Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= R06A10_4
         (1176 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508559|ref|NP_490820.1| protein kinase (44.0 kD) (1B564) [C...   753   0.0
gi|39589335|emb|CAE74364.1| Hypothetical protein CBG22088 [Caeno...   742   0.0
gi|33304047|gb|AAQ02531.1| protein serine kinase H1 [synthetic c...   278   2e-73
gi|17530179|gb|AAL40735.1| protein serine kinase/luciferase fusi...   278   2e-73
gi|27901803|ref|NP_006733.1| protein serine kinase H1; serine/th...   278   2e-73
gi|34851710|ref|XP_344761.1| similar to protein serine kinase Ps...   277   4e-73
gi|27734116|ref|NP_775608.1| hypothetical protein E130013P03 [Mu...   277   4e-73
gi|47209687|emb|CAF92851.1| unnamed protein product [Tetraodon n...   273   7e-72
gi|50753527|ref|XP_414024.1| PREDICTED: similar to Serine/threon...   272   1e-71
gi|14916455|ref|NP_149117.1| protein serine kinase H2; serine/th...   261   2e-68
gi|47221114|emb|CAG05435.1| unnamed protein product [Tetraodon n...   249   7e-65
gi|2136035|pir||I38138 protein-serine kinase (EC 2.7.1.-) PSK-H1...   244   3e-63
gi|49257590|gb|AAH74183.1| Unknown (protein for MGC:82022) [Xeno...   222   1e-56
gi|23491815|dbj|BAC19847.1| calcium/calmodulin-dependent protein...   221   3e-56
gi|28893481|ref|NP_796317.1| calcium/calmodulin-dependent protei...   216   8e-55
gi|33304011|gb|AAQ02513.1| CamKI-like protein kinase [synthetic ...   216   1e-54
gi|9966875|ref|NP_065130.1| calcium/calmodulin-dependent protein...   216   1e-54
gi|26342637|dbj|BAC34975.1| unnamed protein product [Mus musculus]    216   1e-54
gi|23943850|ref|NP_705718.1| calcium/calmodulin-dependent protei...   216   1e-54
gi|27469628|gb|AAH41721.1| Camk1-prov protein [Xenopus laevis]        214   3e-54
gi|4502553|ref|NP_003647.1| calcium/calmodulin-dependent protein...   214   4e-54
gi|19527140|ref|NP_598687.1| calcium/calmodulin-dependent protei...   214   4e-54
gi|19745200|ref|NP_604463.1| regulator of G-protein signalling 1...   214   4e-54
gi|47218247|emb|CAF96284.1| unnamed protein product [Tetraodon n...   214   4e-54
gi|47227255|emb|CAF96804.1| unnamed protein product [Tetraodon n...   214   4e-54
gi|26354647|dbj|BAC40950.1| unnamed protein product [Mus musculus]    214   4e-54
gi|3114436|pdb|1A06|  Calmodulin-Dependent Protein Kinase From Rat    214   4e-54
gi|33304167|gb|AAQ02591.1| calcium/calmodulin-dependent protein ...   214   4e-54
gi|23491817|dbj|BAC19848.1| calcium/calmodulin-dependent protein...   213   9e-54
gi|30704686|gb|AAH51996.1| Pnck protein [Mus musculus]                212   1e-53
gi|406113|gb|AAA19670.1| protein kinase I                             212   1e-53
gi|2077932|dbj|BAA19879.1| Protein Kinase [Rattus norvegicus]         212   1e-53
gi|8393035|ref|NP_058971.1| pregnancy upregulated non-ubiquitous...   212   1e-53
gi|6753248|ref|NP_036170.1| pregnancy upregulated non-ubiquitous...   212   1e-53
gi|30523260|gb|AAP31673.1| calcium/calmodulin-dependent protein ...   212   2e-53
gi|2077934|dbj|BAA19880.1| Protein Kinase [Rattus norvegicus]         210   5e-53
gi|33299962|dbj|BAC80243.1| Ca2+/calmodulin-dependent protein ki...   210   5e-53
gi|21450191|ref|NP_659066.1| calcium/calmodulin-dependent protei...   210   5e-53
gi|33469057|ref|NP_878262.1| calcium/calmodulin-dependent protei...   210   5e-53
gi|41152373|ref|NP_956260.1| calcium/calmodulin-dependent protei...   210   6e-53
gi|4502557|ref|NP_001735.1| calcium/calmodulin-dependent protein...   209   1e-52
gi|33304109|gb|AAQ02562.1| calcium/calmodulin-dependent protein ...   209   1e-52
gi|6753252|ref|NP_033923.1| calcium/calmodulin-dependent protein...   208   2e-52
gi|41152258|ref|NP_957123.1| hypothetical protein MGC73155 [Dani...   207   3e-52
gi|16755792|gb|AAL28100.1| calcium/calmodulin-dependent protein ...   207   5e-52
gi|14196445|ref|NP_065172.1| calcium/calmodulin-dependent protei...   207   5e-52
gi|4678722|emb|CAB41259.1| hypothetical protein [Homo sapiens]        207   5e-52
gi|33304093|gb|AAQ02554.1| calcium/calmodulin-dependent protein ...   207   5e-52
gi|4007153|emb|CAA19296.1| dJ272L16.1 (Rat Ca2+/Calmodulin depen...   207   5e-52
gi|50760361|ref|XP_417986.1| PREDICTED: similar to hypothetical ...   207   5e-52
gi|266412|sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protei...   206   9e-52
gi|203243|gb|AAA40856.1| calcium/calmodulin protein kinase            206   9e-52
gi|6978597|ref|NP_036859.1| calcium/calmodulin-dependent protein...   206   9e-52
gi|26326213|dbj|BAC26850.1| unnamed protein product [Mus musculu...   206   9e-52
gi|28556898|dbj|BAC57526.1| calmodulin-dependent protein kinase ...   205   1e-51
gi|737902|prf||1923385A Ca/calmodulin-dependent protein kinase I...   205   1e-51
gi|12407960|gb|AAG53672.1| calcium/calmodulin-dependent protein ...   205   2e-51
gi|32261078|dbj|BAC78445.1| Ca2+/calmodulin-dependent protein ki...   204   3e-51
gi|47224442|emb|CAG08692.1| unnamed protein product [Tetraodon n...   204   4e-51
gi|1730055|sp|P25323|KMLC_DICDI Myosin light chain kinase (MLCK)...   201   2e-50
gi|203220|gb|AAA40845.1| calcium/calmodulin-dependent protein ki...   200   5e-50
gi|102256|pir||A40811 myosin-light-chain kinase (EC 2.7.1.117) A...   200   6e-50
gi|31200303|ref|XP_309099.1| ENSANGP00000019618 [Anopheles gambi...   199   1e-49
gi|39583744|emb|CAE63848.1| Hypothetical protein CBG08406 [Caeno...   196   7e-49
gi|19114376|ref|NP_593464.1| calmodulin kinase i homolog. [Schiz...   195   2e-48
gi|28829037|gb|AAO51612.1| similar to Dictyostelium discoideum (...   194   4e-48
gi|3309070|gb|AAC26005.1| calmodulin kinase I homolog [Schizosac...   193   7e-48
gi|50554447|ref|XP_504632.1| hypothetical protein [Yarrowia lipo...   193   7e-48
gi|17539480|ref|NP_500139.1| CaM Kinase (39.1 kD) (cmk-1) [Caeno...   192   2e-47
gi|33772637|gb|AAQ54691.1| calcium/calmodulin-dependent protein ...   192   2e-47
