Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R07A4_1
(1583 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW f... 973 0.0
gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel al... 969 0.0
gi|2133555|pir||JC4787 shaw protein - California spiny lobster >... 534 e-150
gi|31223140|ref|XP_317268.1| ENSANGP00000022006 [Anopheles gambi... 529 e-149
gi|28574020|ref|NP_722937.2| CG2822-PB [Drosophila melanogaster]... 526 e-148
gi|17136468|ref|NP_476721.1| CG2822-PA [Drosophila melanogaster]... 526 e-148
gi|3219511|gb|AAC23503.1| Shaw potassium channel Kv3.1a [Aplysia... 526 e-148
gi|103308|pir||A41359 potassium channel protein shaw2 - fruit fl... 525 e-148
gi|37619860|emb|CAE48498.1| Hypothetical protein F14F11.1h [Caen... 513 e-144
gi|39593232|emb|CAE64702.1| Hypothetical protein CBG09488 [Caeno... 511 e-143
gi|17563264|ref|NP_506248.1| SHaW family of potassium channels (... 511 e-143
gi|48115206|ref|XP_396385.1| similar to Potassium voltage-gated ... 503 e-141
gi|32564088|ref|NP_871941.1| k+ channel tetramerisation and ion ... 491 e-137
gi|32564084|ref|NP_871939.1| k+ channel tetramerisation and ion ... 491 e-137
gi|32564076|ref|NP_495752.2| k+ channel tetramerisation and ion ... 491 e-137
gi|32564082|ref|NP_871938.1| k+ channel tetramerisation and ion ... 491 e-137
gi|32564086|ref|NP_871940.1| k+ channel tetramerisation and ion ... 491 e-137
gi|32564080|ref|NP_871937.1| k+ channel tetramerisation and ion ... 491 e-137
gi|32564090|ref|NP_871942.1| k+ channel tetramerisation and ion ... 491 e-137
gi|7499096|pir||T20896 hypothetical protein F14F11.1 - Caenorhab... 490 e-137
gi|39587219|emb|CAE57687.1| Hypothetical protein CBG00686 [Caeno... 483 e-135
gi|31223124|ref|XP_317266.1| ENSANGP00000006819 [Anopheles gambi... 472 e-132
gi|39579626|emb|CAE74565.1| Hypothetical protein CBG22329 [Caeno... 395 e-108
gi|5817540|gb|AAD52813.1| Kv3.1 potassium channel [Xenopus laevis] 385 e-105
gi|11878237|gb|AAG40860.1| Kv3.3 potassium channel subunit precu... 382 e-104
gi|47220492|emb|CAG05518.1| unnamed protein product [Tetraodon n... 379 e-103
gi|112166|pir||S17150 potassium channel protein - rat 371 e-101
gi|41281706|ref|NP_631962.1| Shaw-related voltage-gated potassiu... 371 e-101
gi|21217559|ref|NP_631963.1| Shaw-related voltage-gated potassiu... 371 e-101
gi|285134|pir||S22703 voltage-gated potassium channel protein Ra... 371 e-101
gi|24497458|ref|NP_715624.1| Shaw-related voltage-gated potassiu... 370 e-101
gi|29692336|gb|AAO89503.1| Kv3.2d voltage-gated potassium channe... 370 e-101
gi|21217561|ref|NP_631874.1| Shaw-related voltage-gated potassiu... 370 e-101
gi|21217563|ref|NP_631875.1| Shaw-related voltage-gated potassiu... 370 e-101
gi|4960161|gb|AAD34618.1| Kv3.1 [Canis familiaris] 368 e-100
gi|6680522|ref|NP_032447.1| potassium voltage gated channel, Sha... 367 e-100
gi|6981122|ref|NP_036988.1| potassium voltage gated channel, Sha... 367 e-100
gi|4826786|ref|NP_004967.1| Shaw-related voltage-gated potassium... 367 e-100
gi|6959886|gb|AAF33249.1| Shaw-related potassium channel protein... 363 8e-99
gi|27818774|gb|AAO23561.1| Kv3.3d voltage gated potassium channe... 362 1e-98
gi|6680524|ref|NP_032448.1| potassium voltage gated channel, Sha... 362 1e-98
gi|16758906|ref|NP_446449.1| potassium voltage gated channel, Sh... 362 1e-98
gi|27818772|gb|AAO23560.1| Kv3.3c voltage gated potassium channe... 362 1e-98
gi|3023480|sp|Q01956|KNC3_RAT Potassium voltage-gated channel su... 362 1e-98
gi|3023499|sp|Q63959|KNC3_MOUSE Potassium voltage-gated channel ... 362 1e-98
gi|24497460|ref|NP_004968.2| Shaw-related voltage-gated potassiu... 362 2e-98
gi|8488974|sp|Q14003|KNC3_HUMAN Potassium voltage-gated channel ... 362 2e-98
gi|23320901|gb|AAN15930.1| Shaw type potassium channel Kv3.3 [Or... 359 9e-98
gi|47228763|emb|CAG07495.1| unnamed protein product [Tetraodon n... 359 1e-97
gi|24497462|ref|NP_004969.2| Shaw-related voltage-gated potassiu... 356 1e-96
gi|12313899|emb|CAC19684.1| dJ1003J2.3.2 (potassium voltage-gate... 356 1e-96
gi|3023493|sp|Q03721|CIKG_HUMAN Potassium voltage-gated channel ... 356 1e-96
gi|24497464|ref|NP_720198.1| Shaw-related voltage-gated potassiu... 356 1e-96
gi|3023483|sp|Q63734|CIKG_RAT Potassium voltage-gated channel su... 354 4e-96
gi|22122333|ref|NP_666034.1| potassium voltage gated channel, Sh... 353 8e-96
gi|50747836|ref|XP_421008.1| PREDICTED: similar to Potassium vol... 298 3e-79
gi|31223131|ref|XP_317267.1| ENSANGP00000021912 [Anopheles gambi... 268 3e-70
gi|688438|gb|AAA62590.1| noninactivating potassium channel 268 4e-70
gi|3493321|gb|AAC33365.1| delayed rectifier potassium channel [D... 259 1e-67
gi|17380406|sp|P17970|CIKB_DROME Potassium voltage-gated channel... 259 1e-67
gi|24656289|ref|NP_523894.2| CG1066-PB [Drosophila melanogaster]... 259 2e-67
gi|24656294|ref|NP_728783.1| CG1066-PA [Drosophila melanogaster]... 259 2e-67
