Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R06B10_5
(1089 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre... 700 0.0
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd... 592 e-168
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno... 523 e-147
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum] 72 2e-11
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 69 1e-10
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 67 6e-10
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 67 9e-10
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 65 4e-09
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ... 64 8e-09
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 63 1e-08
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 63 1e-08
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 63 1e-08
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 63 1e-08
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 62 2e-08
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 62 3e-08
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 61 4e-08
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 61 4e-08
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno... 61 5e-08
gi|34854717|ref|XP_215737.2| similar to phospholipase A2 recepto... 60 9e-08
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 60 1e-07
gi|27465527|ref|NP_775120.1| pancreatitis-associated protein 3 [... 60 1e-07
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 60 1e-07
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 59 2e-07
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 59 2e-07
gi|17565466|ref|NP_507951.1| lithostathine like family member (5... 59 3e-07
gi|444786|prf||1908220B pancreatitis-associated protein 58 4e-07
gi|9800611|gb|AAB33848.2| peptide 23; pancreatitis-associated pr... 58 4e-07
gi|14042980|ref|NP_114433.1| regenerating islet-derived family, ... 58 4e-07
gi|6754980|ref|NP_035166.1| pancreatitis-associated protein; Reg... 57 6e-07
gi|129626|sp|P25031|PAP1_RAT Pancreatitis-associated protein 1 p... 57 6e-07
gi|254695|gb|AAB23103.1| Reg-2 [Rattus sp.] 57 6e-07
gi|16757982|ref|NP_445741.1| pancreatitis-associated protein; Pa... 57 6e-07
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 57 7e-07
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 57 7e-07
gi|225342|prf||1301209A lectin 57 1e-06
gi|135619|sp|P26258|TETN_CARSP Tetranectin-like protein >gnl|BL_... 57 1e-06
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 56 1e-06
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 56 1e-06
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 56 2e-06
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 56 2e-06
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 55 2e-06
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 55 2e-06
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 55 3e-06
gi|10835248|ref|NP_006498.1| regenerating islet-derived 1 beta p... 55 4e-06
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 54 5e-06
gi|45430003|ref|NP_991356.1| pancreatic thread protein [Bos taur... 54 5e-06
gi|17551160|ref|NP_509202.1| lithostathine like precursor family... 54 5e-06
gi|27807147|ref|NP_777058.1| domain) lectin, superfamily member ... 54 6e-06
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 54 6e-06
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 54 6e-06
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 53 1e-05
gi|21426887|ref|NP_038921.1| islet neogenesis associated protein... 53 1e-05
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 53 1e-05
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs... 53 1e-05
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 53 1e-05
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 53 1e-05
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 53 1e-05
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 53 1e-05
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 53 1e-05
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 53 1e-05
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres... 53 1e-05
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 53 1e-05
gi|6633974|dbj|BAA88564.1| Reg III delta [Mus musculus] >gnl|BL_... 52 2e-05
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 52 2e-05
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 52 2e-05
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O... 52 2e-05