gi|17975557|ref|NP_524622.1| CG1495-PG [Drosophila melanogaster]...   192   2e-47
gi|7434372|pir||T37321 Ca2+/calmodulin-dependent protein kinase ...   191   4e-47
gi|38099333|gb|EAA46691.1| hypothetical protein MG09912.4 [Magna...   188   2e-46
gi|49078910|ref|XP_403159.1| hypothetical protein UM05544.1 [Ust...   188   2e-46
gi|50255099|gb|EAL17838.1| hypothetical protein CNBL1000 [Crypto...   184   3e-45
gi|38102428|gb|EAA49267.1| hypothetical protein MG00925.4 [Magna...   184   3e-45
gi|46105418|ref|XP_380513.1| hypothetical protein FG00337.1 [Gib...   184   5e-45
gi|2654181|gb|AAC62515.1| calmodulin-dependent protein kinase; C...   183   6e-45
gi|49091482|ref|XP_407202.1| hypothetical protein AN3065.2 [Aspe...   182   1e-44
gi|32421231|ref|XP_331059.1| hypothetical protein ( (AF034963) c...   182   1e-44
gi|13027458|ref|NP_076490.1| vesicle-associated calmodulin-bindi...   182   1e-44
gi|49256303|gb|AAH74382.1| Unknown (protein for MGC:84315) [Xeno...   182   1e-44
gi|21704242|ref|NP_663596.1| vesicle-associated calmodulin-bindi...   182   2e-44
gi|33303827|gb|AAQ02427.1| hypothetical protein MGC8407 [synthet...   182   2e-44
gi|22761290|dbj|BAC11528.1| unnamed protein product [Homo sapiens]    182   2e-44
gi|22760645|dbj|BAC11278.1| unnamed protein product [Homo sapiens]    182   2e-44
gi|13129008|ref|NP_076951.1| hypothetical protein MGC8407 [Homo ...   182   2e-44
gi|16924331|gb|AAH17363.1| Hypothetical protein MGC8407 [Homo sa...   182   2e-44
gi|50256568|gb|EAL19293.1| hypothetical protein CNBH3920 [Crypto...   181   3e-44
gi|12004268|gb|AAG43970.1| calmodulin-binding protein kinase [Ar...   180   7e-44
gi|34303890|dbj|BAC82420.1| hypothetical protein [Entamoeba hist...   179   9e-44
gi|5053101|gb|AAD38850.1| calcium/calmodulin dependent protein k...   179   1e-43
gi|17542676|ref|NP_501899.1| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|32565743|ref|NP_501903.3| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|32565740|ref|NP_501902.2| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|32565737|ref|NP_501901.2| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|25145098|ref|NP_501896.2| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|14530496|emb|CAA94242.2| Hypothetical protein K11E8.1a [Caeno...   179   1e-43
gi|32565730|ref|NP_501900.3| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|1561715|gb|AAB40711.1| calcium/calmodulin-dependent protein k...   179   1e-43
gi|32565735|ref|NP_501897.3| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|39581826|emb|CAE60719.1| Hypothetical protein CBG04391 [Caeno...   179   1e-43
gi|14530497|emb|CAA94244.2| Hypothetical protein K11E8.1c [Caeno...   179   1e-43
gi|32565732|ref|NP_501898.3| UNCoordinated locomotion UNC-43, DE...   179   1e-43
gi|7521914|pir||T30814 calmodulin-binding protein kinase - Fugu ...   179   1e-43
gi|23489576|gb|EAA21610.1| myosin light chain kinase [Plasmodium...   178   2e-43
gi|3122300|sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent pro...   176   7e-43
gi|49089942|ref|XP_406549.1| KCC1_EMENI Calcium/calmodulin-depen...   176   7e-43
gi|22760572|dbj|BAC11248.1| unnamed protein product [Homo sapiens]    176   7e-43
gi|1561717|gb|AAB40712.1| calcium/calmodulin-dependent protein k...   176   9e-43
gi|23508433|ref|NP_701102.1| asparagine-rich protein [Plasmodium...   175   2e-42
gi|47227341|emb|CAF96890.1| unnamed protein product [Tetraodon n...   175   2e-42
gi|50554131|ref|XP_504474.1| YlSSL2 [Yarrowia lipolytica] >gnl|B...   175   2e-42
gi|32422143|ref|XP_331515.1| hypothetical protein [Neurospora cr...   174   4e-42
gi|25287689|pir||B88640 protein K07A9.2 [imported] - Caenorhabdi...   174   4e-42
gi|41055243|ref|NP_956744.1| hypothetical protein MGC63506 [Dani...   174   4e-42
gi|31204371|ref|XP_311134.1| ENSANGP00000017518 [Anopheles gambi...   174   5e-42
gi|18143652|dbj|BAB82378.1| myosin light chain kinase [Physarum ...   173   6e-42
gi|46125001|ref|XP_387054.1| hypothetical protein FG06878.1 [Gib...   172   1e-41
gi|24638772|ref|NP_726634.1| CG18069-PB [Drosophila melanogaster...   172   1e-41
gi|348327|pir||B44412 calmodulin-dependent protein kinase II (EC...   172   1e-41
gi|46576378|sp|Q00168|KCCA_DROME Calcium/calmodulin-dependent pr...   172   1e-41
gi|348329|pir||D44412 Ca2+/calmodulin-dependent protein kinase (...   172   1e-41
gi|1279425|emb|CAA96439.1| calmodulin-domain protein kinase [Eim...   172   1e-41
gi|7505786|pir||T23614 hypothetical protein K11E8.1a - Caenorhab...   172   1e-41
gi|45549243|ref|NP_524635.3| CG18069-PC [Drosophila melanogaster...   172   1e-41
gi|7505788|pir||T23616 hypothetical protein K11E8.1c - Caenorhab...   172   1e-41
gi|7428014|pir||JU0270 Ca2+/calmodulin-dependent protein kinase ...   172   1e-41
gi|4557511|ref|NP_001339.1| death-associated protein kinase 3 [H...   172   2e-41
gi|33304115|gb|AAQ02565.1| death-associated protein kinase 3 [sy...   172   2e-41
gi|45185828|ref|NP_983544.1| ACR142Wp [Eremothecium gossypii] >g...   171   2e-41
gi|49080154|ref|XP_403634.1| hypothetical protein UM06019.1 [Ust...   171   2e-41
gi|23489282|gb|EAA21537.1| Plasmodium falciparum CDPK2 protein [...   171   3e-41
gi|15233820|ref|NP_194171.1| CBL-interacting protein kinase 8 (C...   171   3e-41
gi|3820459|emb|CAA07560.1| SSL2 [Yarrowia lipolytica]                 171   3e-41
gi|22749267|ref|NP_689832.1| hypothetical protein MGC45428 [Homo...   171   4e-41
gi|26339854|dbj|BAC33590.1| unnamed protein product [Mus musculus]    171   4e-41
gi|21740293|emb|CAD39156.1| hypothetical protein [Homo sapiens]       171   4e-41
gi|40254281|ref|NP_081815.3| RIKEN cDNA 6330415M09 [Mus musculus...   171   4e-41
gi|38426274|gb|AAR20249.1| calcium/calmodulin dependent protein ...   171   4e-41
gi|47825355|ref|NP_001001457.1| hypothetical protein MGC76030 [X...   170   5e-41
gi|50746315|ref|XP_420439.1| PREDICTED: similar to hypothetical ...   170   5e-41
