.3| Hypothetical protein F22B3.8 [Caenor... 127 7e-28
gi|34880173|ref|XP_347278.1| similar to protein tyrosine kinase ... 127 7e-28
gi|34877399|ref|XP_223365.2| similar to Txk [Rattus norvegicus] 127 7e-28
gi|32566413|ref|NP_502160.2| protein kinase and SH2 motif family... 127 7e-28
gi|32484983|ref|NP_034269.2| Eph receptor A2 [Mus musculus] 126 9e-28
gi|1174826|sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK (PTK-... 126 9e-28
gi|7305601|ref|NP_038726.1| TXK tyrosine kinase [Mus musculus] >... 126 9e-28
gi|2137700|pir||I48759 protein-tyrosine kinase (EC 2.7.1.112) se... 126 9e-28
gi|2114076|dbj|BAA20078.1| Lyn protein tyrosine kinase [Xenopus ... 126 9e-28
gi|34872522|ref|XP_345597.1| similar to Eph receptor A2 [Rattus ... 126 1e-27
gi|26331180|dbj|BAC29320.1| unnamed protein product [Mus musculus] 126 1e-27
gi|27721289|ref|XP_217250.1| similar to Ephrin type-B receptor 1... 126 1e-27
gi|39595195|emb|CAE60232.1| Hypothetical protein CBG03803 [Caeno... 126 1e-27
gi|56095|emb|CAA31777.1| elk protein [Rattus rattus] 126 1e-27
gi|2507603|sp|P35991|BTK_MOUSE Tyrosine-protein kinase BTK (Brut... 126 1e-27
gi|7709994|ref|NP_038510.1| Bruton agammaglobulinemia tyrosine k... 126 1e-27
gi|31419802|gb|AAH53392.1| Btk protein [Mus musculus] 126 1e-27
gi|8134450|sp|Q91736|EPBB_XENLA Ephrin type-B receptor 1B (Tyros... 125 2e-27
gi|4758284|ref|NP_004432.1| ephrin receptor EphB1 precursor; eph... 125 2e-27
gi|2117857|pir||I50128 fibroblast growth factor receptor - quail... 125 2e-27
gi|1177045|sp|P43404|ZA70_MOUSE Tyrosine-protein kinase ZAP-70 (... 125 2e-27
gi|1706570|sp|Q03145|EPA2_MOUSE Ephrin type-A receptor 2 precurs... 125 2e-27
gi|125678|sp|P08941|KROS_CHICK ROS proto-oncogene tyrosine kinas... 125 2e-27
gi|8134448|sp|Q07494|EPB1_CHICK Ephrin type-B receptor 1 (Tyrosi... 125 2e-27
gi|212637|gb|AAA49058.1| cellular-ros protein (c-ros) 125 2e-27
gi|9627733|ref|NP_042289.1| P68 protein [Avian sarcoma virus] >g... 125 2e-27
gi|4104413|gb|AAD02031.1| Eph-like receptor tyrosine kinase hEph... 125 2e-27
gi|125677|sp|P00529|KROS_AVISU Tyrosine-protein kinase transform... 125 2e-27
gi|2134387|pir||I50612 protein-tyrosine kinase (EC 2.7.1.112) Ce... 125 2e-27
gi|515871|emb|CAA51970.1| protein tyrosin kinase [Homo sapiens] 125 3e-27
gi|448916|prf||1918215A protein Tyr kinase 125 3e-27
gi|21361553|ref|NP_003168.2| spleen tyrosine kinase [Homo sapien... 125 3e-27
gi|6755706|ref|NP_035648.1| spleen tyrosine kinase [Mus musculus... 125 3e-27
gi|48138377|ref|XP_393399.1| similar to CG17309-PB [Apis mellifera] 125 3e-27
gi|34555808|emb|CAA92623.2| Hypothetical protein W01B6.5 [Caenor... 125 3e-27
gi|18420244|ref|NP_568041.1| protein kinase family protein [Arab... 125 3e-27
gi|31216963|ref|XP_316335.1| ENSANGP00000005994 [Anopheles gambi... 125 3e-27
gi|26331236|dbj|BAC29348.1| unnamed protein product [Mus musculus] 125 3e-27
gi|496900|emb|CAA82737.1| protein-tyrosine kinase [Homo sapiens]... 125 3e-27
gi|31981916|ref|NP_033565.2| zeta-chain (TCR) associated protein... 124 4e-27
gi|266436|sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK (Spleen... 124 4e-27
gi|7503796|pir||T22405 protein-tyrosine kinase (EC 2.7.1.112) F4... 124 4e-27