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 52 2e-05
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 52 2e-05
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 52 2e-05
gi|40363429|dbj|BAD06213.1| pancreatitis-associated protein [Can... 52 3e-05
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 52 3e-05
gi|33243102|gb|AAQ01221.1| C-type lectin CTL-7 [Echis pyramidum ... 52 3e-05
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 52 3e-05
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 52 3e-05
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 52 3e-05
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 51 4e-05
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha... 51 4e-05
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 51 4e-05
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 51 4e-05
gi|33243076|gb|AAQ01208.1| C-type lectin CTL-5 [Bitis arietans] 51 5e-05
gi|37993395|gb|AAR06853.1| C-type lectin-3 [Bitis gabonica] 51 5e-05
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 51 5e-05
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 51 5e-05
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [... 51 5e-05
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 51 5e-05
gi|7441631|pir||I83377 regenerating protein III (reg III) - rat ... 51 5e-05
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 50 7e-05
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres... 50 7e-05
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 50 7e-05
gi|5031637|ref|NP_005743.1| C-type lectin, superfamily member 1 ... 50 7e-05
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 50 7e-05
gi|3212622|pdb|1TN3| The C-Type Lectin Carbohydrate Recognition... 50 7e-05
gi|37181877|gb|AAQ88742.1| CLECSF1 [Homo sapiens] 50 7e-05
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 50 9e-05
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres... 50 9e-05
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 50 9e-05
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 50 9e-05
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru... 50 9e-05
gi|665485|gb|AAA96811.1| tetranectin 50 9e-05
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 50 9e-05
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 50 1e-04
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re... 50 1e-04
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 50 1e-04
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 50 1e-04
gi|26344636|dbj|BAC35967.1| unnamed protein product [Mus musculus] 50 1e-04
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 49 2e-04
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 49 2e-04
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 49 2e-04
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1... 49 2e-04
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres... 49 2e-04
gi|3023232|sp|P81114|ABA4_TRIAB Alboaggregin A subunit 4 49 2e-04
gi|4505605|ref|NP_002571.1| pancreatitis-associated protein prec... 49 3e-04
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 49 3e-04
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 49 3e-04
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 49 3e-04
gi|3023251|sp|P81116|ABBB_TRIAB Alboaggregin B beta subunit 49 3e-04
gi|42543880|pdb|1UV0|A Chain A, Pancreatitis-Associated Protein ... 49 3e-04
gi|189601|gb|AAA36415.1| pancreatitis associated protein 49 3e-04
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 48 3e-04
gi|18426875|ref|NP_550435.1| asialoglycoprotein receptor 2 isofo... 48 3e-04
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 48 3e-04
gi|6686332|sp|Q92778|PBCG_MESAU Pancreatic beta cell growth fact... 48 3e-04
gi|4502253|ref|NP_001172.1| asialoglycoprotein receptor 2 isofor... 48 3e-04
gi|1514682|gb|AAB86497.1| pancreatic beta cell growth factor [Me... 48 3e-04
gi|18426877|ref|NP_550436.1| asialoglycoprotein receptor 2 isofo... 48 3e-04
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru... 48 3e-04
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 48 3e-04
gi|33328316|gb|AAQ09608.1| HBxAg-binding protein [Homo sapiens] 48 3e-04
gi|7512196|pir||JC7105 aggretin beta chain - Malayan pit viper >... 48 5e-04
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 48 5e-04
gi|33341192|gb|AAQ15157.1| factor IX/X binding protein beta chai... 48 5e-04
gi|17543580|ref|NP_500257.1| c-type lectin precursor family memb... 48 5e-04
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 48 5e-04