gi|41144343|ref|XP_047355.3| KIAA1765 protein [Homo sapiens]          170   5e-41
gi|12698075|dbj|BAB21856.1| KIAA1765 protein [Homo sapiens]           170   5e-41
gi|47223108|emb|CAG07195.1| unnamed protein product [Tetraodon n...   170   7e-41
gi|26333029|dbj|BAC30232.1| unnamed protein product [Mus musculus]    170   7e-41
gi|28465377|dbj|BAC57465.1| calcium-dependent protein kinase [Ba...   169   9e-41
gi|3241849|dbj|BAA28870.1| calmodulin-dependent protein kinase I...   169   9e-41
gi|2854042|gb|AAC02532.1| protein kinase 4 [Toxoplasma gondii]        169   9e-41
gi|26328339|dbj|BAC27910.1| unnamed protein product [Mus musculus]    169   1e-40
gi|27370432|ref|NP_766516.1| hypothetical protein C730036H08 [Mu...   169   1e-40
gi|18158420|ref|NP_076302.1| calcium/calmodulin-dependent protei...   169   1e-40
gi|26667183|ref|NP_742113.1| calcium/calmodulin-dependent protei...   169   1e-40
gi|26667180|ref|NP_001212.2| calcium/calmodulin-dependent protei...   169   1e-40
gi|47523818|ref|NP_999546.1| calcium/calmodulin-dependent protei...   169   1e-40
gi|50415115|gb|AAH77360.1| Unknown (protein for MGC:81366) [Xeno...   169   1e-40
gi|6978595|ref|NP_036651.1| calcium/calmodulin-dependent protein...   169   1e-40
gi|50292491|ref|XP_448678.1| unnamed protein product [Candida gl...   169   1e-40
gi|28829839|gb|AAO52341.1| similar to Xenopus laevis (African cl...   169   1e-40
gi|12643414|sp|Q13557|KCCD_HUMAN Calcium/calmodulin-dependent pr...   169   2e-40
gi|26338930|dbj|BAC33136.1| unnamed protein product [Mus musculus]    169   2e-40
gi|47939965|gb|AAH72206.1| MGC81183 protein [Xenopus laevis]          169   2e-40
gi|3122292|sp|O14408|KCC1_METAN Calcium/calmodulin-dependent pro...   168   2e-40
gi|34866453|ref|XP_236661.2| similar to hypothetical protein C73...   168   2e-40
gi|16647988|gb|AAL14118.1| Ca/CaM-dependent kinase-1 [Neurospora...   168   3e-40
gi|37362775|gb|AAQ91345.1| calmodulin-domain protein kinase [Eim...   167   3e-40
gi|48095224|ref|XP_394386.1| similar to ENSANGP00000019521 [Apis...   167   4e-40
gi|50417147|gb|AAH77143.1| Unknown (protein for MGC:101001) [Dan...   167   4e-40
gi|31238489|ref|XP_319785.1| ENSANGP00000019521 [Anopheles gambi...   167   4e-40
gi|47125198|gb|AAH70744.1| MGC83745 protein [Xenopus laevis]          167   4e-40
gi|4826684|ref|NP_004929.1| death-associated protein kinase 1 [H...   167   6e-40
gi|33304057|gb|AAQ02536.1| calcium/calmodulin-dependent protein ...   167   6e-40
gi|20150170|pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary ...   167   6e-40
gi|4589580|dbj|BAA76812.1| KIAA0968 protein [Homo sapiens]            167   6e-40
gi|20177970|sp|Q9UQM7|KCCA_HUMAN Calcium/calmodulin-dependent pr...   167   6e-40
gi|26251712|gb|AAH40457.1| Calcium/calmodulin-dependent protein ...   167   6e-40
gi|6978593|ref|NP_037052.1| calcium/calmodulin-dependent protein...   167   6e-40
gi|25952118|ref|NP_741960.1| calcium/calmodulin-dependent protei...   167   6e-40
gi|39104626|dbj|BAC65692.3| mKIAA0968 protein [Mus musculus]          167   6e-40
gi|20150446|pdb|1JKK|A Chain A, 2.4a X-Ray Structure Of Ternary ...   167   6e-40
gi|25952114|ref|NP_057065.2| calcium/calmodulin-dependent protei...   167   6e-40
gi|4836795|gb|AAD30559.1| calcium/calmodulin-dependent protein k...   167   6e-40
gi|30582709|gb|AAP35581.1| death-associated protein kinase 1 [Ho...   167   6e-40
gi|30584399|gb|AAP36448.1| Homo sapiens death-associated protein...   167   6e-40
gi|38605718|sp|P53355|DAK1_HUMAN Death-associated protein kinase...   167   6e-40
gi|40788228|dbj|BAA20824.2| KIAA0369 [Homo sapiens]                   166   7e-40
gi|6325104|ref|NP_015172.1| Protein kinase, required for cell-cy...   166   7e-40
gi|4758128|ref|NP_004725.1| doublecortin and CaM kinase-like 1; ...   166   7e-40
gi|6521217|dbj|BAA88064.1| Death-associated protein kinase 2 [Mu...   166   7e-40
gi|12484153|gb|AAG53993.1| calmodulin-domain protein kinase 1 [T...   166   1e-39
gi|23619315|ref|NP_705277.1| calcium-dependent protein kinase [P...   166   1e-39
gi|47227067|emb|CAG00429.1| unnamed protein product [Tetraodon n...   166   1e-39
gi|10443740|gb|AAG17558.1| calcium/calmodulin-dependent protein ...   166   1e-39
gi|10443738|gb|AAG17557.1| calcium/calmodulin-dependent protein ...   166   1e-39
gi|90334|pir||S04365 Ca2+/calmodulin-dependent protein kinase (E...   166   1e-39
gi|32027990|gb|AAO91934.2| death-associated protein kinase-beta ...   166   1e-39
gi|38604743|sp|Q80YE7|DAK1_MOUSE Death-associated protein kinase...   166   1e-39
gi|34328167|ref|NP_034149.2| death-associated kinase 2 [Mus musc...   166   1e-39
gi|34785717|gb|AAH57317.1| Dapk1 protein [Mus musculus] >gnl|BL_...   166   1e-39
gi|29825683|gb|AAO91935.1| death-associated protein kinase-alpha...   166   1e-39
gi|24371219|ref|NP_083929.1| death associated protein kinase 1 [...   166   1e-39
gi|26328245|dbj|BAC27863.1| unnamed protein product [Mus musculus]    165   2e-39
gi|6716522|gb|AAF26675.1| CPG16 [Mus musculus]                        165   2e-39
gi|17985955|ref|NP_445795.1| double cortin and calcium/calmoduli...   165   2e-39
gi|9910164|ref|NP_064362.1| double cortin and calcium/calmodulin...   165   2e-39
gi|26006151|dbj|BAC41418.1| mKIAA0369 protein [Mus musculus]          165   2e-39
gi|7446371|pir||T14735 probable serine/threonine kinase (EC 2.7....   165   2e-39
gi|631810|pir||S43845 Ca2+/calmodulin-dependent protein kinase (...   165   2e-39
gi|26667199|ref|NP_751910.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|3241847|dbj|BAA28869.1| calmodulin-dependent protein kinase I...   165   2e-39
gi|26667211|ref|NP_751913.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|18448919|gb|AAL69956.1| CaM kinase II gamma J [Mustela putori...   165   2e-39
gi|2511440|gb|AAB80848.1| calcium/calmodulin-dependent protein k...   165   2e-39
