Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= R06F6_12
         (1502 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535279|ref|NP_496331.1| structural maintenance of chromosom...   933   0.0
gi|7506365|pir||T23981 hypothetical protein R06F6.10 - Caenorhab...   780   0.0
gi|39597371|emb|CAE59599.1| Hypothetical protein CBG03006 [Caeno...   536   e-151
gi|1722856|sp|P50533|SMC2_XENLA Structural maintenance of chromo...   291   4e-77
gi|45382553|ref|NP_990561.1| SCII [Gallus gallus] >gnl|BL_ORD_ID...   285   2e-75
gi|5453591|ref|NP_006435.1| structural maintenance of chromosome...   283   1e-74
gi|34868391|ref|XP_342838.1| similar to SMC2 protein [Rattus nor...   282   2e-74
gi|30172544|ref|NP_032043.2| structural maintenance of chromosom...   281   3e-74
gi|42627769|tpe|CAD89875.1| TPA: SMC2 protein [Homo sapiens]          281   4e-74
gi|28277493|gb|AAH44141.1| Zgc:55326 protein [Danio rerio]            274   4e-72
gi|27805179|emb|CAD58848.2| SMC2 protein [Takifugu rubripes]          267   6e-70
gi|47213556|emb|CAF91830.1| unnamed protein product [Tetraodon n...   266   1e-69
gi|31227412|ref|XP_317878.1| ENSANGP00000012139 [Anopheles gambi...   256   1e-66
gi|27227574|emb|CAD59404.1| SMC2 protein [Anopheles gambiae]          256   1e-66
gi|47940530|gb|AAH71750.1| Unknown (protein for IMAGE:6654356) [...   255   2e-66
gi|12850267|dbj|BAB28654.1| unnamed protein product [Mus musculus]    253   6e-66
gi|12860408|dbj|BAB31946.1| unnamed protein product [Mus musculus]    253   6e-66
gi|27227803|emb|CAD59410.1| SMC2 protein [Oryza sativa]               243   7e-63
gi|50257196|gb|EAL19909.1| hypothetical protein CNBG0520 [Crypto...   243   1e-62
gi|49079658|ref|XP_403450.1| hypothetical protein UM05835.1 [Ust...   241   4e-62
gi|38111118|gb|EAA56743.1| hypothetical protein MG07098.4 [Magna...   237   5e-61
gi|25991997|gb|AAN77000.1| condensin subunit [Aspergillus nidulans]   237   6e-61
gi|49097152|ref|XP_410036.1| hypothetical protein AN5899.2 [Aspe...   237   6e-61
gi|32415814|ref|XP_328385.1| hypothetical protein [Neurospora cr...   233   7e-60
gi|46121453|ref|XP_385281.1| conserved hypothetical protein [Gib...   233   7e-60
gi|19922276|ref|NP_610995.1| CG10212-PA [Drosophila melanogaster...   232   2e-59
gi|14318554|ref|NP_116687.1| Chromosome segregation and condensa...   232   2e-59
gi|23619130|ref|NP_705092.1| chromosome segregation protein, put...   231   4e-59
gi|50286419|ref|XP_445638.1| unnamed protein product [Candida gl...   231   4e-59
gi|38304051|gb|AAH61906.1| Unknown (protein for IMAGE:4363420) [...   228   3e-58
gi|15232802|ref|NP_190330.1| SMC2-like condensin, putative [Arab...   228   4e-58
gi|23487793|gb|EAA21147.1| protein mix-1, putative [Plasmodium y...   226   8e-58
gi|15241831|ref|NP_201047.1| SMC2-like condensin, putative (SMC2...   224   3e-57
gi|50416980|ref|XP_457606.1| unnamed protein product [Debaryomyc...   224   5e-57
gi|50307571|ref|XP_453765.1| unnamed protein product [Kluyveromy...   224   5e-57
gi|12382276|gb|AAG53093.1| SMC2-1 [Arabidopsis thaliana]              223   7e-57
gi|19112972|ref|NP_596180.1| cut14 protein [Schizosaccharomyces ...   220   8e-56
gi|1076871|pir||S51623 cut14 protein - fission yeast (Schizosacc...   219   2e-55
gi|6177744|dbj|BAA06453.2| cut14 protein [Schizosaccharomyces po...   219   2e-55
gi|50556870|ref|XP_505843.1| hypothetical protein [Yarrowia lipo...   218   3e-55
gi|5541713|emb|CAB51218.1| chromosome-associated protein-E homol...   217   5e-55
gi|45201332|ref|NP_986902.1| AGR236Wp [Eremothecium gossypii] >g...   217   7e-55
gi|13449986|gb|AAG27593.2| SMC2-like condensin [Arabidopsis thal...   210   6e-53
gi|46436033|gb|EAK95403.1| hypothetical protein CaO19.3623 [Cand...   206   1e-51
gi|29248934|gb|EAA40456.1| GLP_159_9285_14015 [Giardia lamblia A...   187   6e-46
gi|13122235|emb|CAC32271.1| chromosome segregation protein SMC2 ...   187   7e-46
gi|42740738|gb|AAS44543.1| structural maintenance of chromosome ...   183   8e-45
gi|48105714|ref|XP_395988.1| similar to structural maintenance o...   164   5e-39
gi|27227805|emb|CAD59411.1| SMC3 protein [Oryza sativa]               143   1e-32
gi|19075129|ref|NP_586730.1| CHROMOSOME SEGREGATION PROTEIN [Enc...   139   2e-31
gi|50258602|gb|EAL21289.1| hypothetical protein CNBD3430 [Crypto...   136   1e-30
gi|23480124|gb|EAA16773.1| chromosome-associated polypeptide, pu...   132   2e-29
gi|23510124|ref|NP_702790.1| chromosome associated protein, puta...   130   8e-29
gi|32414721|ref|XP_327840.1| hypothetical protein [Neurospora cr...   129   2e-28
gi|50542914|ref|XP_499623.1| hypothetical protein [Yarrowia lipo...   128   4e-28
gi|34763716|ref|ZP_00144638.1| Chromosome partition protein smc ...   126   2e-27
gi|49098082|ref|XP_410501.1| hypothetical protein AN6364.2 [Aspe...   125   3e-27
gi|19704464|ref|NP_604026.1| Chromosome partition protein smc [F...   124   5e-27
gi|41052609|dbj|BAD08001.1| putative SMC3 protein [Oryza sativa ...   124   5e-27
gi|46441807|gb|EAL01101.1| hypothetical protein CaO19.262 [Candi...   124   6e-27
gi|50426027|ref|XP_461610.1| unnamed protein product [Debaryomyc...   124   6e-27
gi|46441945|gb|EAL01238.1| hypothetical protein CaO19.7895 [Cand...   124   8e-27
gi|41018255|sp|Q00737|SUDA_EMENI Chromosome segregation protein ...   123   1e-26
gi|24642555|ref|NP_523374.2| CG9802-PA [Drosophila melanogaster]...   122   2e-26
gi|46124753|ref|XP_386930.1| hypothetical protein FG06754.1 [Gib...   122   2e-26
gi|7447790|pir||S70553 chromosome-associated protein - fruit fly...   122   2e-26
gi|17555958|ref|NP_499453.1| chondroitin sulfate proteoglycan 6 ...   122   2e-26
gi|27227576|emb|CAD59405.1| SMC3 protein [Anopheles gambiae]          121   5e-26
gi|31217421|ref|XP_316422.1| ENSANGP00000020478 [Anopheles gambi...   121   5e-26
gi|11499153|ref|NP_070387.1| chromosome segregation protein (smc...   120   1e-25
gi|15895028|ref|NP_348377.1| Chromosome segregation SMC protein,...   119   2e-25
gi|27805181|emb|CAD58849.2| SMC3 protein [Takifugu rubripes]          118   3e-25
gi|23023432|ref|ZP_00062668.1| COG1196: Chromosome segregation A...   118   3e-25
gi|14520575|ref|NP_126050.1| chromosome segregation protein smc1...   118   4e-25
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog...   117   6e-25
gi|27263154|emb|CAD59446.1| structural maintenance of chromosome...   117   7e-25
gi|47937470|gb|AAH72043.1| LOC432330 protein [Xenopus laevis]         116   2e-24
gi|50288973|ref|XP_446916.1| unnamed protein product [Candida gl...   116   2e-24
gi|41584495|gb|AAS09910.1| SMC3 [Arabidopsis thaliana]                115   3e-24
gi|25315538|pir||F84669 probable chromosome associated protein [...   115   3e-24
gi|19114172|ref|NP_593260.1| putative chromosome-associated prot...   115   3e-24
gi|28375557|emb|CAD66602.1| SMC protein [Pyrococcus furiosus]         115   3e-24