gi|158459|gb|AAA28896.1| Shab11 protein 258 2e-67
gi|29373793|gb|AAO45534.1| potassium channel Kv3.1 [Notoplana at... 258 3e-67
gi|31215061|ref|XP_315955.1| ENSANGP00000013550 [Anopheles gambi... 258 4e-67
gi|4519932|dbj|BAA75810.1| Kv2 channel alpha-subunit [Halocynthi... 256 1e-66
gi|47229758|emb|CAG06954.1| unnamed protein product [Tetraodon n... 256 1e-66
gi|2315214|emb|CAA74748.1| Kv2 voltage-gated potassium channel [... 254 4e-66
gi|103386|pir||S12746 potassium channel protein shab11 - fruit f... 252 2e-65
gi|103307|pir||B41359 potassium channel protein shab11 - fruit f... 252 2e-65
gi|47523520|ref|NP_999383.1| delayed rectifier potassium channel... 251 3e-65
gi|24418477|sp|Q9MZ19|KCB1_RABIT Potassium voltage-gated channel... 251 3e-65
gi|5031819|ref|NP_005540.1| potassium voltage-gated channel, sha... 251 3e-65
gi|13195252|gb|AAK15623.1| delayed rectifier potassium channel K... 250 6e-65
gi|186798|gb|AAA36156.1| voltage-gated potassium channel 250 8e-65
gi|30410858|gb|AAH51422.1| Kcnb1 protein [Mus musculus] 250 8e-65
gi|4826784|ref|NP_004966.1| potassium voltage-gated channel, Sha... 250 8e-65
gi|24418849|sp|P15387|KCB1_RAT Potassium voltage-gated channel s... 250 8e-65
gi|31560819|ref|NP_032446.2| potassium voltage gated channel, Sh... 250 8e-65
gi|24418471|sp|Q03717|KCB1_MOUSE Potassium voltage-gated channel... 250 8e-65
gi|6981120|ref|NP_037318.1| potassium voltage gated channel, Sha... 250 8e-65
gi|24418473|sp|Q95L11|KCB2_RABIT Potassium voltage-gated channel... 249 1e-64
gi|1163143|gb|AAC59758.1| potassium channel alpha subunit Kv2.1 ... 249 1e-64
gi|38049342|ref|XP_136482.3| RIKEN cDNA 9630047L19 [Mus musculus] 248 4e-64
gi|7321945|gb|AAC60504.2| action potential broadening potassium ... 248 4e-64
gi|743110|prf||2011375A K channel 248 4e-64
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh... 247 6e-64
gi|24418850|sp|Q63099|KCB2_RAT Potassium voltage-gated channel s... 247 6e-64
gi|48123471|ref|XP_396534.1| similar to ENSANGP00000016801 [Apis... 246 8e-64
gi|31223114|ref|XP_317265.1| ENSANGP00000025283 [Anopheles gambi... 246 1e-63
gi|27436974|ref|NP_004761.2| potassium voltage-gated channel, Sh... 245 2e-63
gi|45550160|ref|NP_609284.2| CG4450-PA [Drosophila melanogaster]... 245 2e-63
gi|47215595|emb|CAG11626.1| unnamed protein product [Tetraodon n... 245 2e-63
gi|1546839|gb|AAB08433.1| delayed rectifier potassium channel pr... 244 3e-63
gi|31295626|gb|AAP46292.1| voltage-gated potassium channel alpha... 244 3e-63
gi|1163141|gb|AAC59757.1| potassium channel alpha subunit Kv2.2 ... 244 4e-63
gi|20875435|ref|XP_143471.1| similar to potassium voltage-gated ... 244 4e-63
gi|34860120|ref|XP_227577.2| similar to potassium voltage-gated ... 243 9e-63
gi|29373795|gb|AAO45535.1| potassium channel Kv3.2 [Notoplana at... 242 2e-62
gi|47228621|emb|CAG07353.1| unnamed protein product [Tetraodon n... 234 3e-60
gi|47224426|emb|CAG08676.1| unnamed protein product [Tetraodon n... 234 4e-60
gi|45383239|ref|NP_989794.1| shaker subfamily potassium channel ... 234 6e-60
gi|21311755|gb|AAM46839.1| potassium channel alpha subunit Kv3.4... 234 6e-60
gi|8601|emb|CAA30143.1| unnamed protein product [Drosophila mela... 233 7e-60
gi|24642916|ref|NP_728123.1| CG12348-PE [Drosophila melanogaster... 233 1e-59
gi|16903202|gb|AAL27857.1| potassium channel shaker alpha subuni... 233 1e-59
gi|85242|pir||JH0193 potassium channel shaker form epsilon - fru... 233 1e-59
gi|13432103|sp|P08510|CIKS_DROME Potassium voltage-gated channel... 233 1e-59
gi|25742772|ref|NP_037102.1| potassium voltage-gated channel, sh... 233 1e-59
gi|24642914|ref|NP_728122.1| CG12348-PC [Drosophila melanogaster... 233 1e-59
gi|47220744|emb|CAG11813.1| unnamed protein product [Tetraodon n... 233 1e-59
gi|1546837|gb|AAB08432.1| delayed rectifier potassium channel pr... 233 1e-59
gi|24418856|sp|Q95167|KCB2_CANFA Potassium voltage-gated channel... 233 1e-59
gi|45383237|ref|NP_989793.1| shaker subfamily potassium channel ... 233 1e-59
gi|45549143|ref|NP_523393.3| CG12348-PB [Drosophila melanogaster... 231 3e-59
gi|7800634|gb|AAF70088.1| shaker-related potassium channel Tsha2... 231 3e-59
gi|24642910|ref|NP_728120.1| CG12348-PD [Drosophila melanogaster... 231 3e-59
gi|31203841|ref|XP_310869.1| ENSANGP00000008044 [Anopheles gambi... 231 4e-59
gi|4826782|ref|NP_004965.1| potassium voltage-gated channel, sha... 231 4e-59
gi|31543024|ref|NP_032443.2| potassium voltage-gated channel, sh... 231 4e-59
gi|29470162|gb|AAO74497.1| voltage-gated K channel [Limulus poly... 231 4e-59
gi|27465523|ref|NP_775118.1| potassium voltage-gated channel, sh... 231 5e-59
gi|116420|sp|P16388|CIK1_MOUSE Potassium voltage-gated channel s... 231 5e-59
gi|206549|gb|AAA19867.1| cardiac delayed rectifier potassium cha... 231 5e-59
gi|9652317|gb|AAF91476.1| potassium channel subunit Kv 1.2 [Oryc... 231 5e-59
gi|21392146|gb|AAM48427.1| RE58855p [Drosophila melanogaster] 231 5e-59