gi|26667191|ref|NP_001213.2| calcium/calmodulin-dependent protei...   165   2e-39
gi|560653|gb|AAB30671.1| Ca2+/calmodulin-dependent protein kinas...   165   2e-39
gi|11968142|ref|NP_071991.1| Death-associated like kinase [Rattu...   165   2e-39
gi|6681133|ref|NP_031854.1| death-associated kinase 3; ZIP kinas...   165   2e-39
gi|47523472|ref|NP_999358.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|30519907|ref|NP_848712.1| calcium/calmodulin -dependent prote...   165   2e-39
gi|19424316|ref|NP_598289.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|26667206|ref|NP_751912.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|50749382|ref|XP_421612.1| PREDICTED: similar to calcium/calmo...   165   2e-39
gi|20177955|sp|Q923T9|KCCG_MOUSE Calcium/calmodulin-dependent pr...   165   2e-39
gi|34393400|dbj|BAC82911.1| putative CBL-interacting protein kin...   165   2e-39
gi|26667203|ref|NP_751911.1| calcium/calmodulin-dependent protei...   165   2e-39
gi|18448923|gb|AAL69958.1| CaM kinase II gamma G-2 [Mustela puto...   165   2e-39
gi|20178304|sp|Q13555|KCCG_HUMAN Calcium/calmodulin-dependent pr...   165   2e-39
gi|30923520|gb|EAA45998.1| CG17528-PA [Drosophila melanogaster] ...   164   3e-39
gi|4063713|gb|AAC98390.1| calcium/calmodulin-dependent kinase II...   164   3e-39
gi|47212898|emb|CAF90788.1| unnamed protein product [Tetraodon n...   164   3e-39
gi|46048958|ref|NP_989626.1| calcium/calmodulin-dependent protei...   164   3e-39
gi|47225849|emb|CAF98329.1| unnamed protein product [Tetraodon n...   164   3e-39
gi|20152113|gb|AAM11416.1| RE56868p [Drosophila melanogaster]         164   3e-39
gi|30923519|gb|EAA45997.1| CG17528-PC [Drosophila melanogaster] ...   164   3e-39
gi|44804774|gb|AAS47706.1| calcium-dependent protein kinase 2 [C...   164   4e-39
gi|21707842|gb|AAH34044.1| Calcium/calmodulin-dependent protein ...   164   4e-39
gi|125284|sp|P11798|KCCA_MOUSE Calcium/calmodulin-dependent prot...   164   4e-39
gi|25387051|pir||A86427 probable serine/threonine kinase [import...   164   4e-39
gi|21954717|gb|AAM83095.1| SOS2-like protein kinase [Glycine max]     164   4e-39
gi|2271459|gb|AAC13354.1| calcium-dependent protein kinase-a [Pa...   164   5e-39
gi|6137071|emb|CAB59634.1| Ca2+/calmodulin-dependent protein kin...   164   5e-39
gi|50540150|ref|NP_001002542.1| zgc:92792 [Danio rerio] >gnl|BL_...   163   6e-39
gi|23957748|ref|NP_473217.2| calcium-dependent protein kinase, p...   163   6e-39
gi|10443734|gb|AAG17555.1| calcium/calmodulin-dependent protein ...   163   6e-39
gi|29124575|gb|AAH49002.1| Camk2g-prov protein [Xenopus laevis]       163   6e-39
gi|15227739|ref|NP_180595.1| CBL-interacting protein kinase 11 (...   163   6e-39
gi|16226430|gb|AAL16166.1| At2g30360/T9D9.17 [Arabidopsis thaliana]   163   6e-39
gi|7494209|pir||T18445 hypothetical protein C0420w - malaria par...   163   6e-39
gi|49093910|ref|XP_408416.1| hypothetical protein AN4279.2 [Aspe...   163   8e-39
gi|6225242|sp|O15075|DCK1_HUMAN Serine/threonine-protein kinase ...   163   8e-39
gi|50732922|ref|XP_418827.1| PREDICTED: similar to KIAA0342 prot...   163   8e-39
gi|49257872|gb|AAH74394.1| Unknown (protein for MGC:84365) [Xeno...   163   8e-39
gi|10443732|gb|AAG17554.1| calcium/calmodulin-dependent protein ...   162   1e-38
gi|29892113|gb|AAP03012.1| seed calcium dependent protein kinase...   162   1e-38
gi|4884974|gb|AAD31900.1| putative serine/threonine protein kina...   162   1e-38
gi|18397430|ref|NP_564353.1| CBL-interacting protein kinase 23 (...   162   1e-38
gi|15226241|ref|NP_180965.1| CBL-interacting protein kinase 13 (...   162   1e-38
gi|47227854|emb|CAG09017.1| unnamed protein product [Tetraodon n...   162   1e-38
gi|466360|gb|AAA81938.1| calmodulin dependent protein kinase II ...   162   1e-38
gi|33591148|gb|AAQ23078.1| gliding motility related CaM kinase [...   162   2e-38
gi|44804760|gb|AAS47705.1| calcium-dependent protein kinase 1 [C...   162   2e-38
gi|50730959|ref|XP_417099.1| PREDICTED: similar to doublecortin-...   162   2e-38
gi|46125487|ref|XP_387297.1| hypothetical protein FG07121.1 [Gib...   162   2e-38
gi|88515|pir||B26368 protein-serine kinase (EC 2.7.1.-) PSK-H1 -...   161   2e-38
gi|47215384|emb|CAG02200.1| unnamed protein product [Tetraodon n...   161   2e-38
gi|50294063|ref|XP_449443.1| unnamed protein product [Candida gl...   161   3e-38
gi|50424355|ref|XP_460764.1| unnamed protein product [Debaryomyc...   161   3e-38
gi|10443736|gb|AAG17556.1| calcium/calmodulin-dependent protein ...   160   4e-38
gi|603213|gb|AAA57338.1| calcium/calmodulin-dependent kinase typ...   160   4e-38
gi|116054|sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase ...   160   4e-38
gi|3560543|gb|AAC35001.1| DAP-kinase related protein 1 [Homo sap...   160   4e-38
gi|50311127|ref|XP_455587.1| unnamed protein product [Kluyveromy...   160   4e-38
gi|14670383|ref|NP_055141.2| death-associated protein kinase 2 [...   160   5e-38
gi|46488893|gb|AAS99650.1| calcium dependent protein kinase 4 [P...   160   7e-38
gi|23491280|gb|EAA22858.1| calmodulin-domain protein kinase [Pla...   160   7e-38
gi|48141836|ref|XP_393569.1| similar to ENSANGP00000019618 [Apis...   160   7e-38
gi|48100413|ref|XP_395000.1| similar to p69Eg3 protein - African...   160   7e-38
gi|34894358|ref|NP_908504.1| unnamed protein product [Oryza sati...   160   7e-38
gi|3859672|emb|CAA22010.1| serine-threonine protein kinase [Cand...   159   9e-38
gi|45184832|ref|NP_982550.1| AAR009Wp [Eremothecium gossypii] >g...   159   9e-38
gi|46435919|gb|EAK95291.1| hypothetical protein CaO19.9323 [Cand...   159   9e-38
gi|46227305|gb|EAK88255.1| calcium/calmodulin dependent protein ...   159   9e-38
gi|34303892|dbj|BAC82421.1| hypothetical protein [Entamoeba hist...   159   9e-38
gi|34902248|ref|NP_912470.1| Putative serine/threonine kinase [O...   159   9e-38
gi|125286|sp|P28652|KCCB_MOUSE Calcium/calmodulin-dependent prot...   159   9e-38