gi|23476966|emb|CAD43403.2| SMC3 protein [Arabidopsis thaliana]       115   3e-24
gi|18978215|ref|NP_579572.1| chromosome segregation protein smc ...   115   3e-24
gi|38566257|gb|AAH62935.1| Chondroitin sulfate proteoglycan 6 [M...   114   5e-24
gi|45383139|ref|NP_989848.1| cohesin complex subunit [Gallus gal...   114   5e-24
gi|49075956|ref|XP_402004.1| hypothetical protein UM04389.1 [Ust...   114   8e-24
gi|15643938|ref|NP_228987.1| chromosome segregation SMC protein,...   114   8e-24
gi|28958118|gb|AAH47324.1| Chondroitin sulfate proteoglycan 6 (b...   113   1e-23
gi|47575580|ref|ZP_00245615.1| COG1196: Chromosome segregation A...   113   1e-23
gi|48862999|ref|ZP_00316893.1| COG1196: Chromosome segregation A...   113   1e-23
gi|13928790|ref|NP_113771.1| chondroitin sulfate proteoglycan 6;...   112   2e-23
gi|27805841|ref|NP_776720.1| chondroitin sulfate proteoglycan 6 ...   112   2e-23
gi|4885399|ref|NP_005436.1| chondroitin sulfate proteoglycan 6 (...   112   2e-23
gi|36031035|ref|NP_031816.2| chondroitin sulfate proteoglycan 6 ...   112   2e-23
gi|42627759|tpe|CAD59554.1| TPA: SMC3 protein [Bos taurus]            112   2e-23
gi|46142589|ref|ZP_00204355.1| COG1196: Chromosome segregation A...   112   2e-23
gi|47550693|ref|NP_999854.1| chondroitin sulfate proteoglycan 6 ...   112   3e-23
gi|20093122|ref|NP_619197.1| chromosome segregation protein [Met...   112   3e-23
gi|32450573|gb|AAH54173.1| Unknown (protein for IMAGE:6875131) [...   112   3e-23
gi|46370592|gb|AAS90118.1| condensin subunit [Tetrahymena thermo...   111   4e-23
gi|46319260|ref|ZP_00219673.1| COG1196: Chromosome segregation A...   111   4e-23
gi|47214763|emb|CAG01298.1| unnamed protein product [Tetraodon n...   110   7e-23
gi|48841036|ref|ZP_00297962.1| COG1196: Chromosome segregation A...   110   7e-23
gi|20198135|gb|AAM15423.1| putative chromosome associated protei...   110   9e-23
gi|20198247|gb|AAD26882.3| putative chromosome associated protei...   110   9e-23
gi|42569375|ref|NP_180285.2| structural maintenance of chromosom...   110   9e-23
gi|46113217|ref|ZP_00182488.2| COG1196: Chromosome segregation A...   110   1e-22
gi|21227133|ref|NP_633055.1| Chromosome partition protein [Metha...   109   2e-22
gi|48787702|ref|ZP_00283681.1| COG1196: Chromosome segregation A...   108   3e-22
gi|41052610|dbj|BAD08002.1| putative SMC3 protein [Oryza sativa ...   108   3e-22
gi|46229806|gb|EAK90624.1| SMC3'SMC type chromosomal ABC ATpase'...   108   3e-22
gi|18310698|ref|NP_562632.1| chromosome partition protein [Clost...   107   1e-21
gi|45184642|ref|NP_982360.1| AAL182Wp [Eremothecium gossypii] >g...   107   1e-21
gi|29377553|ref|NP_816707.1| chromosome partition protein SMC [E...   107   1e-21
gi|38105926|gb|EAA52296.1| hypothetical protein MG04988.4 [Magna...   106   1e-21
gi|29653880|ref|NP_819572.1| SMC family protein [Coxiella burnet...   106   1e-21
gi|7159657|emb|CAB76376.1| SMC1 protein [Drosophila melanogaster...   106   2e-21
gi|39584752|emb|CAE67647.1| Hypothetical protein CBG13206 [Caeno...   105   2e-21
gi|24649535|ref|NP_651211.2| CG6057-PA [Drosophila melanogaster]...   105   2e-21
gi|15789609|ref|NP_279433.1| chromosome segregation; Smc1 [Halob...   105   2e-21
gi|48731934|ref|ZP_00265678.1| COG1196: Chromosome segregation A...   105   3e-21
gi|48825238|ref|ZP_00286509.1| COG1196: Chromosome segregation A...   105   4e-21
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco...   104   6e-21
gi|50591389|ref|ZP_00332703.1| COG1196: Chromosome segregation A...   104   6e-21
gi|46311946|ref|ZP_00212547.1| COG1196: Chromosome segregation A...   103   8e-21
gi|48866267|ref|ZP_00320123.1| COG1196: Chromosome segregation A...   103   8e-21
gi|32822886|gb|AAH55081.1| Unknown (protein for IMAGE:6708852) [...   103   8e-21
gi|48768180|ref|ZP_00272531.1| COG1196: Chromosome segregation A...   103   1e-20
gi|28870813|ref|NP_793432.1| chromosome segregation SMC protein,...   102   2e-20
gi|24374427|ref|NP_718470.1| SMC family protein [Shewanella onei...   102   2e-20
gi|23102564|ref|ZP_00089069.1| COG1196: Chromosome segregation A...   102   2e-20
gi|22536888|ref|NP_687739.1| chromosome segregation SMC protein ...   102   2e-20
gi|50084058|ref|YP_045568.1| putative chromosome segregation ATP...   102   3e-20
gi|15924224|ref|NP_371758.1| chromosome segregation SMC protein ...   102   3e-20
gi|28210932|ref|NP_781876.1| chromosome segregation protein smc2...   101   4e-20
gi|23098983|ref|NP_692449.1| chromosome segregation SMC protein ...   101   4e-20
gi|46189171|ref|ZP_00124435.2| COG1196: Chromosome segregation A...   101   5e-20
gi|32328841|emb|CAD66596.2| SMC protein [Desulfitobacterium hafn...   101   5e-20
gi|48847180|ref|ZP_00301437.1| COG1196: Chromosome segregation A...   101   5e-20
gi|21902529|ref|NP_663774.1| Bartomin [Rattus norvegicus] >gnl|B...   100   9e-20
gi|21231021|ref|NP_636938.1| chromosome segregation protein [Xan...   100   9e-20
gi|48869678|ref|ZP_00322424.1| COG1196: Chromosome segregation A...   100   9e-20
gi|2129174|pir||A64505 P115 homolog - Methanococcus jannaschii        100   1e-19
gi|15669839|ref|NP_248653.1| chromosome segretation protein (smc...   100   1e-19
gi|6322387|ref|NP_012461.1| involved in sister chromatid cohesio...   100   2e-19
gi|46981263|gb|AAT07581.1| putative SMC protein [Oryza sativa (j...    99   2e-19
gi|24379903|ref|NP_721858.1| putative chromosome segregation ATP...    99   2e-19
gi|21282846|ref|NP_645934.1| chromosome segregation SMC protein ...    99   2e-19
gi|42519392|ref|NP_965322.1| chromosome partitioning protein Smc...    99   2e-19
gi|28374984|emb|CAD66591.1| SMC protein [Acidithiobacillus ferro...    99   3e-19
gi|10697129|emb|CAC12695.1| putative structural maintenance of c...    99   3e-19
gi|32041570|ref|ZP_00139153.1| COG1196: Chromosome segregation A...    99   3e-19
gi|34499363|ref|NP_903578.1| probable chromosome segregation pro...    99   3e-19
gi|38234115|ref|NP_939882.1| Putative chromosome partition prote...    99   3e-19
gi|15596724|ref|NP_250218.1| conserved hypothetical protein [Pse...    99   3e-19
gi|26990967|ref|NP_746392.1| chromosome segregation SMC protein ...    99   3e-19
gi|16030073|emb|CAC93883.1| SMC protein [Lactococcus lactis subs...    99   3e-19
gi|15672785|ref|NP_266959.1| chromosome segregation SMC protein ...    99   3e-19
gi|13541638|ref|NP_111326.1| Chromosome segregation ATPase [Ther...    98   6e-19
gi|45358960|ref|NP_988517.1| structural maintenance of chromosom...    98   6e-19
gi|49483397|ref|YP_040621.1| putative chromosome partition prote...    98   6e-19
gi|21242373|ref|NP_641955.1| chromosome segregation protein [Xan...    97   8e-19
gi|23465915|ref|NP_696518.1| chromosome partitioning protein Smc...    97   1e-18
gi|31794098|ref|NP_856591.1| PROBABLE CHROMOSOME PARTITION PROTE...    97   1e-18