gi|108868|pir||S21144 potassium channel protein RCK5 - bovine (f... 230 6e-59
gi|31560570|ref|NP_034725.2| potassium voltage-gated channel, sh... 230 6e-59
gi|50731321|ref|XP_425660.1| PREDICTED: similar to potassium cha... 230 6e-59
gi|14190047|gb|AAK55539.1| potassium channel protein Shal 1.c [P... 230 8e-59
gi|4557685|ref|NP_000208.1| potassium voltage-gated channel, sha... 229 1e-58
gi|2134137|pir||I51532 potassium channel - African clawed frog >... 229 1e-58
gi|4996280|dbj|BAA78383.1| TuKvI [Halocynthia roretzi] 229 1e-58
gi|155764|gb|AAA27756.1| potassium channel 229 1e-58
gi|510098|gb|AAC37227.1| potassium channel protein 229 1e-58
gi|4204389|gb|AAD11454.1| potassium channel Shaker cKv1.4 [Gallu... 229 2e-58
gi|47224427|emb|CAG08677.1| unnamed protein product [Tetraodon n... 229 2e-58
gi|6981116|ref|NP_037103.1| potassium voltage gated channel, sha... 228 2e-58
gi|13021998|gb|AAK11604.1| Kv1.10 potassium channel [Xenopus lae... 228 2e-58
gi|13021992|gb|AAK11602.1| Kv1.2' potassium channel [Xenopus lae... 228 2e-58
gi|544035|sp|P22739|CIK2_XENLA Potassium voltage-gated channel s... 228 2e-58
gi|31543026|ref|NP_067250.2| potassium voltage-gated channel, sh... 227 5e-58
gi|116431|sp|P15385|CIK4_RAT Potassium voltage-gated channel sub... 227 5e-58
gi|47220743|emb|CAG11812.1| unnamed protein product [Tetraodon n... 227 5e-58
gi|3023496|sp|Q28527|CIK4_MUSPF Potassium voltage-gated channel ... 227 7e-58
gi|47228620|emb|CAG07352.1| unnamed protein product [Tetraodon n... 227 7e-58
gi|1050332|gb|AAA80459.1| voltage-gated K+ channel 226 9e-58
gi|14190045|gb|AAK55538.1| potassium channel protein Shal 1.b [P... 226 9e-58
gi|1587846|prf||2207310A shal gene 226 9e-58
gi|14190059|gb|AAK55545.1| potassium channel protein Shal 1.i [P... 226 9e-58
gi|4504817|ref|NP_002224.1| potassium voltage-gated channel, sha... 226 9e-58
gi|14190053|gb|AAK55542.1| potassium channel protein Shal 1.f [P... 226 9e-58
gi|14190051|gb|AAK55541.1| potassium channel protein Shal 1.e [P... 226 9e-58
gi|14190049|gb|AAK55540.1| potassium channel protein Shal 1.d [P... 226 9e-58
gi|13929491|gb|AAA81592.2| shal 1 potassium channel [Panulirus i... 226 9e-58
gi|14190055|gb|AAK55543.1| potassium channel protein Shal 1.g [P... 226 9e-58
gi|14190057|gb|AAK55544.1| potassium channel protein Shal 1.h [P... 226 9e-58
gi|27805965|ref|NP_776796.1| potassium voltage-gated channel, sh... 226 2e-57
gi|1168949|sp|Q05037|CIK4_BOVIN Potassium voltage-gated channel ... 226 2e-57
gi|1098962|gb|AAA92054.1| cGMP-gated potassium channel 226 2e-57
gi|2815400|dbj|BAA24525.1| Kv4.3 [Rattus norvegicus] 225 2e-57
gi|38257804|sp|Q62897|KCD3_RAT Potassium voltage-gated channel s... 225 2e-57
gi|1658483|gb|AAB18337.1| Kv4.3 potassium channel [Rattus norveg... 225 2e-57
gi|15077851|gb|AAK83378.1| shaker-like potassium channel subunit... 225 2e-57
gi|33112054|gb|AAP94028.1| shaker subfamily potassium channel Kv... 225 2e-57
gi|539662|pir||A38101 potassium channel KCNA3 - human >gnl|BL_OR... 225 2e-57
gi|33112048|gb|AAP94025.1| shaker subfamily potassium channel Kv... 225 2e-57
gi|47230729|emb|CAF99922.1| unnamed protein product [Tetraodon n... 225 3e-57
gi|2959684|gb|AAC05909.1| potassium channel [Panulirus interruptus] 225 3e-57
gi|22122429|ref|NP_666095.1| potassium voltage-gated channel, sh... 224 3e-57
gi|539708|pir||A48672 delayed rectifier potassium channel Kv1.2,... 224 3e-57
gi|7800632|gb|AAF70087.1| shaker-related potassium channel Tsha1... 224 3e-57
gi|3023498|sp|Q61423|CIK4_MOUSE Potassium voltage-gated channel ... 224 4e-57
gi|112170|pir||A43531 potassium channel KV1.3 - rat 224 4e-57
gi|9910302|ref|NP_064315.1| potassium voltage-gated channel, Sha... 224 4e-57
gi|38258267|sp|Q9UK17|KCD3_HUMAN Potassium voltage-gated channel... 224 4e-57
gi|38258261|sp|Q9TTT5|KCD3_RABIT Potassium voltage-gated channel... 224 4e-57
gi|12751419|gb|AAK07651.1| transient voltage dependent potassium... 224 4e-57
gi|27436984|ref|NP_004971.2| potassium voltage-gated channel, Sh... 224 4e-57
gi|13929040|ref|NP_113927.1| potassium voltage gated channel, Sh... 224 4e-57
gi|4324647|gb|AAD16974.1| potassium channel Kv4.3M [Mus musculus] 224 4e-57
gi|27436986|ref|NP_751948.1| potassium voltage-gated channel, Sh... 224 4e-57
gi|116430|sp|P22459|CIK4_HUMAN Potassium voltage-gated channel s... 224 4e-57
gi|26329581|dbj|BAC28529.1| unnamed protein product [Mus musculus] 224 4e-57
gi|21311753|gb|AAM46838.1| potassium channel alpha subunit Kv1.4... 224 4e-57
gi|40352738|gb|AAH64595.1| Unknown (protein for IMAGE:5755761) [... 224 4e-57
gi|3264841|gb|AAC24718.1| glibenclamide-sensitive voltage-gated ... 224 4e-57
gi|25952082|ref|NP_002223.2| potassium voltage-gated channel, sh... 224 4e-57
gi|2493594|sp|Q61762|CIK5_MOUSE Potassium voltage-gated channel ... 224 6e-57
gi|17981488|gb|AAL51038.1| voltage-gated potassium channel Kv4.3... 224 6e-57