gi|46485791|gb|AAS98416.1| putative protein kinase [Oryza sativa...   159   9e-38
gi|29892204|gb|AAP03013.1| seed calcium dependent protein kinase...   159   9e-38
gi|7446372|pir||T14736 probable serine/threonine kinase (EC 2.7....   159   1e-37
gi|7434373|pir||S68470 Ca2+/calmodulin-dependent protein kinase ...   159   1e-37
gi|26051216|ref|NP_742080.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|34859991|ref|XP_219275.2| similar to serine/threonine kinase ...   159   1e-37
gi|26051218|ref|NP_742081.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|26051210|ref|NP_742077.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|26051206|ref|NP_742075.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|11120682|ref|NP_068507.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|26051214|ref|NP_742079.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|26051212|ref|NP_742078.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|5326759|gb|AAD42036.1| calcium/calmodulin-dependent protein k...   159   1e-37
gi|12643413|sp|Q13554|KCCB_HUMAN Calcium/calmodulin-dependent pr...   159   1e-37
gi|26051208|ref|NP_742076.1| calcium/calmodulin-dependent protei...   159   1e-37
gi|15223317|ref|NP_171622.1| CBL-interacting protein kinase 9 (C...   159   1e-37
gi|26051204|ref|NP_001211.3| calcium/calmodulin-dependent protei...   159   1e-37
gi|30677901|ref|NP_849571.1| CBL-interacting protein kinase 9 (C...   159   1e-37
gi|14318536|ref|NP_116669.1| Calmodulin-dependent protein kinase...   159   2e-37
gi|1084335|pir||S46284 calcium-dependent protein kinase (EC 2.7....   159   2e-37
gi|15219693|ref|NP_174807.1| calcium-dependent protein kinase 2 ...   159   2e-37
gi|47217368|emb|CAG11073.1| unnamed protein product [Tetraodon n...   158   2e-37
gi|17542804|ref|NP_499937.1| protein kinase and Kinase-associate...   158   2e-37
gi|4139268|gb|AAD03743.1| calcium/calmodulin-dependent protein k...   158   2e-37
gi|15215664|gb|AAK91377.1| AT5g25110/T11H3_120 [Arabidopsis thal...   158   2e-37
gi|18420882|ref|NP_568466.1| CBL-interacting protein kinase 25 (...   158   2e-37
gi|30025099|gb|AAP13765.1| Hypothetical protein W03G1.6b [Caenor...   158   2e-37
gi|4139270|gb|AAD03744.1| calcium/calmodulin-dependent protein k...   158   2e-37
gi|15808685|gb|AAL06641.1| serine-threonine protein kinase [Ancy...   158   2e-37
gi|2760821|gb|AAB95270.1| serine/threonine protein kinase [Entam...   158   2e-37
gi|17980212|gb|AAL50556.1| serine-threonine protein kinase PK2 [...   158   2e-37
gi|46048967|ref|NP_989625.1| calcium/calmodulin-dependent protei...   158   2e-37
gi|6644464|gb|AAF21062.1| calcium-dependent protein kinase [Duna...   158   3e-37
gi|10863901|ref|NP_004750.1| mitogen-activated protein kinase-ac...   158   3e-37
gi|32481209|ref|NP_116584.2| mitogen-activated protein kinase-ac...   158   3e-37
gi|47212671|emb|CAF94152.1| unnamed protein product [Tetraodon n...   157   3e-37
gi|14423524|gb|AAK62444.1| similar to wpk4 protein kinase [Arabi...   157   3e-37
gi|23943882|ref|NP_112168.1| serine/threonine kinase 33 [Homo sa...   157   3e-37
gi|14970920|emb|CAC44471.1| calcium dependent calmodulin indepen...   157   3e-37
gi|22658392|gb|AAH31231.1| Serine/threonine kinase 33 [Homo sapi...   157   3e-37
gi|31982483|ref|NP_031621.2| calcium/calmodulin-dependent protei...   157   3e-37
gi|2315243|emb|CAA68090.1| CDPK2 [Plasmodium falciparum]              157   3e-37
gi|23612188|ref|NP_703768.1| calcium-dependent protein kinase [P...   157   3e-37
gi|3556|emb|CAA40281.1| calmodulin-dependent protein kinase type...   157   5e-37
gi|32419048|ref|XP_330002.1| hypothetical protein [Neurospora cr...   157   5e-37
gi|50508332|dbj|BAD30183.1| putative serine/threonine kinase [Or...   157   5e-37
gi|33146743|dbj|BAC79646.1| putative calcium-dependent protein k...   157   5e-37
gi|24899813|gb|AAN65121.1| serine/threonine protein kinase-like ...   157   5e-37
gi|30683398|ref|NP_568241.2| CBL-interacting protein kinase 5 (C...   157   5e-37
gi|34909714|ref|NP_916204.1| OsPK4-like protein [Oryza sativa (j...   157   6e-37
gi|23612547|ref|NP_704108.1| calmodulin-domain protein kinase, p...   157   6e-37
gi|30683328|ref|NP_850092.1| CBL-interacting protein kinase 3 (C...   157   6e-37
gi|50355719|gb|AAT75244.1| putative calcium-dependent protein ki...   157   6e-37
gi|30683332|ref|NP_850093.1| CBL-interacting protein kinase 3 (C...   157   6e-37
gi|39587537|emb|CAE58475.1| Hypothetical protein CBG01615 [Caeno...   157   6e-37
gi|30683336|ref|NP_850094.1| CBL-interacting protein kinase 3 (C...   157   6e-37
gi|15224978|ref|NP_181425.1| calcium-dependent protein kinase, p...   157   6e-37
gi|33304099|gb|AAQ02557.1| mitogen-activated protein kinase-acti...   157   6e-37
gi|33243964|gb|AAH55331.1| Ribosomal protein S6 kinase, polypept...   157   6e-37
gi|6755374|ref|NP_035429.1| ribosomal protein S6 kinase, polypep...   157   6e-37
gi|12860267|dbj|BAB31901.1| unnamed protein product [Mus musculus]    157   6e-37
gi|21039158|gb|AAM33514.1| calcium/calmodulin-dependent protein ...   157   6e-37
gi|50427069|ref|XP_462141.1| unnamed protein product [Debaryomyc...   156   8e-37
gi|45552151|ref|NP_995598.1| CG32019-PC [Drosophila melanogaster...   156   8e-37
gi|2134984|pir||I37275 death-associated protein kinase (EC 2.7.1...   156   8e-37
gi|45552153|ref|NP_995599.1| CG32019-PD [Drosophila melanogaster...   156   8e-37
gi|15010494|gb|AAK77295.1| GH07636p [Drosophila melanogaster]         156   8e-37
gi|3560545|gb|AAC35002.1| DAP-kinase related protein 1 [Mus musc...   156   8e-37
gi|28558739|ref|NP_726608.2| CG32019-PA [Drosophila melanogaster...   156   8e-37
gi|50287495|ref|XP_446177.1| unnamed protein product [Candida gl...   156   8e-37
gi|34935429|ref|XP_234468.2| similar to ribosomal protein S6 kin...   156   8e-37
gi|45552149|ref|NP_995597.1| CG32019-PE [Drosophila melanogaster...   156   8e-37