gi|27467827|ref|NP_764464.1| chromosome segregation SMC protein ...    97   1e-18
gi|48857430|ref|ZP_00311434.1| COG1196: Chromosome segregation A...    97   1e-18
gi|28375555|emb|CAD66601.1| SMC protein [Methylococcus capsulatus]     96   2e-18
gi|46438486|gb|EAK97816.1| hypothetical protein CaO19.964 [Candi...    96   2e-18
gi|33578097|gb|AAQ22369.1| chromosomal segregation protein [Meth...    96   2e-18
gi|42527004|ref|NP_972102.1| chromosome partition protein SmC, p...    96   2e-18
gi|37522891|ref|NP_926268.1| chromosome segregation SMC protein ...    96   2e-18
gi|33594427|ref|NP_882071.1| putative chromosome partition prote...    96   2e-18
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis]        96   3e-18
gi|15842466|ref|NP_337503.1| chromosome segregation SMC protein,...    96   3e-18
gi|29336591|sp|O93308|SMC1_XENLA Structural maintenance of chrom...    95   4e-18
gi|47570281|ref|ZP_00240930.1| reticulocyte binding protein [Bac...    95   4e-18
gi|19553265|ref|NP_601267.1| chromosome segregation ATPase [Cory...    95   5e-18
gi|23003652|ref|ZP_00047307.1| COG1196: Chromosome segregation A...    95   5e-18
gi|15901108|ref|NP_345712.1| conserved hypothetical protein [Str...    95   5e-18
gi|23335416|ref|ZP_00120652.1| COG1196: Chromosome segregation A...    95   5e-18
gi|17228623|ref|NP_485171.1| chromosome segregation protein [Nos...    94   7e-18
gi|50302157|ref|XP_451012.1| unnamed protein product [Kluyveromy...    94   7e-18
gi|20807912|ref|NP_623083.1| Chromosome segregation ATPases [The...    94   7e-18
gi|15676451|ref|NP_273590.1| conserved hypothetical protein [Nei...    94   7e-18
gi|45201184|ref|NP_986754.1| AGR089Cp [Eremothecium gossypii] >g...    94   7e-18
gi|33597878|ref|NP_885521.1| putative chromosome partition prote...    94   7e-18
gi|33863851|ref|NP_895411.1| putative chromosome segregation pro...    94   9e-18
gi|15610059|ref|NP_217438.1| smc [Mycobacterium tuberculosis H37...    94   9e-18
gi|48097142|ref|XP_393700.1| similar to ENSANGP00000020478 [Apis...    94   1e-17
gi|25028528|ref|NP_738582.1| putative chromosome segregation SMC...    94   1e-17
gi|32412672|ref|XP_326816.1| hypothetical protein ( (AL451017) r...    94   1e-17
gi|15888144|ref|NP_353825.1| AGR_C_1466p [Agrobacterium tumefaci...    94   1e-17
gi|17934711|ref|NP_531501.1| chromosome segregation protein [Agr...    94   1e-17
gi|30021936|ref|NP_833567.1| Chromosome partition protein smc [B...    94   1e-17
gi|49478913|ref|YP_037909.1| chromosome segregation SMC protein ...    93   1e-17
gi|21401832|ref|NP_657817.1| SMC_C, SMC family, C-terminal domai...    93   1e-17
gi|30250214|ref|NP_842284.1| Chromosome segregation ATPases [Nit...    93   2e-17
gi|45658257|ref|YP_002343.1| chromosome segregation protein [Lep...    93   2e-17
gi|15793701|ref|NP_283523.1| hypothetical protein NMA0724 [Neiss...    93   2e-17
gi|21262152|emb|CAD32690.1| SMC4 protein [Oryza sativa]                92   2e-17
gi|42782940|ref|NP_980187.1| chromosome segregation SMC protein ...    92   2e-17
gi|21223933|ref|NP_629712.1| putative chromosome associated prot...    92   2e-17
gi|48851083|ref|ZP_00305325.1| COG1196: Chromosome segregation A...    92   3e-17
gi|16078657|ref|NP_389476.1| chromosome segregation SMC protein ...    92   3e-17
gi|23508508|ref|NP_701177.1| structural maintenance of chromosom...    92   3e-17
gi|50287267|ref|XP_446063.1| unnamed protein product [Candida gl...    92   4e-17
gi|30581135|ref|NP_006297.2| SMC1 structural maintenance of chro...    92   4e-17
gi|2135244|pir||I54383 chromosome segregation protein smc1 [simi...    92   4e-17
gi|9790237|ref|NP_062684.1| SMC1 structural maintenance of chrom...    92   4e-17
gi|30172566|ref|NP_777039.1| SMC1 structural maintenance of chro...    92   4e-17
gi|39963673|gb|AAH64368.1| SMC1L1 protein [Homo sapiens]               92   4e-17
gi|23120098|ref|ZP_00102904.1| COG1196: Chromosome segregation A...    92   4e-17
gi|27227572|emb|CAD59403.1| SMC1 protein [Anopheles gambiae]           92   4e-17
gi|28375551|emb|CAD66599.1| SMC protein [Geobacillus stearotherm...    92   4e-17
gi|11358861|pir||T47626 structural maintenance of chromosomes (S...    92   4e-17
gi|50293773|ref|XP_449298.1| unnamed protein product [Candida gl...    91   6e-17
gi|30694096|ref|NP_191027.2| structural maintenance of chromosom...    91   6e-17
gi|26553935|ref|NP_757869.1| structural maintenance of chromosom...    91   6e-17
gi|45594277|gb|AAS68515.1| structural maintenance of chromosomes...    91   6e-17
gi|33860617|ref|NP_892178.1| putative chromosome segregation pro...    91   9e-17
gi|48477928|ref|YP_023634.1| chromosome partition protein smc [P...    90   1e-16
gi|29829200|ref|NP_823834.1| putative chromosome segregation pro...    90   1e-16
gi|7521921|pir||T30534 chromosome segregation protein SMC1 homol...    90   1e-16
gi|46110056|ref|XP_382086.1| hypothetical protein FG01910.1 [Gib...    90   1e-16
gi|41409088|ref|NP_961924.1| Smc [Mycobacterium avium subsp. par...    90   2e-16
gi|46205999|ref|ZP_00047825.2| COG1196: Chromosome segregation A...    90   2e-16
gi|13928946|ref|NP_113871.1| SMC1 structural maintenance of chro...    90   2e-16
gi|15964684|ref|NP_385037.1| PUTATIVE CHROMOSOME PARTITION PROTE...    90   2e-16
gi|16081854|ref|NP_394249.1| chromosome segregation protein rela...    90   2e-16
gi|15674632|ref|NP_268806.1| putative chromosome segregation SMC...    90   2e-16
gi|45682710|ref|ZP_00194145.1| COG1196: Chromosome segregation A...    90   2e-16
gi|47097387|ref|ZP_00234938.1| chromosome segregation SMC protei...    90   2e-16
gi|15827858|ref|NP_302121.1| possible cell division protein [Myc...    89   2e-16
gi|39937549|ref|NP_949825.1| putative chromosome segregation SMC...    89   2e-16
gi|50258035|gb|EAL20729.1| hypothetical protein CNBE0920 [Crypto...    89   3e-16
gi|16803844|ref|NP_465329.1| similar to Smc protein essential fo...    89   3e-16
gi|19745654|ref|NP_606790.1| putative chromosome segregation SMC...    89   3e-16
gi|49072991|ref|XP_400748.1| hypothetical protein UM03133.1 [Ust...    89   3e-16
gi|27227578|emb|CAD59406.1| SMC4 protein [Anopheles gambiae]           89   3e-16
gi|15839147|ref|NP_299835.1| chromosome segregation protein [Xyl...    89   3e-16
gi|22997161|ref|ZP_00041397.1| COG1196: Chromosome segregation A...    89   3e-16
gi|28199809|ref|NP_780123.1| chromosome segregation protein [Xyl...    89   3e-16
gi|22994169|ref|ZP_00038684.1| COG1196: Chromosome segregation A...    89   3e-16
gi|46130260|ref|ZP_00165058.2| COG1196: Chromosome segregation A...    89   3e-16
gi|19112184|ref|NP_595392.1| chromosome segregation protein cut3...    89   3e-16
gi|31226222|ref|XP_317674.1| ENSANGP00000018543 [Anopheles gambi...    89   3e-16
gi|21909912|ref|NP_664180.1| putative chromosome condensation an...    89   4e-16