gi|104160|pir||JH0313 potassium channel protein XSha2 - African ... 224 6e-57
gi|50731319|ref|XP_417226.1| PREDICTED: similar to K+ channel Kv... 223 8e-57
gi|6007795|gb|AAF01044.1| voltage gated potassium channel Kv4.3 ... 223 8e-57
gi|6007797|gb|AAF01045.1| voltage gated potassium channel Kv4.3 ... 223 8e-57
gi|50760247|ref|XP_429232.1| PREDICTED: hypothetical protein XP_... 223 8e-57
gi|46048948|ref|NP_989657.1| potassium voltage-gated channel, Sh... 223 8e-57
gi|9506827|ref|NP_062143.1| potassium voltage gated channel, sha... 223 1e-56
gi|206635|gb|AAA42035.1| voltage-gated potassium channel protein 223 1e-56
gi|6680516|ref|NP_032444.1| potassium voltage-gated channel, sha... 223 1e-56
gi|385223|gb|AAC31761.1| potassium channel [Homo sapiens] 223 1e-56
gi|47210943|emb|CAF91112.1| unnamed protein product [Tetraodon n... 223 1e-56
gi|1705863|sp|P22460|CIK5_HUMAN Potassium voltage-gated channel ... 222 2e-56
gi|25952087|ref|NP_002225.2| potassium voltage-gated channel, sh... 222 2e-56
gi|22252948|gb|AAM94168.1| shaker-like potassium channel Kv1.4 [... 222 2e-56
gi|190203|gb|AAA60146.1| potassium channel 222 2e-56
gi|1705864|sp|P50638|CIK5_RABIT Potassium voltage-gated channel ... 222 2e-56
gi|6981118|ref|NP_037104.1| potassium voltage-gated channel, sha... 221 3e-56
gi|13021995|gb|AAK11603.1| Kv1.4 potassium channel [Xenopus laevis] 221 4e-56
gi|1082705|pir||A56031 potassium channel KCNA5 - human >gnl|BL_O... 221 4e-56
gi|47937676|gb|AAH72256.1| LOC432287 protein [Xenopus laevis] 221 4e-56
gi|48097437|ref|XP_391895.1| similar to ENSANGP00000008044 [Apis... 221 4e-56
gi|57035|emb|CAA34132.1| unnamed protein product [Rattus rattus] 221 5e-56
gi|17737641|ref|NP_524159.1| CG9262-PA [Drosophila melanogaster]... 221 5e-56
gi|45383576|ref|NP_989610.1| potassium voltage-gated channel, Sh... 220 8e-56
gi|189673|gb|AAA36425.1| potassium channel protein 220 8e-56
gi|41054215|ref|NP_956096.1| potassium voltage-gated channel, Sh... 219 1e-55
gi|603152|gb|AAA57320.1| delayed rectifier K+ channel >gnl|BL_OR... 219 2e-55
gi|28261369|gb|AAO32845.1| delayed rectifier K+ channel [Canis f... 218 2e-55
gi|2935436|gb|AAC05122.1| Kv4.3 potassium channel long splice va... 218 2e-55
gi|2935434|gb|AAC05121.1| Kv4.3 potassium channel short splice v... 218 2e-55
gi|26006243|dbj|BAC41464.1| mKIAA1044 protein [Mus musculus] 218 2e-55
gi|17544122|ref|NP_500975.1| kv4.3 potassium channel (4H148) [Ca... 218 2e-55
gi|8918934|dbj|BAA97986.1| unnamed protein product [Mus musculus] 218 2e-55
gi|9790093|ref|NP_062671.1| potassium voltage-gated channel, Sha... 218 2e-55
gi|308765|gb|AAA61276.1| voltage-gated potassium channel 218 2e-55
gi|25952092|ref|NP_114092.2| potassium voltage-gated channel, sh... 218 3e-55
gi|12830377|emb|CAC29065.1| potassium voltage-gated channel, sha... 218 3e-55
gi|13929026|ref|NP_113918.1| potassium channel Kv4.2 [Rattus nor... 218 3e-55
gi|24061764|gb|AAN39878.1| voltage-gated potassium channel Kv4.2... 218 3e-55
gi|38257805|sp|Q63881|KCD2_RAT Potassium voltage-gated channel s... 218 3e-55
gi|7305201|ref|NP_038596.1| potassium voltage-gated channel, sha... 218 3e-55
gi|6685288|sp|P79197|CIK5_MUSPF Potassium voltage-gated channel ... 218 4e-55
gi|1085443|pir||S51212 BAK5 protein - bovine >gnl|BL_ORD_ID|5815... 218 4e-55
gi|47210727|emb|CAF95758.1| unnamed protein product [Tetraodon n... 218 4e-55
gi|6680526|ref|NP_032449.1| potassium voltage-gated channel, Sha... 218 4e-55
gi|31199537|ref|XP_308716.1| ENSANGP00000007629 [Anopheles gambi... 218 4e-55
gi|38257916|sp|P59995|KCD2_RABIT Potassium voltage-gated channel... 218 4e-55
gi|116435|sp|P17659|CIK6_RAT Potassium voltage-gated channel sub... 217 5e-55
gi|92635|pir||JH0167 potassium channel KV1.6 - rat 217 5e-55
gi|34933431|ref|XP_217601.2| similar to potassium channel protei... 217 5e-55
gi|4530478|gb|AAD22053.1| potassium channel KV4.2 [Homo sapiens] 217 5e-55
gi|27436981|ref|NP_004970.3| potassium voltage-gated channel, Sh... 217 5e-55
gi|40789029|dbj|BAA82996.2| KIAA1044 protein [Homo sapiens] 217 7e-55
gi|9789987|ref|NP_036413.1| potassium voltage-gated channel, Sha... 217 7e-55
gi|21311759|gb|AAM46841.1| potassium channel alpha subunit Kv4.2... 216 9e-55
gi|48094389|ref|XP_392118.1| similar to potassium channel protei... 216 9e-55
gi|1245451|gb|AAB02884.1| voltage-dependent potassium channel Sq... 216 1e-54
gi|8272404|dbj|BAA96454.1| shal-type potassium channel (Kv4.1) [... 216 2e-54
gi|39584176|emb|CAE61551.1| Hypothetical protein CBG05460 [Caeno... 215 2e-54
gi|7648673|gb|AAF65618.1| voltage-gated potassium channel Kv4.2 ... 215 2e-54
gi|34856190|ref|XP_344890.1| similar to voltage-gated potassium ... 215 3e-54
gi|4504821|ref|NP_002226.1| potassium voltage-gated channel, sha... 214 4e-54
gi|1763619|gb|AAB39750.1| potassium channel alpha subunit [Polyo... 214 6e-54