gi|1346539|sp|P49138|MKK2_MOUSE MAP kinase-activated protein kin...   156   1e-36
gi|7512013|pir||T13931 projectin - fruit fly (Drosophila melanog...   156   1e-36
gi|7428006|pir||S71776 calcium-dependent protein kinase (EC 2.7....   156   1e-36
gi|15237791|ref|NP_197748.1| calcium-dependent protein kinase 9 ...   156   1e-36
gi|33638111|gb|AAQ24165.1| ribosomal protein S6 kinase splice va...   156   1e-36
gi|26328137|dbj|BAC27809.1| unnamed protein product [Mus musculus]    156   1e-36
gi|1076202|pir||S54788 calcium-stimulated protein kinase - Chlam...   156   1e-36
gi|14423914|sp|Q9GM70|S17A_RABIT Serine/threonine-protein kinase...   156   1e-36
gi|34907870|ref|NP_915282.1| putative serine/threonine protein k...   155   1e-36
gi|46437276|gb|EAK96625.1| hypothetical protein CaO19.9491 [Cand...   155   1e-36
gi|17224924|gb|AAL37170.1| CBL-interacting protein kinase [Brass...   155   1e-36
gi|15235768|ref|NP_194825.1| CBL-interacting protein kinase 6 (C...   155   1e-36
gi|40363533|ref|NP_954682.1| serum/glucocorticoid regulated kina...   155   1e-36
gi|7434370|pir||T08873 calcium-dependent protein kinase (EC 2.7....   155   1e-36
gi|26349831|dbj|BAC38555.1| unnamed protein product [Mus musculus]    155   1e-36
gi|46437336|gb|EAK96684.1| hypothetical protein CaO19.1936 [Cand...   155   1e-36
gi|6324557|ref|NP_014626.1| Calmodulin-dependent protein kinase;...   155   1e-36
gi|15238499|ref|NP_198391.1| CBL-interacting protein kinase 24 (...   155   2e-36
gi|15289760|dbj|BAB63464.1| calcium dependent protein kinase [So...   155   2e-36
gi|50549683|ref|XP_502312.1| hypothetical protein [Yarrowia lipo...   155   2e-36
gi|50428135|ref|XP_458207.1| unnamed protein product [Debaryomyc...   155   2e-36
gi|4325074|gb|AAD17247.1| protein kinase 6 [Toxoplasma gondii]        155   2e-36
gi|30017431|ref|NP_835203.1| MAP kinase-activated protein kinase...   155   2e-36
gi|45544580|ref|NP_032577.1| MAP kinase-activated protein kinase...   155   2e-36
gi|24638621|ref|NP_726573.1| CG1495-PD [Drosophila melanogaster]...   155   2e-36
gi|25012400|gb|AAN71308.1| RE12039p [Drosophila melanogaster]         155   2e-36
gi|12484155|gb|AAG53994.1| calmodulin-domain protein kinase 2 [T...   155   2e-36
gi|1942208|pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia...   155   2e-36
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans]    155   2e-36
gi|24620456|gb|AAN61520.1| 301KDa_1 protein [Caenorhabditis eleg...   155   2e-36
gi|39593042|emb|CAE64511.1| Hypothetical protein CBG09247 [Caeno...   155   2e-36
gi|23482698|gb|EAA18606.1| calcium-dependent protein kinase-3 [P...   155   2e-36
gi|30699042|ref|NP_177612.2| calcium-dependent protein kinase, p...   155   2e-36
gi|39598579|gb|AAR28766.1| calcium-dependent protein kinase [Vit...   155   2e-36
gi|15241067|ref|NP_195802.1| CBL-interacting protein kinase 14 (...   155   2e-36
gi|19923570|ref|NP_066958.2| ribosomal protein S6 kinase, 90kDa,...   155   2e-36
gi|6166243|sp|Q15349|K6A2_HUMAN Ribosomal protein S6 kinase alph...   155   2e-36
gi|34913564|ref|NP_918129.1| putative serine/threonine-specific ...   155   2e-36
gi|13676454|dbj|BAB41150.1| hypothetical protein [Macaca fascicu...   155   2e-36
gi|13592065|ref|NP_112369.1| S6 protein kinase (Rsk-1) [Rattus n...   155   2e-36
gi|39593435|emb|CAE64905.1| Hypothetical protein CBG09724 [Caeno...   154   3e-36
gi|14133229|dbj|BAA76843.2| KIAA0999 protein [Homo sapiens]           154   3e-36
gi|30677898|ref|NP_849570.1| CBL-interacting protein kinase 9 (C...   154   3e-36
gi|33304033|gb|AAQ02524.1| serine/threonine kinase 17a [syntheti...   154   3e-36
gi|15233981|ref|NP_193605.1| CBL-interacting protein kinase 12 (...   154   3e-36
gi|4758192|ref|NP_004751.1| serine/threonine kinase 17a (apoptos...   154   3e-36
gi|47218832|emb|CAG02817.1| unnamed protein product [Tetraodon n...   154   3e-36
gi|38569491|ref|NP_079440.2| KIAA0999 protein [Homo sapiens]          154   3e-36
gi|48094488|ref|XP_394194.1| similar to ENSANGP00000022382 [Apis...   154   3e-36
gi|32528295|ref|NP_004746.2| ribosomal protein S6 kinase, 90kDa,...   154   3e-36
gi|38074389|ref|XP_111421.2| similar to myosin light chain kinas...   154   3e-36
gi|25387057|pir||G86141 protein T25K16.13 [imported] - Arabidops...   154   3e-36
gi|21667003|gb|AAM73862.1| putative serine/threonine protein kin...   154   4e-36
gi|21667000|gb|AAM73861.1| putative serine/threonine protein kin...   154   4e-36
gi|50312161|ref|XP_456112.1| unnamed protein product [Kluyveromy...   154   4e-36
gi|21666992|gb|AAM73857.1| putative serine/threonine protein kin...   154   4e-36
gi|21666998|gb|AAM73860.1| putative serine/threonine protein kin...   154   4e-36
gi|39585101|emb|CAE62752.1| Hypothetical protein CBG06916 [Caeno...   154   4e-36
gi|7434354|pir||T10449 probable serine/threonine-specific protei...   154   4e-36
gi|1078931|pir||S49128 twitchin-like protein - California sea ha...   154   4e-36
gi|39582609|emb|CAE63928.1| Hypothetical protein CBG08504 [Caeno...   154   5e-36
gi|50422777|ref|XP_459965.1| unnamed protein product [Debaryomyc...   154   5e-36
gi|50761830|ref|XP_424850.1| PREDICTED: similar to calcium/calmo...   154   5e-36
gi|39752597|gb|AAR30180.1| RE47050p [Drosophila melanogaster]         154   5e-36
gi|15042605|gb|AAK82365.1| Ser/Thr protein kinase PAR-1alpha [Dr...   154   5e-36
gi|30038712|dbj|BAC75706.1| similar to maternal embryonic leucin...   154   5e-36
gi|15233947|ref|NP_192695.1| calcium-dependent protein kinase, p...   154   5e-36
gi|19310195|dbj|BAB85907.1| p90 ribosomal S6 kinase [Asterina pe...   154   5e-36
gi|45552749|ref|NP_995899.1| CG8201-PB [Drosophila melanogaster]...   154   5e-36
gi|45552751|ref|NP_995900.1| CG8201-PA [Drosophila melanogaster]...   154   5e-36
gi|34909718|ref|NP_916206.1| OsPK7 [Oryza sativa (japonica culti...   153   7e-36
gi|8928460|sp|O75962|TRIO_HUMAN Triple functional domain protein...   153   7e-36