gi|42522699|ref|NP_968079.1| chromosome segregation SMC protein ...    89   4e-16
gi|2370078|emb|CAB09784.1| dJ339A18.1 (KIAA0178 (ortholog of Fug...    88   5e-16
gi|47228706|emb|CAG07438.1| unnamed protein product [Tetraodon n...    88   5e-16
gi|15903169|ref|NP_358719.1| chromosome condensation and segrega...    88   5e-16
gi|1076872|pir||S51622 cut3 protein - fission yeast (Schizosacch...    88   5e-16
gi|16800984|ref|NP_471252.1| similar to Smc protein essential fo...    88   6e-16
gi|15615050|ref|NP_243353.1| chromosome segregation SMC protein ...    88   6e-16
gi|23127761|ref|ZP_00109624.1| COG1196: Chromosome segregation A...    88   6e-16
gi|6323115|ref|NP_013187.1| Subunit of the condensin complex, wh...    88   6e-16
gi|13508165|ref|NP_110114.1| SMC family, chromosome/DNA binding/...    87   8e-16
gi|46365978|ref|ZP_00191324.2| COG1196: Chromosome segregation A...    87   1e-15
gi|50549059|ref|XP_502000.1| hypothetical protein [Yarrowia lipo...    87   1e-15
gi|46141408|ref|ZP_00146648.2| COG1196: Chromosome segregation A...    87   1e-15
gi|27227801|emb|CAD59409.1| SMC1 protein [Oryza sativa]                87   1e-15
gi|46908035|ref|YP_014424.1| chromosome segregation SMC protein ...    87   1e-15
gi|1722855|sp|P50532|SMC4_XENLA Structural maintenance of chromo...    87   1e-15
gi|16124628|ref|NP_419192.1| smc protein [Caulobacter crescentus...    86   2e-15
gi|48836414|ref|ZP_00293410.1| COG1196: Chromosome segregation A...    86   2e-15
gi|46192811|ref|ZP_00005997.2| COG1196: Chromosome segregation A...    86   2e-15
gi|29837126|emb|CAD58850.2| SMC1 protein cohesin subunit [Gallus...    86   2e-15
gi|14318514|ref|NP_116647.1| coiled-coil protein involved in chr...    86   2e-15
gi|17553272|ref|NP_497935.1| structural Maintenance of Chromosom...    86   3e-15
gi|26986436|emb|CAD58915.1| SMC4 protein [Takifugu rubripes]           86   3e-15
gi|46447121|ref|YP_008486.1| putative chromosome segregation SMC...    86   3e-15
gi|17987722|ref|NP_540356.1| CHROMOSOME SEGREGATION PROTEIN SMC2...    86   3e-15
gi|23501398|ref|NP_697525.1| SMC family protein [Brucella suis 1...    86   3e-15
gi|28378330|ref|NP_785222.1| cell division protein Smc [Lactobac...    86   3e-15
gi|22299468|ref|NP_682715.1| chromosome segregation SMC protein ...    85   4e-15
gi|50425249|ref|XP_461216.1| unnamed protein product [Debaryomyc...    85   5e-15
gi|28375561|emb|CAD66604.1| SMC protein [Synechococcus sp. PCC 7...    85   5e-15
gi|16329963|ref|NP_440691.1| chromosome segregation protein SMC1...    84   7e-15
gi|39591600|emb|CAE71177.1| Hypothetical protein CBG18034 [Caeno...    84   7e-15
gi|38109352|gb|EAA55237.1| hypothetical protein MG06894.4 [Magna...    84   7e-15
gi|31544374|ref|NP_852952.1| Smc-like [Mycoplasma gallisepticum ...    84   7e-15
gi|39580844|emb|CAE73105.1| Hypothetical protein CBG20485 [Caeno...    84   9e-15
gi|19112841|ref|NP_596049.1| Xenopus 14s cohesin smc1 subunit ho...    84   9e-15
gi|46434731|gb|EAK94133.1| hypothetical protein CaO19.2417 [Cand...    84   1e-14
gi|32452356|emb|CAD66598.2| SMC protein [Fibrobacter succinogenes]     84   1e-14
gi|15239023|ref|NP_199671.1| structural maintenance of chromosom...    84   1e-14
gi|50311811|ref|XP_455936.1| unnamed protein product [Kluyveromy...    83   2e-14
gi|31206003|ref|XP_311953.1| ENSANGP00000011008 [Anopheles gambi...    83   2e-14
gi|23016160|ref|ZP_00055919.1| COG1196: Chromosome segregation A...    83   2e-14
gi|13476253|ref|NP_107823.1| chromosome segregation SMC protein ...    83   2e-14
gi|42740744|gb|AAS44546.1| structural maintenance of chromosome ...    83   2e-14
gi|42740740|gb|AAS44544.1| structural maintenance of chromosome ...    82   3e-14
gi|42733831|gb|AAS38749.1| similar to Arabidopsis thaliana (Mous...    82   3e-14
gi|47459245|ref|YP_016107.1| segregation of chromosomes protein ...    82   3e-14
gi|49094546|ref|XP_408734.1| hypothetical protein AN4597.2 [Aspe...    82   4e-14
gi|32422023|ref|XP_331455.1| hypothetical protein [Neurospora cr...    82   4e-14
gi|19074490|ref|NP_585996.1| CUT3-LIKE CHROMOSOME SEGREGATION PR...    81   6e-14
gi|49618927|gb|AAT68048.1| chromosome adhesion protein SMC1-like...    80   1e-13
gi|48853927|ref|ZP_00308092.1| COG1196: Chromosome segregation A...    80   1e-13
gi|27545259|ref|NP_775360.1| MC4 structural maintenance of chrom...    80   1e-13
gi|23112533|ref|ZP_00098005.1| COG1196: Chromosome segregation A...    80   1e-13
gi|27377607|ref|NP_769136.1| chromosome segregation protein [Bra...    80   1e-13
gi|46229789|gb|EAK90607.1| SMC4'SMC4, chromosomal ATpase with gi...    80   1e-13
gi|13357697|ref|NP_077971.1| p115 protein [Ureaplasma parvum ser...    80   1e-13
gi|3851586|gb|AAC72361.1| chromosome-associated protein-C [Homo ...    80   2e-13
gi|50658067|ref|NP_001002799.1| SMC4 structural maintenance of c...    80   2e-13
gi|46436700|gb|EAK96058.1| hypothetical protein CaO19.11845 [Can...    80   2e-13
gi|21739524|emb|CAD38803.1| hypothetical protein [Homo sapiens]        80   2e-13
gi|50658063|ref|NP_001002800.1| SMC4 structural maintenance of c...    80   2e-13
gi|32474054|ref|NP_867048.1| chromosome partition protein Smc [P...    80   2e-13
gi|29789347|ref|NP_598547.1| SMC4 structural maintenance of chro...    79   2e-13
gi|15639358|ref|NP_218807.1| chromosome segregation protein, put...    79   2e-13
gi|38181589|gb|AAH61481.1| Smc4l1 protein [Mus musculus]               79   2e-13
gi|26353334|dbj|BAC40297.1| unnamed protein product [Mus musculus]     79   2e-13
gi|30173370|sp|Q9ERA5|SMC4_MICAR Structural maintenance of chrom...    79   2e-13
gi|1237015|dbj|BAA10977.1| ORF4 [Bacillus subtilis]                    79   2e-13
gi|49091278|ref|XP_407100.1| hypothetical protein AN2963.2 [Aspe...    79   3e-13
gi|11278962|pir||T46486 chromosomal protein CAPC homolog DKFZp43...    79   3e-13
gi|26383507|dbj|BAB31016.2| unnamed protein product [Mus musculus]     79   4e-13
gi|34857050|ref|XP_215573.2| similar to SMC4 protein [Rattus nor...    78   6e-13
gi|49237089|ref|ZP_00331144.1| COG1196: Chromosome segregation A...    78   6e-13
gi|50553158|ref|XP_503989.1| hypothetical protein [Yarrowia lipo...    78   6e-13
gi|15829185|ref|NP_326545.1| P115-LIKE (Mycoplasma hyorhinis) AB...    77   8e-13
gi|50259757|gb|EAL22425.1| hypothetical protein CNBB3040 [Crypto...    77   8e-13
gi|27881854|gb|AAH44377.1| Smc4l1 protein [Danio rerio] >gnl|BL_...    77   8e-13
gi|23482825|gb|EAA18694.1| SMC domain N terminal domain, putativ...    77   8e-13
gi|12045154|ref|NP_072965.1| P115 protein [Mycoplasma genitalium...    77   8e-13
gi|46118844|ref|ZP_00175702.2| COG1196: Chromosome segregation A...    77   1e-12
gi|38105342|gb|EAA51783.1| hypothetical protein MG03378.4 [Magna...    77   1e-12
gi|28317138|gb|AAD46883.2| LD20207p [Drosophila melanogaster]          77   1e-12
gi|41725311|ref|ZP_00152069.1| COG1196: Chromosome segregation A...    77   1e-12