gi|39589243|emb|CAE57976.1| Hypothetical protein CBG01037 [Caeno... 213 8e-54
gi|107365|pir||S12787 potassium channel KCNA2 - human 213 1e-53
gi|38090715|ref|XP_193580.3| similar to Potassium voltage-gated ... 210 9e-53
gi|6754414|ref|NP_034726.1| potassium voltage-gated channel, sha... 209 1e-52
gi|987511|gb|AAB02604.1| potassium channel homolog 209 2e-52
gi|346305|pir||S19552 potassium channel protein - human >gnl|BL_... 208 3e-52
gi|50745143|ref|XP_426211.1| PREDICTED: similar to potassium vol... 208 3e-52
gi|7514119|pir||JE0276 voltage-gated potassium channel alpha cha... 208 3e-52
gi|31543041|ref|NP_113966.2| Shab-related delayed-rectifier K+ c... 208 3e-52
gi|2739121|gb|AAB94882.1| Shab-related delayed-rectifier K+ chan... 208 3e-52
gi|41351867|gb|AAS00646.1| potassium channel Kv4; CionaKv4 [Cion... 207 4e-52
gi|50760255|ref|XP_417943.1| PREDICTED: similar to Shaw-related ... 207 4e-52
gi|47208124|emb|CAF91031.1| unnamed protein product [Tetraodon n... 207 7e-52
gi|47217887|emb|CAG05009.1| unnamed protein product [Tetraodon n... 207 7e-52
gi|32564070|ref|NP_871934.1| k+ channel tetramerisation and ion ... 206 2e-51
gi|50507493|emb|CAH04712.1| Hypothetical protein ZK1321.2e [Caen... 206 2e-51
gi|7510995|pir||T27759 hypothetical protein ZK1321.2 - Caenorhab... 206 2e-51
gi|32564068|ref|NP_496104.2| k+ channel tetramerisation and ion ... 206 2e-51
gi|24418478|sp|Q9TT17|KCS3_RABIT Potassium voltage-gated channel... 206 2e-51
gi|27734146|ref|NP_775593.1| potassium voltage-gated channel, de... 205 2e-51
gi|2815899|gb|AAC13164.1| Shab-related delayed-rectifier K+ chan... 204 6e-51
gi|25952108|ref|NP_002243.3| potassium voltage-gated channel del... 204 6e-51
gi|27530020|dbj|BAC53864.1| Kv4 class voltage-gated potassium ch... 203 8e-51
gi|50745141|ref|XP_426210.1| PREDICTED: similar to potassium vol... 203 8e-51
gi|21311763|gb|AAM46843.1| potassium channel alpha subunit Kv4.3... 203 8e-51
gi|27530018|dbj|BAC53863.1| Kv4 class voltage-gated potassium ch... 203 8e-51
gi|2738111|gb|AAB94379.1| potassium channel xKv4.3 [Xenopus laevis] 203 1e-50
gi|30584613|gb|AAP36559.1| Homo sapiens potassium voltage-gated ... 203 1e-50
gi|16198531|gb|AAH15947.1| Potassium voltage-gated channel delay... 203 1e-50
gi|24418475|sp|Q9BQ31|KCS3_HUMAN Potassium voltage-gated channel... 203 1e-50
gi|499659|gb|AAA29794.1| K+ channel protein [Panulirus interruptus] 202 1e-50
gi|1363211|pir||C49507 potassium channel Kv1.5, form 3 - mouse 202 1e-50
gi|186673|gb|AAA59458.1| type l voltage-gated K+ channel of lymp... 202 2e-50
gi|987509|gb|AAB02603.1| potassium channel homolog 202 2e-50
gi|34863358|ref|XP_216678.2| similar to potassium voltage-gated ... 198 3e-49
gi|50510805|dbj|BAD32388.1| mKIAA1144 protein [Mus musculus] 198 3e-49
gi|6680550|ref|NP_032462.1| K+ voltage-gated channel, subfamily ... 198 3e-49
gi|13027418|ref|NP_076456.1| potassium channel, alpha subunit (k... 198 3e-49
gi|41462415|ref|NP_963289.1| potassium voltage-gated channel, su... 198 3e-49
gi|20070166|ref|NP_002227.2| potassium voltage-gated channel, su... 198 3e-49
gi|6329973|dbj|BAA86458.1| KIAA1144 protein [Homo sapiens] 197 4e-49
gi|45383011|ref|NP_065748.1| potassium voltage-gated channel, de... 197 4e-49
gi|32564074|ref|NP_871936.1| k+ channel tetramerisation and ion ... 197 6e-49
gi|32564072|ref|NP_871935.1| k+ channel tetramerisation and ion ... 197 6e-49
gi|40557626|gb|AAR88106.1| potassium channel Kv3.1 [Taenopygia g... 196 1e-48
gi|7513252|pir||JC5919 potassium channel 1 - human >gnl|BL_ORD_I... 195 2e-48
gi|13492973|ref|NP_002242.2| potassium voltage-gated channel del... 194 5e-48
gi|5542588|pdb|3KVT| Tetramerization Domain From Akv3.1 (Shaw-S... 193 1e-47
gi|16758838|ref|NP_446406.1| K+ voltage-gated channel, subfamily... 192 2e-47
gi|6680548|ref|NP_032461.1| K+ voltage-gated channel, subfamily ... 190 9e-47
gi|7514118|pir||JE0275 voltage-gated potassium channel alpha cha... 190 9e-47
gi|1438971|gb|AAC52727.1| potassium channel Kv8.1 [Mesocricetus ... 187 5e-46
gi|7657289|ref|NP_055194.1| potassium channel, subfamily V, memb... 187 6e-46
gi|20381121|gb|AAH28739.1| Potassium channel, subfamily V, membe... 187 6e-46
gi|3387822|gb|AAC28565.1| voltage-gated potassium-channel LKv1; ... 186 1e-45
gi|11067433|ref|NP_067729.1| potassium channel, subfamily V, mem... 186 2e-45
gi|28460685|ref|NP_080476.1| potassium channel Kv8.1 homolog; ne... 185 3e-45
gi|23943842|ref|NP_705732.1| potassium voltage-gated channel, su... 184 4e-45
gi|50740396|ref|XP_419451.1| PREDICTED: similar to potassium vol... 184 5e-45
gi|19071574|ref|NP_579875.1| potassium voltage-gated channel, su... 183 9e-45
gi|12848914|dbj|BAB28134.1| unnamed protein product [Mus musculus] 183 1e-44
gi|27704938|ref|XP_215951.1| similar to Potassium voltage-gated ... 181 3e-44
gi|22164090|gb|AAM93552.1| voltage-gated potassium channel subun... 181 4e-44