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 48 5e-04
gi|34851945|ref|XP_344774.1| similar to C-type lectin superfamil... 48 5e-04
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 48 5e-04
gi|25742852|ref|NP_742074.1| regenerating islet-derived 3 alpha ... 48 5e-04
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 48 5e-04
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 48 5e-04
gi|28488673|ref|XP_286121.1| similar to C-type lectin superfamil... 47 6e-04
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 47 6e-04
gi|2851436|sp|P23807|IXB_TRIFL Coagulation factor IX/factor X-bi... 47 6e-04
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 47 6e-04
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 47 8e-04
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 47 8e-04
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii... 47 8e-04
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 47 8e-04
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs... 47 8e-04
gi|213876|gb|AAA49618.1| antifreeze protein 47 8e-04
gi|50418093|gb|AAH77648.1| Unknown (protein for MGC:86525) [Xeno... 47 8e-04
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor 47 8e-04
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m... 47 8e-04
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT... 47 8e-04
gi|11693134|ref|NP_071788.1| Gal/GalNAc-specific lectin; monogly... 47 8e-04
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu] 47 0.001
gi|6755308|ref|NP_035389.1| regenerating islet-derived 3 alpha; ... 47 0.001
gi|49456831|emb|CAG46736.1| UNQ429 [Homo sapiens] 47 0.001
gi|38348213|ref|NP_940850.1| LPPM429 [Homo sapiens] >gnl|BL_ORD_... 47 0.001
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1... 47 0.001
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr... 47 0.001
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|... 47 0.001
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1... 47 0.001
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ... 47 0.001
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus] 47 0.001
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ... 47 0.001
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai... 46 0.001
gi|12060181|dbj|BAB20441.1| anticoagulant protein-B [Deinagkistr... 46 0.001
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis] 46 0.001
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 46 0.001
gi|34365423|emb|CAE46048.1| hypothetical protein [Homo sapiens] 46 0.001
gi|3212544|pdb|1IXX|B Chain B, Crystal Structure Of Coagulation ... 46 0.001
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote... 46 0.001
gi|31335113|gb|AAO32796.1| polycystic kidney disease 1-like 2 [H... 46 0.001
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h... 46 0.002
gi|6633978|dbj|BAA88566.1| Islet neogenesis associated protein [... 46 0.002
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb... 46 0.002
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H... 46 0.002
gi|1091923|prf||2022211A asialoglycoprotein receptor 46 0.002
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n... 46 0.002
gi|33598940|ref|NP_877417.1| polycystin 1-like 2 isoform b [Homo... 46 0.002
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp... 46 0.002
gi|33598942|ref|NP_443124.2| polycystin 1-like 2 isoform a [Homo... 46 0.002
gi|50793953|ref|XP_423644.1| PREDICTED: similar to C-type lectin... 45 0.002
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 45 0.002
gi|6980876|pdb|1QDD|A Chain A, Crystal Structure Of Human Lithos... 45 0.002
gi|34870060|ref|XP_341024.1| similar to CD209 antigen; dendritic... 45 0.002
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 45 0.002
gi|47230430|emb|CAF99623.1| unnamed protein product [Tetraodon n... 45 0.002
gi|21410278|gb|AAH31064.1| Unknown (protein for MGC:33379) [Homo... 45 0.003
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 45 0.003
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis] 45 0.003
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 45 0.003
gi|13445904|gb|AAK26430.1| agkisasin-b [Deinagkistrodon acutus] 45 0.003
gi|31559055|gb|AAP50528.1| agkisasin-b [Deinagkistrodon acutus] 45 0.003
gi|39593681|emb|CAE61973.1| Hypothetical protein CBG05976 [Caeno... 45 0.003
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus] 45 0.004
gi|31541842|ref|NP_083962.1| polycystin 1-like 2; polycystic kid... 45 0.004