gi|24584683|ref|NP_723996.1| CG11397-PA [Drosophila melanogaster...    77   1e-12
gi|34849448|gb|AAP58947.1| chromosome segregation ATPase [Spirop...    76   2e-12
gi|23491225|gb|EAA22815.1| chromosome assembly protein xcap-c [P...    76   2e-12
gi|46138859|ref|XP_391120.1| hypothetical protein FG10944.1 [Gib...    76   2e-12
gi|6469332|gb|AAF13306.1| XCAP-C/SMC4 homolog Gluon [Drosophila ...    76   2e-12
gi|39996232|ref|NP_952183.1| chromosome segregation SMC protein,...    76   2e-12
gi|42561011|ref|NP_975462.1| P115-like protein with SMC_C motif ...    75   5e-12
gi|4704204|emb|CAB41703.1| dJ102D24.1 (novel Mitosis-specific Ch...    74   7e-12
gi|50365048|ref|YP_053473.1| structural maintenance of chromosom...    74   7e-12
gi|50729186|ref|XP_416467.1| PREDICTED: similar to SMC1beta prot...    74   7e-12
gi|32766679|gb|AAH55212.1| Zgc:76902 protein [Danio rerio]             74   9e-12
gi|29336774|sp|Q8NDV3|SM1B_HUMAN Structural maintenance of chrom...    74   1e-11
gi|48475050|ref|NP_683515.2| SMC1 structural maintenance of chro...    74   1e-11
gi|45383133|ref|NP_989849.1| condensin complex subunit [Gallus g...    74   1e-11
gi|13096783|pdb|1E69|A Chain A, Smc Head Domain From Thermotoga ...    73   2e-11
gi|47086417|ref|NP_997975.1| SMC1 structural maintenance of chro...    73   2e-11
gi|33864877|ref|NP_896436.1| putative chromosome segregation pro...    73   2e-11
gi|33239523|ref|NP_874465.1| Chromosome segregation ATPase [Proc...    72   3e-11
gi|46198851|ref|YP_004518.1| chromosome partition protein smc [T...    72   3e-11
gi|12851088|dbj|BAB28937.1| unnamed protein product [Mus musculu...    72   3e-11
gi|33416654|gb|AAH56009.1| XCAP-C protein [Xenopus laevis]             72   5e-11
gi|27881713|gb|AAH44679.1| XCAP-C protein [Xenopus laevis]             72   5e-11
gi|48106016|ref|XP_396038.1| similar to XCAP-C protein [Apis mel...    72   5e-11
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa...    71   6e-11
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ...    71   6e-11
gi|19074170|ref|NP_584776.1| CHROMOSOME SEGREGATION PROTEIN [Enc...    71   8e-11
gi|34365245|emb|CAE45960.1| hypothetical protein [Homo sapiens]        71   8e-11
gi|29249088|gb|EAA40607.1| GLP_23_10542_6235 [Giardia lamblia AT...    70   1e-10
gi|17552844|ref|NP_497771.1| SMC protein, N-terminal and structu...    70   1e-10
gi|27805177|emb|CAD58847.2| SMC1 beta protein [Takifugu rubripes]      70   2e-10
gi|7500037|pir||T34063 chromosome segregation protein smc1 F28B3...    70   2e-10
gi|47123398|gb|AAH70161.1| SMC4L1 protein [Homo sapiens]               70   2e-10
gi|17506951|ref|NP_491486.1| SMC protein, N-terminal and structu...    70   2e-10
gi|26353956|dbj|BAC40608.1| unnamed protein product [Mus musculus]     69   3e-10
gi|47157021|gb|AAT12384.1| CUT3-like chromosome segregation prot...    69   4e-10
gi|17532089|ref|NP_494935.1| SMC protein, N-terminal and structu...    69   4e-10
gi|7496566|pir||T15650 hypothetical protein C27A2.1 - Caenorhabd...    69   4e-10
gi|99066|pir||JQ0894 P115 protein - Mycoplasma hyorhinis               68   5e-10
gi|50258855|gb|EAL21538.1| hypothetical protein CNBD0060 [Crypto...    68   7e-10
gi|46227810|gb|EAK88730.1| SMC1 structural maintenance of chromo...    67   9e-10
gi|40807120|gb|AAH65259.1| SMC4L1 protein [Homo sapiens]               67   9e-10
gi|1352653|sp|P41508|P115_MYCHR P115 protein >gnl|BL_ORD_ID|1208...    67   1e-09
gi|15899022|ref|NP_343627.1| Purine NTPase [Sulfolobus solfatari...    67   1e-09
gi|18202023|sp|O33600|RA50_SULAC DNA double-strand break repair ...    66   2e-09
gi|48766289|ref|ZP_00270839.1| COG1196: Chromosome segregation A...    66   2e-09
gi|22000946|gb|AAL82734.1| structural maintenance of chromosome ...    66   2e-09
gi|48852133|ref|ZP_00306324.1| COG1196: Chromosome segregation A...    65   3e-09
gi|39580916|emb|CAE72848.1| Hypothetical protein CBG20143 [Caeno...    65   3e-09
gi|19115819|ref|NP_594907.1| putative SMC family protein [Schizo...    65   4e-09
gi|45201073|ref|NP_986643.1| AGL023Wp [Eremothecium gossypii] >g...    65   4e-09
gi|34867523|ref|XP_217011.2| similar to structural maintenance o...    65   4e-09
gi|29248736|gb|EAA40263.1| GLP_164_29061_32786 [Giardia lamblia ...    65   6e-09
gi|45358904|ref|NP_988461.1| DNA double-strand break repair rad5...    65   6e-09
gi|45190269|ref|NP_984523.1| AEL337Cp [Eremothecium gossypii] >g...    64   7e-09
gi|15594391|ref|NP_212179.1| P115 protein [Borrelia burgdorferi ...    64   1e-08
gi|50405825|ref|XP_456553.1| unnamed protein product [Debaryomyc...    64   1e-08
gi|22974164|ref|ZP_00020510.1| hypothetical protein [Chloroflexu...    63   2e-08
gi|27227582|emb|CAD59408.1| SMC6 protein [Anopheles gambiae]           63   2e-08
gi|47224982|emb|CAF97397.1| unnamed protein product [Tetraodon n...    63   2e-08
gi|31205901|ref|XP_311902.1| ENSANGP00000018189 [Anopheles gambi...    63   2e-08
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica]       62   3e-08
gi|45509192|ref|ZP_00161527.1| COG1196: Chromosome segregation A...    62   3e-08
gi|17978290|ref|NP_536718.1| SMC (structural maintenace of chrom...    62   4e-08
gi|50310839|ref|XP_455442.1| unnamed protein product [Kluyveromy...    62   5e-08
gi|49068130|ref|XP_398354.1| hypothetical protein UM00739.1 [Ust...    61   6e-08
gi|50287189|ref|XP_446024.1| unnamed protein product [Candida gl...    61   8e-08
gi|50554989|ref|XP_504903.1| hypothetical protein [Yarrowia lipo...    60   1e-07
gi|39596804|emb|CAE59031.1| Hypothetical protein CBG02311 [Caeno...    60   1e-07
gi|46128649|ref|XP_388878.1| hypothetical protein FG08702.1 [Gib...    60   1e-07
gi|19075406|ref|NP_587906.1| dna repair protein rad18 [Schizosac...    60   1e-07
gi|50259260|gb|EAL21933.1| hypothetical protein CNBC0730 [Crypto...    60   1e-07
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc...    60   1e-07
gi|46138405|ref|XP_390893.1| hypothetical protein FG10717.1 [Gib...    60   1e-07
gi|32422027|ref|XP_331457.1| hypothetical protein [Neurospora cr...    60   1e-07
gi|15669512|ref|NP_248322.1| purine NTPase [Methanocaldococcus j...    59   2e-07
gi|45190650|ref|NP_984904.1| AER044Wp [Eremothecium gossypii] >g...    59   2e-07
gi|11362271|pir||T47237 myosin II heavy chain [imported] - Naegl...    59   4e-07
gi|48852929|ref|ZP_00307111.1| COG0419: ATPase involved in DNA r...    59   4e-07
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl...    58   5e-07
gi|50289173|ref|XP_447016.1| unnamed protein product [Candida gl...    58   7e-07
gi|28301615|emb|CAD65850.1| SMC5 protein [Takifugu rubripes]           57   9e-07
gi|2760351|gb|AAB95253.1| myosin heavy chain [Girardia tigrina]        57   9e-07
gi|6323415|ref|NP_013487.1| Protein involved in recombination re...    57   1e-06