gi|27684873|ref|XP_220024.1| similar to potassium channel, subfa... 181 4e-44
gi|24418460|sp|Q8R523|KCG3_RAT Potassium voltage-gated channel s... 181 4e-44
gi|26345098|dbj|BAC36198.1| unnamed protein product [Mus musculus] 181 6e-44
gi|34147232|ref|NP_899002.1| potassium channel, subfamily V, mem... 181 6e-44
gi|27436993|ref|NP_758847.1| potassium voltage-gated channel, su... 181 6e-44
gi|38075353|ref|XP_141545.2| similar to Potassium voltage-gated ... 180 7e-44
gi|27436988|ref|NP_002228.2| potassium voltage-gated channel, su... 180 1e-43
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem... 179 1e-43
gi|28076887|ref|NP_080010.2| voltage-gated potassium channel sub... 179 1e-43
gi|50760267|ref|XP_417948.1| PREDICTED: similar to shaker subfam... 179 2e-43
gi|47222380|emb|CAG05129.1| unnamed protein product [Tetraodon n... 179 2e-43
gi|27436996|ref|NP_758857.1| potassium voltage-gated channel, su... 179 2e-43
gi|34851811|ref|XP_226524.2| similar to RIKEN cDNA 4921535I01 [R... 178 3e-43
gi|50470587|emb|CAA19530.3| Hypothetical protein Y48A6B.6a [Caen... 177 5e-43
gi|22164086|gb|AAM93550.1| voltage-gated potassium channel subun... 177 5e-43
gi|32564679|ref|NP_499417.2| k+ channel tetramerisation and ion ... 177 5e-43
gi|7509961|pir||T26983 hypothetical protein Y48A6B.6 - Caenorhab... 177 5e-43
gi|33112050|gb|AAP94026.1| shaker subfamily potassium channel Kv... 177 8e-43
gi|7513253|pir||JC5920 potassium channel 2 - human >gnl|BL_ORD_I... 177 8e-43
gi|28302320|gb|AAH46629.1| Potassium voltage-gated channel, subf... 176 1e-42
gi|47212908|emb|CAF90798.1| unnamed protein product [Tetraodon n... 176 1e-42
gi|47220096|emb|CAF99009.1| unnamed protein product [Tetraodon n... 175 3e-42
gi|50762086|ref|XP_429194.1| PREDICTED: similar to Potassium cha... 173 1e-41
gi|7494575|pir||T34417 delayed rectifier channel protein homolog... 172 2e-41
gi|39593041|emb|CAE64510.1| Hypothetical protein CBG09245 [Caeno... 172 2e-41
gi|32566100|ref|NP_504583.2| expulsion defective protein 2 like ... 172 2e-41
gi|6959888|gb|AAF33250.1| Shaw-related potassium channel protein... 171 3e-41
gi|34146982|gb|AAA83447.2| Hypothetical protein F44A2.2 [Caenorh... 171 5e-41
gi|47217776|emb|CAG05998.1| unnamed protein product [Tetraodon n... 171 6e-41
gi|47229124|emb|CAG03876.1| unnamed protein product [Tetraodon n... 170 8e-41
gi|45384276|ref|NP_990370.1| Shab-like voltage-gated potassium c... 169 1e-40
gi|47221868|emb|CAF98880.1| unnamed protein product [Tetraodon n... 169 2e-40
gi|48141224|ref|XP_393546.1| similar to CG1066-PA [Apis mellifera] 169 2e-40
gi|40737187|gb|AAR89084.1| shaker-like potassium channel [Callip... 168 3e-40
gi|40737185|gb|AAR89083.1| shaker-like potassium channel [Callip... 168 3e-40
gi|6912444|ref|NP_036415.1| potassium voltage-gated channel, sub... 166 1e-39
gi|39591750|emb|CAE71328.1| Hypothetical protein CBG18227 [Caeno... 166 1e-39
gi|29123088|gb|AAO65852.1| KVS-1 [Caenorhabditis elegans] 166 2e-39
gi|37359267|gb|AAN75511.1| KVS-2 [Caenorhabditis elegans] 166 2e-39
gi|50794590|ref|XP_428021.1| PREDICTED: similar to potassium cha... 164 7e-39
gi|50759023|ref|XP_425704.1| PREDICTED: similar to delayed recti... 162 2e-38
gi|17225492|gb|AAL37430.1| potassium voltage-gated channel [Sus ... 162 3e-38
gi|39593393|emb|CAE64863.1| Hypothetical protein CBG09661 [Caeno... 162 3e-38
gi|7497879|pir||T15829 hypothetical protein C53C9.3 - Caenorhabd... 161 4e-38
gi|25147276|ref|NP_509301.2| K (potassium) Voltage-gated Sensory... 161 5e-38
gi|39752857|gb|AAR30209.1| K (potassium) voltage-gated sensory c... 161 5e-38
gi|39594151|emb|CAE70261.1| Hypothetical protein CBG16762 [Caeno... 161 5e-38
gi|31249890|gb|AAB52604.3| K (potassium) voltage-gated sensory c... 161 5e-38
gi|1763617|gb|AAB39749.1| potassium channel gamma subunit [Polyo... 160 6e-38
gi|50759082|ref|XP_417510.1| PREDICTED: similar to Potassium vol... 160 6e-38
gi|7496828|pir||T19635 hypothetical protein C32C4.1 - Caenorhabd... 160 8e-38
gi|32566712|ref|NP_505725.2| k+ channel tetramerisation and ion ... 160 1e-37
gi|24418462|sp|Q9QYU3|KCG2_RAT Potassium voltage-gated channel s... 159 1e-37
gi|50470586|emb|CAH04760.1| Hypothetical protein Y48A6B.6b [Caen... 158 3e-37
gi|3415132|gb|AAC31613.1| shaker related delayed rectifier potas... 157 5e-37
gi|47224674|emb|CAG03658.1| unnamed protein product [Tetraodon n... 157 9e-37
gi|26329483|dbj|BAC28480.1| unnamed protein product [Mus musculus] 156 1e-36
gi|47224454|emb|CAG08704.1| unnamed protein product [Tetraodon n... 155 3e-36
gi|5814288|gb|AAD52159.1| voltage-gated potassium channel protei... 155 3e-36
gi|41473939|gb|AAS07530.1| unknown [Homo sapiens] 155 3e-36
gi|39583546|emb|CAE65650.1| Hypothetical protein CBG10711 [Caeno... 148 4e-34
gi|25148255|ref|NP_499978.2| voltage-gated channel family member... 147 5e-34
gi|47209609|emb|CAF89593.1| unnamed protein product [Tetraodon n... 147 5e-34