gi|26453338|dbj|BAC43746.1| truncated ZAP kinase [Mus musculus] 124 4e-27
gi|45383660|ref|NP_989564.1| Bruton agammaglobulinemia tyrosine ... 124 5e-27
gi|47221383|emb|CAF97301.1| unnamed protein product [Tetraodon n... 124 5e-27
gi|2425192|dbj|BAA22282.1| FGF receptor 4b [Xenopus laevis] 124 5e-27
gi|4104411|gb|AAD02030.1| Eph-like receptor tyrosine kinase hEph... 124 5e-27
gi|40714572|gb|AAR88544.1| RE17878p [Drosophila melanogaster] 124 5e-27
gi|40675709|gb|AAH65121.1| Spleen tyrosine kinase [Mus musculus] 124 5e-27
gi|1711636|sp|P48025|KSYK_MOUSE Tyrosine-protein kinase SYK (Spl... 124 5e-27
gi|9858141|gb|AAG01013.1| fibroblast growth factor receptor 4c [... 124 5e-27
gi|47213587|emb|CAF93490.1| unnamed protein product [Tetraodon n... 124 5e-27
gi|103966|pir||S19947 fibroblast growth factor receptor - Iberia... 124 6e-27
gi|477891|pir||B49151 fibroblast growth factor receptor 4 - Iber... 124 6e-27
gi|1079292|pir||JC4058 fibroblast growth factor receptor-4 precu... 124 6e-27
gi|2541908|dbj|BAA22849.1| FGF receptor 4a [Xenopus laevis] 124 6e-27
gi|50414687|gb|AAH77761.1| LOC397701 protein [Xenopus laevis] 124 6e-27
gi|39582132|emb|CAE60809.1| Hypothetical protein CBG04507 [Caeno... 124 6e-27
gi|18858679|ref|NP_571505.1| fibroblast growth factor receptor 4... 124 6e-27
gi|50730275|ref|XP_425573.1| PREDICTED: similar to Brutons tyros... 123 8e-27
gi|21730412|pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Ty... 123 8e-27
gi|50747015|ref|XP_420720.1| PREDICTED: similar to Tyrosine-prot... 123 8e-27
gi|1213275|emb|CAA61930.1| FGF receptor 4 [Xenopus laevis] 123 8e-27
gi|17136510|ref|NP_476745.1| CG8049-PB [Drosophila melanogaster]... 123 1e-26
gi|2723313|dbj|BAA24064.1| Dsrc29A type 2 protein [Drosophila me... 123 1e-26
gi|2117854|pir||JC4583 fibroblast growth factor receptor 4B prec... 123 1e-26
gi|47211144|emb|CAF96564.1| unnamed protein product [Tetraodon n... 123 1e-26
gi|2827464|gb|AAB99858.1| TEC29 [Drosophila melanogaster] 123 1e-26
gi|2723311|dbj|BAA24063.1| Dsrc29A type 1 protein [Drosophila me... 123 1e-26
gi|17136512|ref|NP_476746.1| CG8049-PA [Drosophila melanogaster]... 123 1e-26
gi|34393850|dbj|BAC83504.1| putative serine/threonine protein ki... 122 1e-26
gi|416153|gb|AAA42308.1| tyrosine kinase receptor 122 1e-26
gi|1363318|pir||A56707 protein-tyrosine kinase (EC 2.7.1.112) sy... 122 1e-26
gi|40254274|ref|NP_775623.2| Eph receptor B1; ELK homolog [Mus m... 122 1e-26
gi|47551197|ref|NP_999783.1| src-family protein tyrosine kinase ... 122 1e-26
gi|27696880|gb|AAH43783.1| MGC53012 protein [Xenopus laevis] 122 1e-26
gi|34901608|ref|NP_912150.1| P0571D04.18 [Oryza sativa (japonica... 122 1e-26
gi|49617830|gb|AAT67598.1| Src tyrosine kinase 3 [Suberites domu... 122 1e-26
gi|48099473|ref|XP_392586.1| similar to CG10244-PA [Apis mellifera] 122 1e-26
gi|2137726|pir||I48974 receptor-protein tyrosine kinase - mouse ... 122 1e-26
gi|39583828|emb|CAE74901.1| Hypothetical protein CBG22767 [Caeno... 122 1e-26
gi|552072|gb|AAA28129.1| abl-like putative oncogene; putative [C... 122 2e-26
gi|7506130|pir||T23832 protein-tyrosine kinase (EC 2.7.1.112) ab... 122 2e-26