gi|33338074|gb|AAQ13659.1| MSTP142 [Homo sapiens]                      57   2e-06
gi|46136645|ref|XP_390014.1| hypothetical protein FG09838.1 [Gib...    57   2e-06
gi|18310866|ref|NP_562800.1| hypothetical protein CPE1884 [Clost...    57   2e-06
gi|50553286|ref|XP_504054.1| hypothetical protein [Yarrowia lipo...    56   2e-06
gi|50258490|gb|EAL21177.1| hypothetical protein CNBD2340 [Crypto...    55   3e-06
gi|49128929|ref|XP_412879.1| hypothetical protein AN8742.2 [Aspe...    55   3e-06
gi|49092272|ref|XP_407597.1| hypothetical protein AN3460.2 [Aspe...    55   3e-06
gi|45521172|ref|ZP_00172694.1| COG1196: Chromosome segregation A...    55   3e-06
gi|48894091|ref|ZP_00327289.1| COG1196: Chromosome segregation A...    55   3e-06
gi|48139710|ref|XP_397037.1| similar to SMC5 structural maintena...    55   4e-06
gi|19173313|ref|NP_597116.1| CHROMOSOME SEGREGATION PROTEIN OF T...    55   4e-06
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo...    55   4e-06
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot...    55   4e-06
gi|27803028|emb|CAD60731.1| unnamed protein product [Podospora a...    55   4e-06
gi|46109064|ref|XP_381590.1| hypothetical protein FG01414.1 [Gib...    55   4e-06
gi|11276951|pir||A59287 myosin heavy chain - fluke (Schistosoma ...    55   6e-06
gi|15240258|ref|NP_200954.1| structural maintenance of chromosom...    55   6e-06
gi|5880614|gb|AAD54769.1| SMC-like protein [Arabidopsis thaliana...    55   6e-06
gi|3941223|gb|AAC82221.1| myosin heavy chain [Schistosoma japoni...    55   6e-06
gi|3941320|gb|AAC82332.1| myosin [Schistosoma japonicum]               55   6e-06
gi|422336|pir||S33068 myosin heavy chain - fluke (Schistosoma ma...    54   8e-06
gi|16078129|ref|NP_388946.1| yirY [Bacillus subtilis subsp. subt...    54   8e-06
gi|11067|emb|CAA46548.1| myosin II heavy chain [Schistosoma mans...    54   8e-06
gi|50730576|ref|XP_425585.1| PREDICTED: similar to GRIP coiled-c...    54   1e-05
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic...    54   1e-05
gi|15237400|ref|NP_197175.1| expressed protein [Arabidopsis thal...    54   1e-05
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl...    54   1e-05
gi|32421469|ref|XP_331178.1| hypothetical protein [Neurospora cr...    54   1e-05
gi|15240835|ref|NP_196383.1| structural maintenance of chromosom...    53   2e-05
gi|677198|gb|AAB00143.1| putative                                      53   2e-05
gi|17550582|ref|NP_510041.1| SMC protein, N-terminal (XM859) [Ca...    53   2e-05
gi|4249699|gb|AAD13771.1| myosin heavy chain [Rana catesbeiana]        53   2e-05
gi|25406838|pir||A86188 hypothetical protein [imported] - Arabid...    53   2e-05
gi|39593040|emb|CAE64509.1| Hypothetical protein CBG09244 [Caeno...    53   2e-05
gi|31874763|emb|CAD98081.1| hypothetical protein [Homo sapiens]        53   2e-05
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae]             53   2e-05
gi|28301617|emb|CAD65851.1| SMC6 protein [Takifugu rubripes]           53   2e-05
gi|6320145|ref|NP_010225.1| involved intracellular protein trans...    53   2e-05
gi|30679235|ref|NP_172024.2| myosin-related [Arabidopsis thaliana]     53   2e-05
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p...    53   2e-05
gi|38105564|gb|EAA51978.1| hypothetical protein MG03573.4 [Magna...    53   2e-05
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel...    52   3e-05
gi|50053824|ref|NP_001001932.1| early endosome antigen 1 [Mus mu...    52   3e-05
gi|41349746|dbj|BAD08304.1| meiosis-specific cohesin subunit SMC...    52   3e-05
gi|49481961|gb|AAT66692.1| DNA repair and genetic recombination ...    52   3e-05
gi|49481951|gb|AAT66687.1| DNA repair and genetic recombination ...    52   3e-05
gi|49481959|gb|AAT66691.1| DNA repair and genetic recombination ...    52   3e-05
gi|49481927|gb|AAT66675.1| DNA repair and genetic recombination ...    52   3e-05
gi|38090688|ref|XP_125851.4| similar to Early endosome antigen 1...    52   3e-05
gi|23612484|ref|NP_704045.1| hypothetical protein [Plasmodium fa...    52   3e-05
gi|13541058|ref|NP_110746.1| ATPase involved in DNA repair [Ther...    52   3e-05
gi|47228744|emb|CAG07476.1| unnamed protein product [Tetraodon n...    52   4e-05
gi|15800123|ref|NP_286135.1| ATP-dependent dsDNA exonuclease [Es...    52   4e-05
gi|15829701|ref|NP_308474.1| ATP-dependent dsDNA exonuclease [Es...    52   4e-05
gi|49328171|gb|AAT58867.1| putative SMC5 protein [Oryza sativa (...    52   4e-05
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch...    52   5e-05
gi|19075000|ref|NP_586506.1| putative NUCLEAR PROTEIN OF THE SMC...    52   5e-05
gi|46047435|ref|NP_996769.1| sarcoma antigen NY-SAR-41 [Homo sap...    52   5e-05
gi|49481943|gb|AAT66683.1| DNA repair and genetic recombination ...    52   5e-05
gi|50542984|ref|XP_499658.1| hypothetical protein [Yarrowia lipo...    52   5e-05
gi|46201456|ref|ZP_00055027.2| COG1196: Chromosome segregation A...    52   5e-05
gi|24649575|ref|NP_651228.1| CG5524-PA [Drosophila melanogaster]...    52   5e-05
gi|16580622|emb|CAD10418.1| SMC protein [Deinococcus radiodurans]      52   5e-05
gi|24642557|ref|NP_727988.1| CG9802-PB [Drosophila melanogaster]...    52   5e-05
gi|26246400|ref|NP_752439.1| Exonuclease sbcC [Escherichia coli ...    51   6e-05
gi|27820006|gb|AAL39489.2| LD05471p [Drosophila melanogaster]          51   6e-05
gi|23508440|ref|NP_701109.1| hypothetical protein [Plasmodium fa...    51   6e-05
gi|50409256|ref|XP_456854.1| unnamed protein product [Debaryomyc...    51   8e-05
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap...    51   8e-05
gi|49481901|gb|AAT66662.1| DNA repair and genetic recombination ...    51   8e-05
gi|49481891|gb|AAT66657.1| DNA repair and genetic recombination ...    51   8e-05
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi]                       51   8e-05
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw...    51   8e-05
gi|23481991|gb|EAA18109.1| erythrocyte binding protein [Plasmodi...    51   8e-05
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|2204269|emb|CAA97648.1| unnamed protein product [Saccharomyce...    50   1e-04
gi|50795133|ref|XP_423749.1| PREDICTED: similar to TATA element ...    50   1e-04
gi|50405018|ref|YP_054110.1| hypothetical protein with coiled-co...    50   1e-04
gi|47224584|emb|CAG03568.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|16758484|ref|NP_446123.1| TATA element modulatory factor 1 [R...    50   1e-04
gi|23380382|gb|AAN18298.1| immunoreactive protein Se68.9 [Strept...    50   1e-04
gi|24111775|ref|NP_706285.1| ATP-dependent dsDNA exonuclease [Sh...    50   1e-04
gi|49481897|gb|AAT66660.1| DNA repair and genetic recombination ...    50   1e-04
gi|49481879|gb|AAT66651.1| DNA repair and genetic recombination ...    50   1e-04
gi|47076824|dbj|BAD18364.1| DNA repair protein [Geobacillus kaus...    50   1e-04