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL) 45 0.004
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti... 45 0.004
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica] 45 0.004
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n... 45 0.004
gi|1942639|pdb|1LIT| Human Lithostathine 45 0.004
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit 45 0.004
gi|321190|pir||A45751 pancreatic stone protein precursor - human... 45 0.004
gi|29725633|ref|NP_002900.2| regenerating islet-derived 1 alpha ... 45 0.004
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 44 0.005
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 44 0.005
gi|17544700|ref|NP_502450.1| serum lectin like precursor family ... 44 0.005
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu... 44 0.005
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ... 44 0.005
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus] 44 0.005
gi|33341186|gb|AAQ15154.1| factor IX/X binding protein beta chai... 44 0.005
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi... 44 0.005
gi|33638231|gb|AAQ24216.1| coagulation factor IX-binding protein... 44 0.005
gi|14719571|pdb|1IOD|B Chain B, Crystal Structure Of The Complex... 44 0.005
gi|32699622|sp|Q9PRS8|OC17_CHICK Ovocleidin 17 (OC-17) >gnl|BL_O... 44 0.005
gi|50762093|ref|XP_424932.1| PREDICTED: similar to embryonic bla... 44 0.005
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 44 0.005
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus] 44 0.007
gi|39592589|emb|CAE63666.1| Hypothetical protein CBG08168 [Caeno... 44 0.007
gi|17543508|ref|NP_500448.1| c-type lectin family member (22.4 k... 44 0.007
gi|12842671|dbj|BAB25687.1| unnamed protein product [Mus musculus] 44 0.007
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor... 44 0.007
gi|17543498|ref|NP_500443.1| predicted CDS, RNA-directed DNA pol... 44 0.007
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 44 0.007
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 44 0.007
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 44 0.007
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)... 44 0.007
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL... 44 0.007
gi|48060081|gb|AAF60603.2| Hypothetical protein Y46C8AL.6 [Caeno... 44 0.007
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g... 44 0.007
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g... 44 0.007
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 44 0.007
gi|30025075|gb|AAP13751.1| Hypothetical protein Y46C8AR.2b [Caen... 44 0.007
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu] 44 0.007
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus] 44 0.007
gi|31615312|pdb|1GZ2|A Chain A, Crystal Structure Of The Ovoclei... 44 0.007
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 44 0.007
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 44 0.009
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 44 0.009
gi|11967287|gb|AAG42041.1| agkicetin beta subunit precursor [Dei... 44 0.009
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 44 0.009
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 44 0.009
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 44 0.009
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 44 0.009
gi|49355286|gb|AAT65188.1| asialoglycoprotein receptor major sub... 44 0.009
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 43 0.011
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene... 43 0.011
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g... 43 0.011
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus] 43 0.011
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 43 0.011
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 43 0.011
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 43 0.011
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 43 0.011
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat... 43 0.011
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor 43 0.011
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [... 43 0.011
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus] 43 0.015
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s... 43 0.015
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 43 0.015
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 43 0.015
gi|39587934|emb|CAE67953.1| Hypothetical protein CBG13556 [Caeno... 43 0.015
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 43 0.015