gi|34555831|emb|CAA94238.2| Hypothetical protein W08D2.8 [Caenor... 122 2e-26
gi|39583248|emb|CAE60040.1| Hypothetical protein CBG03551 [Caeno... 122 2e-26
gi|17541452|ref|NP_501758.1| protein kinase and SH2 motif family... 122 2e-26
gi|23510362|ref|NP_694592.1| protein-tyrosine kinase fyn isoform... 122 2e-26
gi|25147104|ref|NP_509778.2| related to oncogene ABL (138.3 kD) ... 122 2e-26
gi|251793|gb|AAB22579.1| srk1 protein kinase=src-related tyrosin... 122 2e-26
gi|30017393|ref|NP_835185.1| sterile-alpha motif and leucine zip... 122 2e-26
gi|22329194|ref|NP_195303.2| protein kinase family protein [Arab... 122 2e-26
gi|25147108|ref|NP_509777.2| related to oncogene ABL (abl-1) [Ca... 122 2e-26
gi|3560565|gb|AAC35011.1| non-receptor protein-tyrosine kinase C... 122 2e-26
gi|25147111|ref|NP_509779.2| related to oncogene ABL (abl-1) [Ca... 122 2e-26
gi|34873797|ref|XP_344571.1| similar to Fibroblast growth factor... 122 2e-26
gi|50750442|ref|XP_421996.1| PREDICTED: similar to mixed lineage... 122 2e-26
gi|66802|pir||TVFFDS protein-tyrosine kinase (EC 2.7.1.112) src2... 122 2e-26
gi|15219517|ref|NP_177507.1| protein kinase family protein [Arab... 122 2e-26
gi|20466322|gb|AAM20478.1| putative protein kinase [Arabidopsis ... 122 2e-26
gi|46249610|gb|AAH68849.1| Unknown (protein for MGC:81509) [Xeno... 122 2e-26
gi|17136878|ref|NP_476962.1| CG4926-PA [Drosophila melanogaster]... 122 2e-26
gi|1684833|gb|AAB36538.1| tyrosine kinase [Mus musculus] 121 3e-26
gi|975277|gb|AAA75166.1| p72 121 3e-26
gi|45382883|ref|NP_990840.1| tyrosine kinase (cek2) [Gallus gall... 121 3e-26
gi|8134449|sp|Q91571|EPBA_XENLA Ephrin type-B receptor 1A precur... 121 3e-26
gi|6981620|ref|NP_036890.1| spleen tyrosine kinase [Rattus norve... 121 3e-26
gi|19526767|ref|NP_598407.1| mixed lineage kinase-related kinase... 121 4e-26
gi|294581|gb|AAA20945.1| lyn B protein tyrosine kinase [Rattus n... 121 4e-26
gi|9247171|gb|AAB33113.2| tyrosine kinase p59fyn(T) [Homo sapiens] 121 4e-26
gi|294579|gb|AAA20944.1| lyn A protein tyrosine kinase [Rattus n... 121 4e-26
gi|10798812|dbj|BAB16444.1| MLTK-alpha [Homo sapiens] 121 4e-26
gi|7706601|ref|NP_057737.1| sterile-alpha motif and leucine zipp... 121 4e-26
gi|12746436|ref|NP_075544.1| sterile-alpha motif and leucine zip... 121 4e-26
gi|7542537|gb|AAF63490.1| mixed lineage kinase ZAK [Homo sapiens] 121 4e-26
gi|9927293|dbj|BAB12040.1| plaucible mixed-lineage kinase protei... 121 4e-26
gi|10798810|dbj|BAB16443.1| MLTK-beta [Mus musculus] 121 4e-26
gi|28194039|gb|AAO33376.1| cervical cancer suppressor gene-4 pro... 121 4e-26
gi|7486654|pir||T04683 hypothetical protein F8D20.290 - Arabidop... 121 4e-26
gi|34855187|ref|XP_230983.2| similar to MLTK-beta [Rattus norveg... 120 5e-26
gi|48098662|ref|XP_394128.1| similar to ENSANGP00000006704 [Apis... 120 5e-26
gi|3005903|emb|CAA06300.1| Eph-like receptor tyrosine kinase rtk... 120 5e-26
gi|42734371|ref|NP_571490.1| eph-like receptor tyrosine kinase 6... 120 5e-26
gi|17569805|ref|NP_509104.1| growth factor receptor (122.9 kD) (... 120 5e-26
gi|17569803|ref|NP_509105.1| tyrosine kinase (116.8 kD) (XH177) ... 120 5e-26