>gi|17535279|ref|NP_496331.1| structural maintenance of chromosome
            protein SMC2 homolog, required for chromosome
            condensation and segregation and for X-chromosome dosage
            compensation, MItosis and X associated MIX-1, LEThal
            LET-29 (140.3 kD) (mix-1) [Caenorhabditis elegans]
 gi|8488992|sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome
            associated protein mix-1 (Structural maintenance of
            chromosome 2) (Protein let-29)
 gi|7511550|pir||T23744 chromosome-associated MIX-1 protein -
            Caenorhabditis elegans
 gi|2088621|gb|AAC47834.1| mitotic chromosome and X-chromosome
            associated MIX-1 protein [Caenorhabditis elegans]
 gi|3878717|emb|CAA87054.1| Hypothetical protein M106.1
            [Caenorhabditis elegans]
 gi|3878912|emb|CAA86786.1| Hypothetical protein M106.1
            [Caenorhabditis elegans]
 gi|3880446|emb|CAA20330.1| Hypothetical protein M106.1
            [Caenorhabditis elegans]
          Length = 1244

 Score =  933 bits (2412), Expect = 0.0
 Identities = 479/500 (95%), Positives = 479/500 (95%)
 Frame = +1

Query: 1    MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK 180
            MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK
Sbjct: 1    MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK 60