gi|47208253|emb|CAF93060.1| unnamed protein product [Tetraodon n... 43 0.015
gi|48060080|gb|AAF60602.3| Hypothetical protein Y46C8AL.5 [Caeno... 42 0.019
gi|25148862|ref|NP_500442.2| c-type lectin family member (4E711)... 42 0.019
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 42 0.019
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1... 42 0.019
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 42 0.019
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r... 42 0.019
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 42 0.019
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 42 0.019
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 42 0.019
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 42 0.019
gi|38176075|gb|AAC69343.2| Hypothetical protein Y73C8C.2 [Caenor... 42 0.019
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 42 0.019
gi|1143285|gb|AAA87847.1| brevican core protein 42 0.019
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 42 0.019
gi|11277030|pir||S78774 perlucin - Haliotis laevigata 42 0.019
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 42 0.019
gi|181168|gb|AAA35726.1| proteoglycan core protein 42 0.019
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 42 0.019
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 42 0.019
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 42 0.019
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 42 0.019
gi|190981|gb|AAA36559.1| regenerating protein (reg) 42 0.019
gi|46395874|sp|Q8HY01|C209_HYLCO CD209 antigen (Dendritic cell-s... 42 0.025
gi|24266774|gb|AAN52336.1| nematocyst outer wall antigen precurs... 42 0.025
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 42 0.025
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 42 0.025
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 42 0.025
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno... 42 0.025
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 42 0.025
gi|12841994|dbj|BAB25430.1| unnamed protein product [Mus musculu... 42 0.025
gi|46395876|sp|Q8HY03|C209_HYLLA CD209 antigen (Dendritic cell-s... 42 0.025
gi|46395941|sp|Q95J96|C209_MACMU CD209 antigen (Dendritic cell-s... 42 0.033
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 42 0.033
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens] 42 0.033
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi... 42 0.033
gi|33284863|emb|CAE17651.1| SI:dZ169I8.9 (novel protein similar ... 42 0.033
gi|23498706|emb|CAD28397.1| putative mannose-binding C-type lect... 42 0.033
gi|15420784|gb|AAK97459.1| dendritic cell-specific ICAM-3 grabbi... 42 0.033
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci... 42 0.033
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans] 42 0.033
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car... 42 0.033
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 42 0.033
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens] 42 0.033
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens] 42 0.033
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap... 42 0.033
gi|15281075|gb|AAK91847.1| mDC-SIGN1A type II isoform [Homo sapi... 42 0.033
gi|50513579|pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Car... 42 0.033
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 42 0.033
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 42 0.033
gi|25090912|sp|P82596|PLC_HALLA Perlucin 42 0.033
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi... 42 0.033
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s... 42 0.033
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes] 42 0.033
gi|46395872|sp|Q8HXZ8|C209_GORGO CD209 antigen (Dendritic cell-s... 42 0.033
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi... 42 0.033
gi|23498708|emb|CAD28399.1| putative mannose-binding C-type lect... 42 0.033
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap... 42 0.033
gi|23498707|emb|CAD28398.1| putative mannose-binding C-type lect... 42 0.033
gi|46395942|sp|Q95LC6|C209_MACNE CD209 antigen (Dendritic cell-s... 42 0.033
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma... 42 0.033
gi|206105|gb|AAA41836.1| proteoglycan 41 0.043
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 41 0.043
gi|32566297|ref|NP_500438.2| predicted CDS, c-type lectin family... 41 0.043
gi|17543574|ref|NP_500262.1| c-type lectin precursor family memb... 41 0.043
gi|7416083|dbj|BAA93691.1| C-type lectin expressed in mouthparts... 41 0.043