gi|18146654|dbj|BAB82424.1| protein tyrosine kinase [Ephydatia f... 120 7e-26
gi|26326477|dbj|BAC26982.1| unnamed protein product [Mus musculus] 120 7e-26
gi|556789|emb|CAA57224.1| Embryo Brain Kinase [Mus musculus] 120 7e-26
gi|48139059|ref|XP_396962.1| similar to ENSANGP00000008377 [Apis... 120 7e-26
gi|20070702|gb|AAH26153.1| Epha7 protein [Mus musculus] 120 7e-26
gi|48097657|ref|XP_393849.1| similar to ENSANGP00000019144 [Apis... 120 7e-26
gi|4503823|ref|NP_002028.1| protein-tyrosine kinase fyn isoform ... 120 9e-26
gi|6978863|ref|NP_036887.1| fyn proto-oncogene [Rattus norvegicu... 120 9e-26
gi|346984|pir||JC1450 fibroblast growth factor receptor 4 - rat ... 120 9e-26
gi|2105002|gb|AAB71345.1| Lyn B tyrosine kinase [Rattus norvegic... 120 9e-26
gi|31201161|ref|XP_309528.1| ENSANGP00000008377 [Anopheles gambi... 120 9e-26
gi|13540677|ref|NP_110484.1| lyn protein non-receptor kinase [Ra... 120 9e-26
gi|48121983|ref|XP_396503.1| similar to ENSANGP00000008846 [Apis... 120 9e-26
gi|45384174|ref|NP_990414.1| Eph-like receptor tyrosine kinase [... 120 9e-26
gi|32527767|gb|AAP86285.1| CTR1-like kinase kinase kinase [Brass... 119 1e-25
gi|31198427|ref|XP_308161.1| ENSANGP00000009263 [Anopheles gambi... 119 1e-25
gi|47208879|emb|CAF98181.1| unnamed protein product [Tetraodon n... 119 1e-25
gi|6679879|ref|NP_032080.1| protein-tyrosine kinase fyn; Src Kin... 119 1e-25
gi|21594599|gb|AAH32149.1| Fyn protein [Mus musculus] 119 1e-25
gi|546693|gb|AAB30743.1| ZAP-70=protein tyrosine kinase Syk homo... 119 1e-25
gi|1174436|sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform ... 119 1e-25
gi|47227915|emb|CAF97544.1| unnamed protein product [Tetraodon n... 119 1e-25
gi|17136690|ref|NP_476849.1| CG7873-PA [Drosophila melanogaster]... 119 1e-25
gi|1536790|dbj|BAA07705.1| Dsrc41 [Drosophila melanogaster] 119 1e-25
gi|18858677|ref|NP_571681.1| fibroblast growth factor receptor 3... 119 1e-25
gi|38079278|ref|XP_355556.1| similar to Txk [Mus musculus] 119 1e-25
gi|1362665|pir||A49114 protein-tyrosine kinase (EC 2.7.1.112) fy... 119 1e-25
gi|47086347|ref|NP_998008.1| spleen tyrosine kinase; spleen prot... 119 1e-25
gi|48139712|ref|XP_397038.1| similar to receptor tyrosine kinase... 119 1e-25
gi|49904060|gb|AAH76773.1| Unknown (protein for MGC:83457) [Xeno... 119 1e-25
gi|49522498|gb|AAH75556.1| Unknown (protein for MGC:89505) [Xeno... 119 1e-25
gi|7446384|pir||T07406 probable protein kinase - tomato >gnl|BL_... 119 1e-25
gi|479367|pir||S33568 protein-tyrosine kinase (EC 2.7.1.112) fyn... 119 1e-25
gi|35505522|gb|AAH57401.1| Epha5 protein [Mus musculus] 119 1e-25
gi|41352675|gb|AAS01046.1| Src family kinase [Asterina miniata] 119 1e-25
gi|31222210|ref|XP_317149.1| ENSANGP00000006704 [Anopheles gambi... 119 1e-25
gi|40538750|ref|NP_571172.1| eph-like kinase 3 [Danio rerio] >gn... 119 1e-25
gi|34875595|ref|XP_217382.2| similar to Zap70 protein [Rattus no... 119 2e-25
gi|631880|pir||S47489 receptor tyrosine kinase - rat >gnl|BL_ORD... 119 2e-25
gi|12229808|sp|Q91735|EPB3_XENLA Ephrin type-B receptor 3 precur... 119 2e-25
gi|47524177|ref|NP_075252.2| fibroblast growth factor receptor 4... 119 2e-25