gi|50728348|ref|XP_416101.1| PREDICTED: similar to Shaw-related ... 147 9e-34
gi|47228622|emb|CAG07354.1| unnamed protein product [Tetraodon n... 143 1e-32
gi|47216576|emb|CAG00611.1| unnamed protein product [Tetraodon n... 139 1e-31
gi|19173804|ref|NP_596917.1| potassium voltage-gated channel, su... 137 7e-31
gi|47214297|emb|CAG00963.1| unnamed protein product [Tetraodon n... 136 2e-30
gi|554466|gb|AAA41499.1| potassium channel-Kv2 135 2e-30
gi|39594573|emb|CAE72151.1| Hypothetical protein CBG19249 [Caeno... 135 4e-30
gi|38078841|ref|XP_357386.1| hypothetical protein XP_357386 [Mus... 133 1e-29
gi|47212422|emb|CAF93578.1| unnamed protein product [Tetraodon n... 132 3e-29
gi|2143920|pir||I57681 potassium channel protein - rat (fragment... 132 3e-29
gi|45382465|ref|NP_990230.1| potassium channel Shaker alpha subu... 129 2e-28
gi|47217564|emb|CAG02491.1| unnamed protein product [Tetraodon n... 127 7e-28
gi|47222813|emb|CAF96480.1| unnamed protein product [Tetraodon n... 126 2e-27
gi|50731856|ref|XP_418390.1| PREDICTED: similar to potassium cha... 125 4e-27
gi|47212272|emb|CAF89504.1| unnamed protein product [Tetraodon n... 123 1e-26
gi|975333|gb|AAA75181.1| shaker-like potassium channel homolog, ... 122 2e-26
gi|26332573|dbj|BAC30004.1| unnamed protein product [Mus musculus] 121 4e-26
gi|28175209|gb|AAH43564.1| Similar to potassium voltage-gated ch... 119 2e-25
gi|24642918|ref|NP_728124.1| CG12348-PA [Drosophila melanogaster... 118 3e-25
gi|45555851|ref|NP_996497.1| CG12348-PF [Drosophila melanogaster... 118 3e-25
gi|50753909|ref|XP_425129.1| PREDICTED: similar to Voltage-gated... 114 9e-24
gi|47220741|emb|CAG11810.1| unnamed protein product [Tetraodon n... 112 3e-23
gi|48129508|ref|XP_396650.1| similar to ENSANGP00000013550 [Apis... 109 2e-22
gi|11141731|gb|AAG32051.1| putative potassium channel Kv1 [Trema... 109 2e-22
gi|18252526|gb|AAL66301.1| voltage-gated potassium channel Kv3.4... 108 4e-22
gi|34932488|ref|XP_225718.2| similar to Potassium voltage-gated ... 107 6e-22
gi|5468522|gb|AAD43822.1| voltage-gated potassium channel isofor... 105 3e-21
gi|9454360|gb|AAF87774.1| delayed rectifier potassium ion channe... 105 3e-21
gi|38084655|ref|XP_140499.3| similar to Potassium voltage-gated ... 105 3e-21
gi|1705862|sp|Q09081|CIK2_RABIT Potassium voltage-gated channel ... 104 7e-21
gi|48895851|ref|ZP_00328835.1| COG1226: Kef-type K+ transport sy... 104 7e-21
gi|5468523|gb|AAD43823.1| voltage-gated potassium channel isofor... 103 1e-20
gi|47223540|emb|CAF98027.1| unnamed protein product [Tetraodon n... 102 3e-20
gi|5468519|gb|AAD43819.1| voltage-gated potassium channel isofor... 101 4e-20
gi|47216402|emb|CAG01953.1| unnamed protein product [Tetraodon n... 101 6e-20
gi|47229620|emb|CAG06816.1| unnamed protein product [Tetraodon n... 100 7e-20
gi|21229291|ref|NP_635213.1| Potassium channel protein [Methanos... 100 1e-19
gi|206046|gb|AAA41820.1| potassium channel Kv3.2c 99 4e-19
gi|40737183|gb|AAR89082.1| shaker-like potassium channel [Callip... 98 5e-19
gi|9711573|dbj|BAB07847.1| voltage-dependent K channel [Sus scrofa] 97 8e-19
gi|48854478|ref|ZP_00308640.1| COG1226: Kef-type K+ transport sy... 96 3e-18
gi|46141646|ref|ZP_00204009.1| COG1226: Kef-type K+ transport sy... 96 3e-18
gi|5468520|gb|AAD43820.1| voltage-gated potassium channel isofor... 96 3e-18
gi|50731357|ref|XP_425662.1| PREDICTED: similar to Potassium vol... 96 3e-18
gi|9967389|dbj|BAB12398.1| voltage-dependent potassium channel [... 95 4e-18
gi|33337887|gb|AAQ13572.1| voltage-gated Kv1.3 potassium channel... 95 4e-18
gi|33590528|gb|AAQ22995.1| voltage-gated potassium channel, Shal... 95 5e-18
gi|46201458|ref|ZP_00054971.2| COG1226: Kef-type K+ transport sy... 94 9e-18
gi|50405239|ref|YP_054331.1| K+ channel, putative [Paramecium te... 93 2e-17
gi|28870782|ref|NP_793401.1| ion transport protein, putative [Ps... 92 3e-17
gi|46912722|emb|CAG19512.1| Putative potassium channel [Photobac... 91 8e-17
gi|29349894|ref|NP_813397.1| voltage-gated K+ channel protein [B... 91 1e-16
gi|5468521|gb|AAD43821.1| voltage-gated potassium channel isofor... 91 1e-16
gi|50085477|ref|YP_046987.1| putative potassium channel protein ... 91 1e-16
gi|48729526|ref|ZP_00263276.1| COG1226: Kef-type K+ transport sy... 90 2e-16
gi|41689524|ref|ZP_00146057.1| COG1226: Kef-type K+ transport sy... 89 2e-16
gi|37679357|ref|NP_933966.1| putative potassium channel protein ... 89 3e-16
gi|27366380|ref|NP_761908.1| Probable potassium channel [Vibrio ... 89 3e-16
gi|2137051|pir||I46855 voltage-gated potassium channel - rabbit ... 89 4e-16
gi|22997750|ref|ZP_00041977.1| COG1226: Kef-type K+ transport sy... 89 4e-16
gi|28198561|ref|NP_778875.1| ion transporter 33.9 kDa [Xylella f... 89 4e-16
gi|20090882|ref|NP_616957.1| potassium channel protein [Methanos... 89 4e-16
gi|15838027|ref|NP_298715.1| ion transporter [Xylella fastidiosa... 88 5e-16