gi|2117824|pir||I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-...   153   7e-36
gi|20149547|ref|NP_002944.2| ribosomal protein S6 kinase, 90kDa,...   153   7e-36
gi|38648708|gb|AAH63268.1| BC033915 protein [Mus musculus]            153   7e-36
gi|33303975|gb|AAQ02495.1| ribosomal protein S6 kinase, 90kDa, p...   153   7e-36
gi|34303888|dbj|BAC82419.1| hypothetical protein [Entamoeba hist...   153   7e-36
gi|33304069|gb|AAQ02542.1| ribosomal protein S6 kinase, 90kDa, p...   153   7e-36
gi|38110185|gb|EAA55945.1| hypothetical protein MG01596.4 [Magna...   153   7e-36
gi|20260556|gb|AAM13176.1| unknown protein [Arabidopsis thaliana]     153   7e-36
gi|33354095|dbj|BAC81131.1| RPS6KA3 [Homo sapiens] >gnl|BL_ORD_I...   153   7e-36
gi|4759050|ref|NP_004577.1| ribosomal protein S6 kinase, 90kDa, ...   153   7e-36
gi|22507357|ref|NP_683747.1| ribosomal protein S6 kinase polypep...   153   7e-36
gi|91277|pir||C32571 ribosomal protein S6 kinase II (EC 2.7.-.-)...   153   7e-36
gi|40226068|gb|AAH17268.1| TRIO protein [Homo sapiens]                153   7e-36
gi|47077363|dbj|BAD18570.1| unnamed protein product [Homo sapiens]    153   7e-36
gi|46195779|ref|NP_996771.2| maternal embryonic leucine zipper k...   153   7e-36
gi|34100406|gb|AAQ57276.1| calmodulin-dependent protein kinase t...   153   7e-36
gi|3522970|gb|AAC34245.1| Trio [Homo sapiens]                         153   7e-36
gi|45439359|ref|NP_009049.2| triple functional domain (PTPRF int...   153   7e-36
gi|6094310|sp|O94168|SNF1_CANTR Carbon catabolite derepressing p...   153   9e-36
gi|47230027|emb|CAG10441.1| unnamed protein product [Tetraodon n...   153   9e-36
gi|47229499|emb|CAF99487.1| unnamed protein product [Tetraodon n...   153   9e-36
gi|15222045|ref|NP_172728.1| protein kinase family protein [Arab...   153   9e-36
gi|50748598|ref|XP_421318.1| PREDICTED: similar to ribosomal pro...   153   9e-36
gi|6677811|ref|NP_033123.1| ribosomal protein S6 kinase polypept...   153   9e-36
gi|46229407|gb|EAK90225.1| calcium/calmodulin-dependent protein ...   153   9e-36
gi|29294760|gb|AAH49076.1| Rps6ka1 protein [Mus musculus]             153   9e-36
gi|25402738|pir||D86260 protein T12C24.22 [imported] - Arabidops...   153   9e-36
gi|25145904|ref|NP_741548.1| fibronectin, type III and protein k...   152   1e-35
gi|14329670|emb|CAA78913.2| p69Eg3 [Xenopus laevis]                   152   1e-35
gi|1079310|pir||S52244 p69Eg3 protein - African clawed frog           152   1e-35
gi|31240093|ref|XP_320460.1| ENSANGP00000016067 [Anopheles gambi...   152   1e-35
gi|23268465|gb|AAN11310.1| calmodulin domain protein kinase 1 [C...   152   1e-35
gi|24620457|gb|AAN61521.1| 301KDa_2 protein [Caenorhabditis eleg...   152   1e-35
gi|7498954|pir||T34416 hypothetical protein F12F3.2 - Caenorhabd...   152   1e-35
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans]    152   1e-35
gi|27819504|gb|AAO24908.1| putative calcium-dependent protein ki...   152   1e-35
gi|50427081|ref|XP_462147.1| unnamed protein product [Debaryomyc...   152   1e-35
gi|31240095|ref|XP_320461.1| ENSANGP00000022382 [Anopheles gambi...   152   1e-35
gi|25145902|ref|NP_741549.1| fibronectin, type III and protein k...   152   1e-35
gi|33636738|ref|NP_891993.1| cAMP-dependent protein kinase catal...   152   1e-35
gi|37359816|dbj|BAC97886.1| mKIAA0175 protein [Mus musculus]          152   1e-35
gi|30109251|gb|AAH51169.1| Trio protein [Mus musculus]                152   1e-35
gi|3116066|emb|CAA11528.1| s-sgk2 [Squalus acanthias]                 152   1e-35
gi|25143976|ref|NP_741254.1| protein kinase KIN10 (3J848) [Caeno...   152   1e-35
gi|3554|emb|CAA40928.1| Ca2+/calmodulin-dependent protein kinase...   152   1e-35
gi|47221231|emb|CAG13167.1| unnamed protein product [Tetraodon n...   152   1e-35
gi|34867929|ref|XP_342829.1| similar to protein kinase PK38 [Rat...   152   1e-35
gi|41056189|ref|NP_957317.1| similar to protein kinase, cAMP dep...   152   1e-35
gi|34854901|ref|XP_226888.2| similar to Triple functional domain...   152   1e-35
gi|125218|sp|P24256|KAPI_BOVIN cAMP-dependent protein kinase, be...   152   1e-35
gi|27807059|ref|NP_777010.1| cAMP-dependent protein kinase catal...   152   1e-35
gi|4506057|ref|NP_002722.1| cAMP-dependent protein kinase cataly...   152   1e-35
gi|15218854|ref|NP_174217.1| CBL-interacting protein kinase 18 (...   152   1e-35
gi|50758162|ref|XP_415789.1| PREDICTED: similar to Psph-A protei...   152   2e-35
gi|49116933|gb|AAH73077.1| Sgk protein [Xenopus laevis]               152   2e-35
gi|46433231|gb|EAK92679.1| hypothetical protein CaO19.399 [Candi...   152   2e-35
gi|11066952|gb|AAG28776.1| CBL-interacting protein kinase 1 [Ara...   152   2e-35
gi|38087657|ref|XP_358897.1| similar to Serine/Threonine kinase ...   152   2e-35
gi|28950006|emb|CAD70761.1| probable serine/threonine protein ki...   152   2e-35
gi|32442211|gb|AAP82174.1| CIPK-like protein [Oryza sativa (japo...   152   2e-35
gi|38088242|ref|XP_110633.2| serine/threonine kinase 33 [Mus mus...   152   2e-35
gi|631291|pir||S39793 MAPK-activated protein kinase 2 (EC 2.7.1....   152   2e-35
gi|31981626|ref|NP_034920.2| maternal embryonic leucine zipper k...   152   2e-35
gi|50400863|sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipp...   152   2e-35
gi|37805197|gb|AAH60363.1| MGC68791 protein [Xenopus laevis]          152   2e-35
gi|50417908|gb|AAH78343.1| Unknown (protein for MGC:91856) [Dani...   152   2e-35
gi|34903780|ref|NP_913237.1| unnamed protein product [Oryza sati...   151   2e-35
gi|33589284|gb|AAQ22409.1| SD05712p [Drosophila melanogaster]         151   2e-35
gi|125692|sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II al...   151   2e-35
gi|45552745|ref|NP_995897.1| CG8201-PF [Drosophila melanogaster]...   151   2e-35
gi|50252468|dbj|BAD28646.1| putative CBL-interacting protein kin...   151   2e-35