gi|6739818|gb|AAF27432.1| fibroblast growth factor receptor 4, s... 119 2e-25
gi|12229786|sp|O13147|EPB3_BRARE Ephrin type-B receptor 3 (Tyros... 119 2e-25
gi|32450904|gb|AAP82507.1| Bruton's tyrosine kinase-like protein... 119 2e-25
gi|125372|sp|P27446|FYN_XIPHE Proto-oncogene tyrosine-protein ki... 119 2e-25
gi|338228|gb|AAA36615.1| src-like tyrosine kinase (put.); putative 119 2e-25
gi|34328170|ref|NP_034271.2| Eph receptor A7 [Mus musculus] >gnl... 119 2e-25
gi|4758282|ref|NP_004431.1| ephrin receptor EphA7; ephrin type-A... 119 2e-25
gi|19705437|ref|NP_599158.1| EphA7 [Rattus norvegicus] >gnl|BL_O... 119 2e-25
gi|13991618|gb|AAK51435.1| fibroblast growth factor receptor 4 v... 119 2e-25
gi|26351311|dbj|BAC39292.1| unnamed protein product [Mus musculus] 119 2e-25
gi|34876735|ref|XP_341202.1| eck-like sequence 1 [Rattus norvegi... 119 2e-25
gi|2832350|emb|CAA74200.1| fibroblast growth factor 4 [Homo sapi... 119 2e-25
gi|47524173|ref|NP_002002.3| fibroblast growth factor receptor 4... 119 2e-25
gi|476558|pir||TVHUF4 fibroblast growth factor receptor 4 precur... 119 2e-25
gi|20153207|gb|AAM13666.1| fibroblast growth factor receptor 4 [... 119 2e-25
gi|39595860|emb|CAE67363.1| Hypothetical protein CBG12830 [Caeno... 119 2e-25
gi|17542722|ref|NP_501826.1| protein kinase and SH2 motif family... 119 2e-25
gi|2137278|pir||I48953 eph-related receptor protein tyrosine kin... 119 2e-25
gi|1708335|sp|P54761|EPB4_MOUSE Ephrin type-B receptor 4 precurs... 119 2e-25
gi|18150844|dbj|BAB83688.1| protein tyrosine kinase [Ephydatia f... 118 3e-25
gi|25146840|ref|NP_741859.1| fibroblast growth factor receptor f... 118 3e-25
gi|5052337|gb|AAD38508.1| Eph receptor tyrosine kinase [Drosophi... 118 3e-25
gi|47124936|gb|AAH70804.1| Unknown (protein for MGC:83871) [Xeno... 118 3e-25
gi|4193948|gb|AAD10056.1| ethylene-inducible CTR1-like protein k... 118 3e-25
gi|25146843|ref|NP_741858.1| fibroblast growth factor receptor f... 118 3e-25
gi|7507825|pir||T16875 hypothetical protein T14E8.1 - Caenorhabd... 118 3e-25
gi|4193950|gb|AAD10057.1| ethylene-inducible CTR1-like protein k... 118 3e-25
gi|11596416|gb|AAG38611.1| src-family tyrosine kinase SCK [Salmo... 118 3e-25
gi|187271|gb|AAB50019.1| Lyn B protein [Homo sapiens] >gnl|BL_OR... 118 3e-25
gi|13928766|ref|NP_113752.1| Eph receptor A3 [Rattus norvegicus]... 118 3e-25
gi|23273873|gb|AAH33313.1| Fgfr4 protein [Mus musculus] 118 3e-25
gi|37589566|gb|AAH59394.1| LYN protein [Homo sapiens] >gnl|BL_OR... 118 3e-25
gi|4505055|ref|NP_002341.1| v-yes-1 Yamaguchi sarcoma viral rela... 118 3e-25
gi|2507208|sp|P25911|LYN_MOUSE Tyrosine-protein kinase LYN >gnl|... 118 3e-25
gi|34855604|ref|XP_231658.2| similar to Ephrin type-A receptor 1... 118 3e-25
gi|33304203|gb|AAQ02609.1| v-yes-1 Yamaguchi sarcoma viral relat... 118 3e-25
gi|22329643|ref|NP_173254.2| protein kinase family protein [Arab... 118 3e-25
gi|20466652|gb|AAM20643.1| MAP kinase, putative [Arabidopsis tha... 118 3e-25
gi|39589478|emb|CAE74507.1| Hypothetical protein CBG22259 [Caeno... 118 3e-25
gi|31127085|gb|AAH52804.1| Ephrin receptor EphB4, precursor [Hom... 118 3e-25
gi|495473|gb|AAA20598.1| tyrosine kinase 118 3e-25