Query: 181  SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG 360
            SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG
Sbjct: 61   SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG 120

Query: 361  HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK 540
            HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK
Sbjct: 121  HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK 180

Query: 541  DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY 720
            DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY
Sbjct: 181  DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY 240

Query: 721  FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQXXXXXXXXXXXXXXXXXXXXXQHEEAALSA 900
            FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQ                     QHEEAALSA
Sbjct: 241  FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQLDLDLKNKEDEKKKMEESRDDQHEEAALSA 300

Query: 901  AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK 1080
            AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK
Sbjct: 301  AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK 360

Query: 1081 DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK 1260
            DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK
Sbjct: 361  DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK 420

Query: 1261 RGERLHNQIKHLEGEKATLSARSKSDIGSADNYQKEVDEINKQLQLLGFNIDADTEKREH 1440
            RGERLHNQIKHLEGEKATLSARSKSDIGSADNYQKEVDEINKQLQLLGFNIDADTEKREH
Sbjct: 421  RGERLHNQIKHLEGEKATLSARSKSDIGSADNYQKEVDEINKQLQLLGFNIDADTEKREH 480

Query: 1441 AAKLHESITKLKDMDTRLLN 1500
            AAKLHESITKLKDMDTRLLN
Sbjct: 481  AAKLHESITKLKDMDTRLLN 500



 Score = 45.1 bits (105), Expect = 0.005
 Identities = 43/185 (23%), Positives = 76/185 (40%), Gaps = 1/185 (0%)
 Frame = +1

Query: 943  VKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSKDIQSQSDDEALVTK 1122
            + NQL   + KL +    IN S   +  ++    K H +    N  +I++       V
Sbjct: 730  LNNQLATAMRKLAQVKTNINNS---EFGIVVRDLKVHSEEYEKNQAEIEATVKTLKDVED 786

Query: 1123 YRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKKRGERLHNQIKHLEG 1302
                LES+       DK      + E+ +    A Q    +   K RGE+   ++  L+
Sbjct: 787  KIKTLESMKN----KDKNSQEKRKKELTALLQKAEQT---VAQNKNRGEKARREVMLLQA 839

Query: 1303 EKATLSARSKSDIGSADNYQKEVDEINKQL-QLLGFNIDADTEKREHAAKLHESITKLKD 1479
                +    K D G  +  +KE DE+ ++L   +    DA+ E++   AKL++     +
Sbjct: 840  TVEEMEKTIKKDEGIWEQKKKECDELEEKLPNAIAALKDAELEQKAAQAKLNDLKNNQRQ 899

Query: 1480 MDTRL 1494
            + TRL
Sbjct: 900  ISTRL 904


>gi|7506365|pir||T23981 hypothetical protein R06F6.10 - Caenorhabditis
            elegans
          Length = 421

 Score =  780 bits (2013), Expect = 0.0
 Identities = 400/421 (95%), Positives = 400/421 (95%)
 Frame = +1

Query: 1    MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK 180
            MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK
Sbjct: 1    MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAK 60

Query: 181  SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG 360
            SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG
Sbjct: 61   SMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQRIITAQATGKGCATSYTLNG 120

Query: 361  HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK 540
            HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK
Sbjct: 121  HAATNGKMQDFFRGVGLNVNNPHFLIMQGRITTVLNMKPEEILGMVEEAAGTKMYDQKKK 180

Query: 541  DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY 720
            DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY
Sbjct: 181  DAEKTMFLKDAKLKEVDRIFQSSIDPRMVKFREDRKNMVEVTRLKKLKENFSRKYEAFQY 240

Query: 721  FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQXXXXXXXXXXXXXXXXXXXXXQHEEAALSA 900
            FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQ                     QHEEAALSA
Sbjct: 241  FQTCEAVKKSAKEIEDAKKGIEDLGEKFNQLDLDLKNKEDEKKKMEESRDDQHEEAALSA 300

Query: 901  AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK 1080
            AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK
Sbjct: 301  AHLSKQSIMLQKETVKNQLVETINKLKKEGEQINKSLSKDREVLDAKRKEHEDSKAANSK 360

Query: 1081 DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK 1260
            DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK
Sbjct: 361  DIQSQSDDEALVTKYRNDLESLTRGTIANDKGEHVSIESEIQSCKSTASQMSSGITAAKK 420

Query: 1261 R 1263
            R
Sbjct: 421  R 421




[DB home][top]