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 41 0.043
gi|25148855|ref|NP_500437.2| c-type lectin precursor family memb... 41 0.043
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 41 0.043
gi|25396033|pir||F88656 protein F56D6.1 [imported] - Caenorhabdi... 41 0.043
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 41 0.043
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno... 41 0.043
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 41 0.043
gi|25396032|pir||E88656 protein F56D6.2 [imported] - Caenorhabdi... 41 0.043
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 41 0.043
gi|17570773|ref|NP_508098.1| phospholipase A2 receptor family me... 41 0.043
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno... 41 0.043
gi|15383618|gb|AAK91865.1| sDC-SIGN2 type III isoform [Homo sapi... 41 0.056
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 41 0.056
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 41 0.056
gi|18158893|pdb|1K9J|A Chain A, Complex Of Dc-Signr And Glcnac2m... 41 0.056
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 41 0.056
gi|38493055|pdb|1UKM|A Chain A, Crystal Structure Of Ems16, An A... 41 0.056
gi|31879369|dbj|BAC77706.1| EMS16 A chain [Echis multisquamatus] 41 0.056
gi|50513581|pdb|1SL6|A Chain A, Crystal Structure Of A Fragment ... 41 0.056
gi|13383470|gb|AAK20998.1| L-SIGN [Homo sapiens] 41 0.056
gi|47607497|ref|NP_999841.1| CD209 antigen-like isoform 2; proba... 41 0.056
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 41 0.056
gi|12084797|gb|AAG13848.2| probable mannose binding C-type lecti... 41 0.056
gi|42542390|ref|NP_055072.3| CD209 antigen-like isoform 1; proba... 41 0.056
gi|27356930|gb|AAL89545.1| putative CD209 protein [Pan troglodytes] 41 0.056
gi|19424150|ref|NP_598196.1| NKR-P2, ortholog of human NKG2D [Ra... 41 0.056
gi|21553093|ref|NP_660119.1| macrophage galactose N-acetyl-galac... 41 0.056
gi|15383614|gb|AAK91863.1| sDC-SIGN2 type I isoform [Homo sapiens] 41 0.056
gi|17543576|ref|NP_500259.1| anticoagulant protein-B like family... 41 0.056
gi|4502251|ref|NP_001662.1| asialoglycoprotein receptor 1; hepat... 40 0.073
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus] 40 0.073
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 40 0.073
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 40 0.073
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 40 0.073
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2... 40 0.073
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 40 0.073
gi|4808975|gb|AAD30038.1| receptor protein-tyrosine kinase; HTK2... 40 0.073
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n... 40 0.073
gi|25148869|ref|NP_500449.2| c-type lectin precursor family memb... 40 0.073
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 40 0.073
gi|17543492|ref|NP_500439.1| GalNAc-specific lectin like precurs... 40 0.073
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 40 0.073
gi|48476220|gb|AAT44385.1| REJ3CRD [Strongylocentrotus francisca... 40 0.073
gi|9955094|pdb|1DV8|A Chain A, Crystal Structure Of The Carbohyd... 40 0.073
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 40 0.073
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus] 40 0.073
gi|39585193|emb|CAE57436.1| Hypothetical protein CBG00397 [Caeno... 40 0.073
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m... 40 0.073
gi|21755922|dbj|BAC04786.1| unnamed protein product [Homo sapiens] 40 0.073
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 40 0.073
gi|33284862|emb|CAE17650.1| SI:dZ169I8.10 (novel protein similar... 40 0.095
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 40 0.095
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2... 40 0.095
gi|4808977|gb|AAD30039.1| receptor protein-tyrosine kinase; HTK2... 40 0.095
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 40 0.095
gi|20562931|gb|AAM22783.1| C-type lectin [Deinagkistrodon acutus] 40 0.095
gi|30267428|gb|AAP13539.1| Ly49 [Felis catus] 40 0.095
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 40 0.095
gi|211655|gb|AAA48720.1| proteoglycan core protein 40 0.12
gi|46395877|sp|Q8HY04|C209_PAPHA CD209 antigen (Dendritic cell-s... 40 0.12
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 40 0.12
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 40 0.12
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 40 0.12
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 40 0.12