gi|32528301|ref|NP_004435.3| ephrin receptor EphB4 precursor; he... 118 3e-25
gi|50513700|pdb|1T45|A Chain A, Structural Basis For The Autoinh... 118 3e-25
gi|24653266|ref|NP_477086.2| CG3969-PA [Drosophila melanogaster]... 118 3e-25
gi|31230842|ref|XP_318436.1| ENSANGP00000014190 [Anopheles gambi... 118 3e-25
gi|2134388|pir||I50613 protein-tyrosine kinase (EC 2.7.1.112) Ce... 118 3e-25
gi|24653268|ref|NP_477087.2| CG3969-PB [Drosophila melanogaster]... 118 3e-25
gi|24657846|gb|AAH39039.1| ZAP70 protein [Homo sapiens] 118 3e-25
gi|50754979|ref|XP_414568.1| PREDICTED: similar to IL2-inducible... 118 3e-25
gi|27694619|gb|AAH43749.1| Fyn-prov protein [Xenopus laevis] 118 3e-25
gi|34867401|ref|XP_346415.1| hypothetical protein XP_346414 [Rat... 118 3e-25
gi|555619|gb|AAB60613.1| receptor-type protein-tyrosine kinase 118 3e-25
gi|15021868|dbj|BAB62210.1| hypothetical protein [Macaca fascicu... 118 3e-25
gi|31455611|ref|NP_001070.2| zeta-chain associated protein kinas... 118 3e-25
gi|13279062|gb|AAH04264.1| Similar to EphB4 [Homo sapiens] 118 3e-25
gi|455392|dbj|BAA04489.1| tyrosine kinase [Drosophila melanogaster] 118 3e-25
gi|34810084|pdb|1PKG|A Chain A, Structure Of A C-Kit Kinase Prod... 118 3e-25
gi|16209620|gb|AAL14195.1| receptor protein tyrosine kinase vari... 118 3e-25
gi|2425188|dbj|BAA22281.1| FGF receptor 3 [Xenopus laevis] 118 3e-25
gi|50513701|pdb|1T46|A Chain A, Structural Basis For The Autoinh... 118 3e-25
gi|47087153|ref|NP_990436.1| receptor-type protein-tyrosine kina... 118 3e-25
gi|46488944|ref|NP_997402.1| zeta-chain associated protein kinas... 118 3e-25
gi|555620|gb|AAB60614.1| receptor-type protein-tyrosine kinase 118 3e-25
gi|49115521|gb|AAH73428.1| Unknown (protein for MGC:80912) [Xeno... 118 3e-25
gi|26340060|dbj|BAC33693.1| unnamed protein product [Mus musculus] 117 4e-25
gi|13492036|gb|AAK28051.1| Ephrin type-B receptor 4 precursor >g... 117 4e-25
gi|47059093|ref|NP_034274.3| Eph receptor B4 [Mus musculus] >gnl... 117 4e-25
gi|50748173|ref|XP_421140.1| PREDICTED: similar to SI:dZ107O16.1... 117 4e-25
gi|13924736|gb|AAK49117.1| spleen protein tyrosine kinase [Cypri... 117 4e-25
gi|26338474|dbj|BAC32908.1| unnamed protein product [Mus musculus] 117 4e-25
gi|26351347|dbj|BAC39310.1| unnamed protein product [Mus musculus] 117 4e-25
gi|31240647|ref|XP_320737.1| ENSANGP00000008846 [Anopheles gambi... 117 4e-25
gi|31982448|ref|NP_034270.1| Eph receptor A3 [Mus musculus] >gnl... 117 4e-25
gi|1083782|pir||S51604 receptor-like tyrosine kinase Ehk-1 - rat 117 4e-25
gi|1083781|pir||S51603 receptor-like tyrosine kinase Ehk-1 - rat 117 4e-25
gi|15227883|ref|NP_179361.1| protein kinase family protein [Arab... 117 4e-25
gi|1706629|sp|P54757|EPA5_RAT Ephrin type-A receptor 5 precursor... 117 4e-25
gi|45384352|ref|NP_990650.1| fibroblast growth factor receptor 2... 117 4e-25
gi|21361241|ref|NP_005224.2| ephrin receptor EphA3 isoform a pre... 117 4e-25
gi|38648757|gb|AAH63282.1| EPHA3 protein [Homo sapiens] 117 4e-25
gi|125387|sp|P29320|EPA3_HUMAN Ephrin type-A receptor 3 precurso... 117 4e-25
gi|480110|pir||S36439 fibroblast growth factor receptor 2 - Iber... 117 4e-25