>gi|17508559|ref|NP_490820.1| protein kinase (44.0 kD) (1B564)
            [Caenorhabditis elegans]
 gi|25395232|pir||G87723 protein R06A10.4 [imported] - Caenorhabditis
            elegans
 gi|2773215|gb|AAB96730.1| Hypothetical protein R06A10.4
            [Caenorhabditis elegans]
          Length = 391

 Score =  753 bits (1945), Expect = 0.0
 Identities = 377/391 (96%), Positives = 377/391 (96%)
 Frame = -1

Query: 1176 MGNCSQKQSGSAVGSTGTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA 997
            MGNCSQKQSGSAVGSTGTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA
Sbjct: 1    MGNCSQKQSGSAVGSTGTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA 60

Query: 996  MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAVNNELNILSRLS 817
            MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAVNNELNILSRLS
Sbjct: 61   MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAVNNELNILSRLS 120

Query: 816  HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS 637
            HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS
Sbjct: 121  HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS 180

Query: 636  IRVTHRDLKPENLLYADSRPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV 457
            IRVTHRDLKPENLLYADSRPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV
Sbjct: 181  IRVTHRDLKPENLLYADSRPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV 240

Query: 456  PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD 277
            PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD
Sbjct: 241  PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD 300

Query: 276  SLLETNSVERLSSSAAMKHEWLTGEXXXXXXXXXXXXXXSEYNSMQRTKSTRSIRSVTRS 97
            SLLETNSVERLSSSAAMKHEWLTGE              SEYNSMQRTKSTRSIRSVTRS
Sbjct: 301  SLLETNSVERLSSSAAMKHEWLTGERPSTTQSRPPTRPTSEYNSMQRTKSTRSIRSVTRS 360

Query: 96   DHGHRVDPREVDELANDLKRVAQTTKNYGVF 4
            DHGHRVDPREVDELANDLKRVAQTTKNYGVF
Sbjct: 361  DHGHRVDPREVDELANDLKRVAQTTKNYGVF 391


>gi|39589335|emb|CAE74364.1| Hypothetical protein CBG22088
            [Caenorhabditis briggsae]
          Length = 391

 Score =  742 bits (1915), Expect = 0.0
 Identities = 368/391 (94%), Positives = 375/391 (95%)
 Frame = -1

Query: 1176 MGNCSQKQSGSAVGSTGTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA 997
            MGNCSQKQSGS VGS+GTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA
Sbjct: 1    MGNCSQKQSGSTVGSSGTSFFSNLFHKAHIDPHALAQTCPPPHGGEMPLGECAVLRDRPA 60

Query: 996  MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAVNNELNILSRLS 817
            MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKY+AVKVVNGDCGAVNNELNILSR+S
Sbjct: 61   MRFDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYYAVKVVNGDCGAVNNELNILSRMS 120

Query: 816  HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS 637
            HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS
Sbjct: 121  HPFVIRLEEVFKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHS 180

Query: 636  IRVTHRDLKPENLLYADSRPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV 457
            IRVTHRDLKPENLLY+D+RPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV
Sbjct: 181  IRVTHRDLKPENLLYSDARPEARLLITDFGLAYQATKPNETMTETCGTPEYIAPELLLRV 240

Query: 456  PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD 277
            PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD
Sbjct: 241  PYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVD 300

Query: 276  SLLETNSVERLSSSAAMKHEWLTGEXXXXXXXXXXXXXXSEYNSMQRTKSTRSIRSVTRS 97
            SLLETNS ERLS+S+AMKHEWLTGE              SEYNSMQRTKSTRSIRSVTRS
Sbjct: 301  SLLETNSAERLSASSAMKHEWLTGERPTTSQNRPPTRPTSEYNSMQRTKSTRSIRSVTRS 360

Query: 96   DHGHRVDPREVDELANDLKRVAQTTKNYGVF 4
            DHGHRVDPREVDELANDLKRVAQTTKNYGVF
Sbjct: 361  DHGHRVDPREVDELANDLKRVAQTTKNYGVF 391




[DB home][top]