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 40 0.12
gi|9910162|ref|NP_064332.1| C-type lectin, superfamily member 9 ... 40 0.12
gi|27356854|gb|AAL89535.1| putative CD209L1 protein [Pan troglod... 40 0.12
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 40 0.12
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno... 40 0.12
gi|27753507|dbj|BAC55179.1| hypothetical protein [Cotesia ruficr... 40 0.12
gi|50753886|ref|XP_425128.1| PREDICTED: similar to polycystic ki... 40 0.12
gi|47215081|emb|CAG04535.1| unnamed protein product [Tetraodon n... 40 0.12
gi|46395660|sp|P60883|C209_CERAE CD209 antigen (Dendritic cell-s... 40 0.12
gi|18652791|gb|AAK74185.1| type II membrane protein CD209 [Macac... 40 0.12
gi|16118475|gb|AAL14438.1| dendritic cell-specific ICAM-3 grabbi... 40 0.12
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 40 0.12
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 40 0.12
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|... 39 0.16
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n... 39 0.16
gi|16923229|gb|AAL29936.1| lectin 2c [Girardia tigrina] 39 0.16
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II... 39 0.16
gi|46395882|sp|Q8HYC0|209L_PANTR CD209 antigen-like protein 1 >g... 39 0.16
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 39 0.16
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 39 0.16
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula] 39 0.16
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 39 0.16
gi|34870062|ref|XP_221810.2| similar to CD209 antigen; dendritic... 39 0.16
gi|50512699|gb|AAT77680.1| C-type lectin [Chlamys farreri] 39 0.16
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno... 39 0.16
gi|8392926|ref|NP_058885.1| asialoglycoprotein receptor 2; rat h... 39 0.16
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1 39 0.16
gi|17561192|ref|NP_507260.1| c-type lectin family member (5R341)... 39 0.21
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens] 39 0.21
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 39 0.21
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 39 0.21
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus] 39 0.21
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12... 39 0.21
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an... 39 0.21
gi|37813574|gb|AAR04559.1| L-SIGN variant [Homo sapiens] 39 0.21
gi|38373928|gb|AAR19205.1| type II transmembrane C-type lectin [... 39 0.21
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus] 39 0.21
gi|14579651|gb|AAK69351.1| akitonin precursor [Deinagkistrodon a... 39 0.21
gi|126136|sp|P08290|LECI_RAT Asialoglycoprotein receptor R2/3 (H... 39 0.21
gi|206649|gb|AAA42038.1| asialoglycoprotein receptor (RHL2) 39 0.21
gi|33863107|ref|NP_894667.1| C-type lectin domain [Prochlorococc... 39 0.21
gi|47217441|emb|CAG10210.1| unnamed protein product [Tetraodon n... 39 0.28
gi|39579290|emb|CAE56946.1| Hypothetical protein CBG24793 [Caeno... 39 0.28
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 39 0.28
gi|16923227|gb|AAL29934.1| lectin 2b [Girardia tigrina] 39 0.28
gi|39581194|emb|CAE73599.1| Hypothetical protein CBG21085 [Caeno... 39 0.28
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub... 39 0.28
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ... 39 0.28
gi|46395878|sp|Q8HY06|209L_GORGO CD209 antigen-like protein 1 >g... 39 0.28
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus] 39 0.28
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s... 39 0.28
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus] 38 0.36
gi|50794058|ref|XP_423655.1| PREDICTED: similar to brevican isof... 38 0.36
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 38 0.36
gi|7657291|ref|NP_056532.1| CD207 antigen, langerin; Langerhans ... 38 0.36
gi|28394504|gb|AAO38235.1| C-type lectin domain [Pseudopleuronec... 38 0.36
gi|31789967|gb|AAP58741.1| C-type lectin receptor [Oreochromis n... 38 0.36
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 38 0.36
gi|4838459|gb|AAD31000.1| C-type lectin Tc-ctl-4 [Toxocara canis] 38 0.47
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 38 0.47
gi|2627436|gb|AAB86683.1| PKD1 gene product [Takifugu rubripes] 37 0.61
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina] 37 0.61
gi|47230198|emb|CAG10612.1| unnamed protein product [Tetraodon n... 37 0.61
gi|39579883|emb|CAE56619.1| Hypothetical protein CBG24375 [Caeno... 37 0.61