gi|2497569|sp|Q61851|FGR3_MOUSE Fibroblast growth factor recepto... 117 6e-25
gi|476731|gb|AAA49398.1| keratinocyte growth factor receptor 117 6e-25
gi|34862507|ref|XP_233867.2| similar to tyrosine kinase [Rattus ... 117 6e-25
gi|33859588|ref|NP_034877.1| Yamaguchi sarcoma viral (v-yes-1) o... 117 6e-25
gi|24308430|ref|NP_571170.1| eph-like kinase 1; eph-like recepto... 117 6e-25
gi|542631|pir||S41050 fibroblast growth factor receptor-2 - east... 117 6e-25
gi|476729|gb|AAA49395.1| fibroblast growth factor receptor 2 117 6e-25
gi|49899860|gb|AAH76889.1| Unknown (protein for MGC:88962) [Xeno... 117 6e-25
gi|6680680|ref|NP_031465.1| anaplastic lymphoma kinase [Mus musc... 117 6e-25
gi|4809260|gb|AAD30170.1| Eph tyrosine kinase [Drosophila melano... 117 6e-25
gi|40642785|emb|CAD58836.1| ephrin receptor gamma [Ciona intesti... 117 6e-25
gi|7578848|gb|AAF64151.1| tyrosine kinase 5 [Schistosoma mansoni] 117 6e-25
gi|542632|pir||S41051 fibroblast growth factor receptor-2 - east... 117 6e-25
gi|125717|sp|P17713|STK_HYDAT Tyrosine-protein kinase STK (P57-S... 117 6e-25
gi|2967840|gb|AAC05835.1| c-Src kinase [Xenopus laevis] 117 6e-25
gi|6689572|emb|CAB65513.1| eph receptor tyrosine kinase [Xenopus... 117 6e-25
gi|15020806|emb|CAC44628.1| tyrosine protein kinase BTK [Takifug... 117 6e-25
gi|45382181|ref|NP_990761.1| receptor tyrosine kinase [Gallus ga... 117 7e-25
gi|104849|pir||S24108 protein-tyrosine kinase (EC 2.7.1.112) bek... 117 7e-25
gi|6739535|gb|AAF27292.1| TRK-fused gene/anaplastic lymphoma kin... 117 7e-25
gi|7229261|gb|AAF42734.1| TRK-fused gene-anaplastic lymphoma kin... 117 7e-25
gi|125371|sp|P13406|FYN_XENLA Proto-oncogene tyrosine-protein ki... 117 7e-25
gi|41052622|dbj|BAD08131.1| putative serine/threonine protein ki... 117 7e-25
gi|482917|emb|CAA81796.1| receptor tyrosine kinase eph [Homo sap... 117 7e-25
gi|87779|pir||A34076 protein-tyrosine kinase (EC 2.7.1.112) rece... 117 7e-25
gi|609342|gb|AAA58698.1| nucleophosmin-anaplastic lymphoma kinas... 117 7e-25
gi|1483131|dbj|BAA08343.1| p80 protein [Homo sapiens] 117 7e-25
gi|39591698|emb|CAE71276.1| Hypothetical protein CBG18159 [Caeno... 117 7e-25
gi|20269390|gb|AAM17922.1| TRK-fused gene/anaplastic large cell ... 117 7e-25
gi|32967309|ref|NP_005223.2| ephrin receptor EphA1; oncogene EPH... 117 7e-25
gi|47117832|sp|P21709|EPA1_HUMAN Ephrin type-A receptor 1 precur... 117 7e-25
gi|41472551|gb|AAS07458.1| unknown [Homo sapiens] 117 7e-25
gi|20137251|sp|Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor pre... 117 7e-25
gi|29029632|ref|NP_004295.2| anaplastic lymphoma kinase Ki-1; AL... 117 7e-25
gi|1848244|gb|AAC51104.1| anaplastic lymphoma kinase receptor 117 7e-25
gi|12314010|emb|CAC10350.1| dJ74M1.1.1 (tyrosine kinase isoform ... 116 1e-24
gi|2136054|pir||A57174 protein-tyrosine kinase (EC 2.7.1.112) er... 116 1e-24
gi|22449839|emb|CAC84705.1| fibroblast growth factor receptor 2 ... 116 1e-24
gi|38078900|ref|XP_204072.3| Eph receptor B2 [Mus musculus] >gnl... 116 1e-24
gi|25150323|ref|NP_490866.2| SRC oncogene related (60.7 kD) (src... 116 1e-24
gi|50761846|ref|XP_424854.1| PREDICTED: similar to Tyrosine-prot... 116 1e-24