gi|34870124|ref|XP_344065.1| similar to SIGNR3 [Rattus norvegicus] 37 0.61
gi|34870068|ref|XP_341025.1| similar to SIGNR4 [Rattus norvegicus] 37 0.61
gi|33284861|emb|CAE17649.1| SI:dZ169I8.11 (novel protein similar... 37 0.61
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ... 37 0.61
gi|39587933|emb|CAE67952.1| Hypothetical protein CBG13555 [Caeno... 37 0.61
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 37 0.61
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC... 37 0.61
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|... 37 0.61
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 37 0.80
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec... 37 0.80
gi|14861840|ref|NP_149069.1| NKG2-D; natural killer cell group 2... 37 0.80
gi|24655071|ref|NP_728586.1| CG9134-PA [Drosophila melanogaster]... 37 0.80
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae... 37 0.80
gi|24655067|ref|NP_612091.1| CG9134-PB [Drosophila melanogaster]... 37 0.80
gi|48476200|gb|AAT44375.1| REJ1CRD1 [Strongylocentrotus pallidus] 37 0.80
gi|13399489|pdb|1HQ8|A Chain A, Crystal Structure Of The Murine ... 37 0.80
gi|2688987|gb|AAC28245.1| NKG2D homolog [Mus musculus] 37 0.80
gi|41690545|ref|ZP_00147077.1| COG0659: Sulfate permease and rel... 37 0.80
gi|31212725|ref|XP_315347.1| ENSANGP00000020910 [Anopheles gambi... 37 0.80
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto... 37 0.80
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact... 37 0.80
gi|46276889|ref|NP_002719.3| proteoglycan 2 preproprotein; eosin... 37 0.80
gi|34854713|ref|XP_215741.2| similar to RIKEN cDNA 1110055L24 [R... 37 1.0
gi|39580406|emb|CAE70966.1| Hypothetical protein CBG17779 [Caeno... 37 1.0
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno... 37 1.0
gi|21902271|gb|AAM78490.1| natural killer cell receptor [Pongo p... 37 1.0
gi|33504575|ref|NP_872425.1| secretory protein LOC348174 [Homo s... 37 1.0
gi|50418413|gb|AAH78143.1| Secretory protein LOC348174 [Homo sap... 37 1.0
gi|22760438|dbj|BAC11199.1| unnamed protein product [Homo sapiens] 37 1.0
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 37 1.0
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 37 1.0
gi|31746577|gb|AAF59584.2| Hypothetical protein Y54G2A.14 [Caeno... 37 1.0
gi|47523736|ref|NP_999503.1| killer cell lectin-like receptor su... 37 1.0
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388... 37 1.0
gi|45597237|dbj|BAD12809.1| killer cell lectin-like receptor [Eq... 37 1.0
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ... 37 1.0
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2) 37 1.0
gi|46395899|sp|Q8MIS5|209P_MACMU CD209 antigen-like protein 2 >g... 37 1.0
gi|31322508|gb|AAP22984.1| mannose receptor precursor-like isofo... 36 1.4
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 36 1.4
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 36 1.4
>gi|17554488|ref|NP_497312.1| pancreatitis-associated protein
precursor (40.4 kD) (3B623) [Caenorhabditis elegans]
gi|13435311|gb|AAK21450.2| Hypothetical protein R06B10.3
[Caenorhabditis elegans]
Length = 362
Score = 700 bits (1806), Expect = 0.0
Identities = 336/362 (92%), Positives = 336/362 (92%)
Frame = +1
Query: 1 MLREHIFSASLLFLISVSVGSAATCHGEEKLDPSGKFCYVVHTGAASFHDAEKACYDYGG 180
MLREHIFSASLLFLISVSVGSAATCHGEEKLDPSGKFCYVVHTGAASFHDAEKACYDYGG
Sbjct: 1 MLREHIFSASLLFLISVSVGSAATCHGEEKLDPSGKFCYVVHTGAASFHDAEKACYDYGG 60
Query: 181 YHLASVPSMIDXXXXXXXXXXXXVWANYFWIGLTDMTADGSWEWIDGLDLVFMNWASSST 360
YHLASVPSMID VWANYFWIGLTDMTADGSWEWIDGLDLVFMNWASSST
Sbjct: 61 YHLASVPSMIDNNFLYNLSSNSNVWANYFWIGLTDMTADGSWEWIDGLDLVFMNWASSST 120
Query: 361 AGYCGAMRAADARWQAQDCTKPYPFFCYGPALGAXXXXXXXXXXXXXXVRNQENMIKFMA 540
AGYCGAMRAADARWQAQDCTKPYPFFCYGPALGA VRNQENMIKFMA
Sbjct: 121 AGYCGAMRAADARWQAQDCTKPYPFFCYGPALGAPTNPPNTPKTTQKPVRNQENMIKFMA 180
Query: 541 DAESVGDPNVDPNALSFYNKEREFIRAVTDYLFANPTSDGNTCLYYMSPAFYGFTQYEQQ 720
DAESVGDPNVDPNALSFYNKEREFIRAVTDYLFANPTSDGNTCLYYMSPAFYGFTQYEQQ
Sbjct: 181 DAESVGDPNVDPNALSFYNKEREFIRAVTDYLFANPTSDGNTCLYYMSPAFYGFTQYEQQ 240
Query: 721 FDTSPAWSHYQFDNLLESNVWDQGKTDHDYNITDAITGAQKFRWVPSMNNIGYTTLVFLT 900
FDTSPAWSHYQFDNLLESNVWDQGKTDHDYNITDAITGAQKFRWVPSMNNIGYTTLVFLT
Sbjct: 241 FDTSPAWSHYQFDNLLESNVWDQGKTDHDYNITDAITGAQKFRWVPSMNNIGYTTLVFLT 300
Query: 901 ARRDFSGIPSLFQPFPKFDEVVVISLNGSQMPGIPAGVKNVAVSNDFSSTDIQNVINVLK 1080
ARRDFSGIPSLFQPFPKFDEVVVISLNGSQMPGIPAGVKNVAVSNDFSSTDIQNVINVLK
Sbjct: 301 ARRDFSGIPSLFQPFPKFDEVVVISLNGSQMPGIPAGVKNVAVSNDFSSTDIQNVINVLK 360
Query: 1081 CH 1086
CH
Sbjct: 361 CH 362