gi|38614379|gb|AAH62924.1| Ephb2 protein [Mus musculus] 116 1e-24
gi|481393|pir||S38579 fibroblast growth factor receptor 3 - Iber... 116 1e-24
gi|599959|emb|CAA53271.1| fibroblast growth factor receptor 3 [P... 116 1e-24
gi|495678|dbj|BAA06506.1| tyrosine kinase precursor [Homo sapiens] 116 1e-24
gi|346421|pir||A44266 protein-tyrosine kinase (EC 2.7.1.112) ZAP... 116 1e-24
gi|17975765|ref|NP_059145.1| ephrin receptor EphB2 isoform 1 pre... 116 1e-24
gi|12644190|sp|P29323|EPB2_HUMAN Ephrin type-B receptor 2 precur... 116 1e-24
gi|110658|pir||A39719 protein-tyrosine kinase (EC 2.7.1.112) lyn... 116 1e-24
gi|18150110|dbj|BAB83670.1| type 1 insulin-like growth factor re... 116 1e-24
gi|12314011|emb|CAC10351.1| dJ74M1.1.2 (tyrosine kinase isosform... 116 1e-24
gi|38303921|gb|AAH61936.1| MGC68754 protein [Xenopus laevis] 116 1e-24
gi|38605719|sp|P54763|EPB2_MOUSE Ephrin type-B receptor 2 precur... 116 1e-24
gi|414594|gb|AAA72411.1| Nuk receptor tyrosine kinase [Mus muscu... 116 1e-24
gi|34872119|ref|XP_233574.2| similar to Ephrin type-B receptor 2... 116 1e-24
gi|49114324|gb|AAH43088.1| Ephb2 protein [Mus musculus] 116 1e-24
gi|24636132|gb|AAK29735.3| Src oncogene related protein 1 [Caeno... 116 1e-24
gi|2137701|pir||I48760 protein-tyrosine kinase (EC 2.7.1.112) se... 116 1e-24
gi|15988071|pdb|1JPA|A Chain A, Crystal Structure Of Unphosphory... 116 1e-24
>gi|17535461|ref|NP_496201.1| tyrosine kinase family member (2K488)
[Caenorhabditis elegans]
gi|7506332|pir||T23940 hypothetical protein R05H5.4 - Caenorhabditis
elegans
gi|3878800|emb|CAA88727.1| Hypothetical protein R05H5.4
[Caenorhabditis elegans]
Length = 414
Score = 752 bits (1942), Expect = 0.0
Identities = 380/414 (91%), Positives = 380/414 (91%)
Frame = -1
Query: 1245 MCSTEKLSEADANLPYFHGALMNIDADQLLVNEGDFMVTMKKQLDINKLQLFLAVRLKKG 1066
MCSTEKLSEADANLPYFHGALMNIDADQLLVNEGDFMVTMKKQLDINKLQLFLAVRLKKG
Sbjct: 1 MCSTEKLSEADANLPYFHGALMNIDADQLLVNEGDFMVTMKKQLDINKLQLFLAVRLKKG 60
Query: 1065 IRRYEIKRTSKTAKIGGKTSQNIVKLINMLKADPIEIRGEKVVLKRAIPKGKFQLMHKDV 886
IRRYEIKRTSKTAKIGGKTSQNIVKLINMLKADPIEIRGEKVVLKRAIPKGKFQLMHKDV
Sbjct: 61 IRRYEIKRTSKTAKIGGKTSQNIVKLINMLKADPIEIRGEKVVLKRAIPKGKFQLMHKDV 120
Query: 885 IFQKKIGAGAYGTVYRGKLVKTDEVIAVKKLDPEGADEDGLAEMMKEARVMQLYDHPNIV 706
IFQKKIGAGAYGTVYRGKLVKTDEVIAVKKLDPEGADEDGLAEMMKEARVMQLYDHPNIV
Sbjct: 121 IFQKKIGAGAYGTVYRGKLVKTDEVIAVKKLDPEGADEDGLAEMMKEARVMQLYDHPNIV 180
Query: 705 KFHGFILDDLPYLLVLEYCNGGAVEDRLRDKGEKIKVPTRVKYTYMAACGMDYLHKKNCI 526
KFHGFILDDLPYLLVLEYCNGGAVEDRLRDKGEKIKVPTRVKYTYMAACGMDYLHKKNCI
Sbjct: 181 KFHGFILDDLPYLLVLEYCNGGAVEDRLRDKGEKIKVPTRVKYTYMAACGMDYLHKKNCI 240
Query: 525 HRDIASRNCLIHKGVVKMADFGMCRAQSVYKVDLKKPCNIRWLAPEVWDNGETRFNTDVY 346
HRDIASRNCLIHKGVVKMADFGMCRAQSVYKVDLKKPCNIRWLAPEVWDNGETRFNTDVY
Sbjct: 241 HRDIASRNCLIHKGVVKMADFGMCRAQSVYKVDLKKPCNIRWLAPEVWDNGETRFNTDVY 300
Query: 345 AFGIMMWEFFETPFKSPYVEMKAAQVKRKTRAGYXXXXXXXXXXXMVEIMSECWQVDAEK 166
AFGIMMWEFFETPFKSPYVEMKAAQVKRKTRAGY MVEIMSECWQVDAEK
Sbjct: 301 AFGIMMWEFFETPFKSPYVEMKAAQVKRKTRAGYRLPPPPSMPSRMVEIMSECWQVDAEK 360
Query: 165 RPTAXXXXXXXXXXXXKTENSITTSAPPTXXXXXXXXXXXEPTTKSVDPNKSRL 4
RPTA KTENSITTSAPPT EPTTKSVDPNKSRL
Sbjct: 361 RPTAEELKEKLEEFKKKTENSITTSAPPTSVEKSKLSVSSEPTTKSVDPNKSRL 414