gi|24637840|gb|AAN63887.1| potassium channel [Drosophila melanog... 88 7e-16
gi|15596693|ref|NP_250187.1| probable potassium channel [Pseudom... 88 7e-16
gi|25012477|gb|AAN71343.1| RE26469p [Drosophila melanogaster] 88 7e-16
gi|34499017|ref|NP_903232.1| probable ion transporter [Chromobac... 87 9e-16
gi|26990995|ref|NP_746420.1| cation transporter, VIC family [Pse... 87 1e-15
gi|28898897|ref|NP_798502.1| putative potassium channel [Vibrio ... 86 2e-15
gi|47191214|emb|CAF94881.1| unnamed protein product [Tetraodon n... 86 2e-15
gi|27436990|ref|NP_758529.1| potassium voltage-gated channel, su... 86 2e-15
gi|49083349|gb|AAT51009.1| PA1496 [synthetic construct] 86 2e-15
gi|19424124|ref|NP_597997.1| potassium voltage-gated channel, su... 86 3e-15
gi|48861391|ref|ZP_00315293.1| COG1226: Kef-type K+ transport sy... 86 3e-15
gi|39937293|ref|NP_949569.1| Cyclic nucleotide regulated K+ chan... 86 3e-15
gi|1575023|gb|AAB09438.1| potassium channel mKv3.2 85 6e-15
gi|47168964|pdb|1S1G|A Chain A, Crystal Structure Of Kv4.3 T1 Do... 84 9e-15
gi|45552041|ref|NP_788300.2| CG33135-PA [Drosophila melanogaster... 84 9e-15
gi|45552039|ref|NP_788299.2| CG33135-PB [Drosophila melanogaster... 84 9e-15
gi|47207670|emb|CAF93764.1| unnamed protein product [Tetraodon n... 84 9e-15
gi|34810965|pdb|1NN7|A Chain A, Crystal Structure Of The Tetrame... 84 1e-14
gi|48768627|ref|ZP_00272976.1| COG1226: Kef-type K+ transport sy... 84 1e-14
gi|25147242|ref|NP_741819.1| potassium channel, KvQLT family (82... 83 2e-14
gi|25147238|ref|NP_741820.1| potassium channel, KvQLT family (77... 83 2e-14
gi|15805856|ref|NP_294554.1| ion transporter, putative [Deinococ... 83 2e-14
gi|34541624|ref|NP_906103.1| ion transporter [Porphyromonas ging... 83 2e-14
gi|7511689|pir||T34116 voltage-gated potassium channel klq-1 - C... 83 2e-14
gi|31217139|ref|XP_316369.1| ENSANGP00000004228 [Anopheles gambi... 83 2e-14
gi|39586721|emb|CAE65763.1| Hypothetical protein CBG10852 [Caeno... 83 2e-14
gi|45517076|ref|ZP_00168628.1| COG1226: Kef-type K+ transport sy... 82 4e-14
gi|45517078|ref|ZP_00168630.1| COG1226: Kef-type K+ transport sy... 82 4e-14
gi|45517074|ref|ZP_00168626.1| COG1226: Kef-type K+ transport sy... 82 4e-14
gi|46106887|ref|ZP_00200211.1| COG1226: Kef-type K+ transport sy... 81 8e-14
gi|23473800|ref|ZP_00129095.1| COG1226: Kef-type K+ transport sy... 81 8e-14
gi|21232712|ref|NP_638629.1| ion transporter [Xanthomonas campes... 79 2e-13
gi|21244155|ref|NP_643737.1| ion transporter [Xanthomonas axonop... 79 3e-13
gi|45513140|ref|ZP_00164706.1| COG1226: Kef-type K+ transport sy... 79 3e-13
gi|34494838|dbj|BAC85099.1| potassium channel, subfamily V, memb... 79 4e-13
gi|33862490|ref|NP_894050.1| possible potassium channel, VIC fam... 77 9e-13
gi|26333633|dbj|BAC30534.1| unnamed protein product [Mus musculus] 77 1e-12
gi|23121342|ref|ZP_00103672.1| COG1226: Kef-type K+ transport sy... 77 1e-12
gi|34871140|ref|XP_233477.2| similar to potassium voltage-gated ... 77 1e-12
gi|26638655|ref|NP_751895.1| potassium voltage-gated channel KQT... 77 1e-12
gi|26638653|ref|NP_004691.2| potassium voltage-gated channel KQT... 77 1e-12
gi|6166006|sp|P56696|CIQ4_HUMAN Potassium voltage-gated channel ... 77 1e-12
gi|38078783|ref|XP_143960.4| potassium voltage-gated channel, su... 77 1e-12
gi|8648988|emb|CAB94847.1| Kv4.2 voltage-gated potassium channel... 77 2e-12
gi|39591253|emb|CAE73306.1| Hypothetical protein CBG20733 [Caeno... 77 2e-12
gi|16760140|ref|NP_455757.1| possible membrane transport protein... 76 2e-12
gi|16765085|ref|NP_460700.1| putative voltage-gated potassium ch... 76 2e-12
gi|47211206|emb|CAF90163.1| unnamed protein product [Tetraodon n... 75 6e-12
gi|14285403|sp|Q9NR82|CIQ5_HUMAN Potassium voltage-gated channel... 75 6e-12
gi|8132997|gb|AAF73446.1| voltage-gated potassium channel KCNQ5 ... 75 6e-12
gi|50259918|gb|EAL22586.1| hypothetical protein CNBB4630 [Crypto... 75 6e-12
gi|33864687|ref|NP_896246.1| possible potassium channel, VIC fam... 75 6e-12
gi|46187362|ref|ZP_00205309.1| COG1226: Kef-type K+ transport sy... 75 6e-12
gi|28373065|ref|NP_062816.2| potassium voltage-gated channel, KQ... 75 6e-12
gi|9651967|gb|AAF91335.1| voltage-gated potassium channel [Homo ... 75 6e-12
gi|29791782|gb|AAH50689.1| Unknown (protein for IMAGE:6137109) [... 75 6e-12
gi|32564066|ref|NP_496875.2| potassium channel, KvQLT family (kq... 74 7e-12
gi|4176412|dbj|BAA37165.1| alternative splicing:see accession be... 74 1e-11
>gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW family
of potassium channels (egl-36) [Caenorhabditis elegans]
gi|7506376|pir||T23991 hypothetical protein R07A4.1 - Caenorhabditis
elegans
gi|3878927|emb|CAA91765.1| C. elegans EGL-36 protein (corresponding
sequence R07A4.1) [Caenorhabditis elegans]
gi|3879241|emb|CAA92011.1| Hypothetical protein R07A4.1
[Caenorhabditis elegans]
Length = 558
Score = 973 bits (2515), Expect = 0.0
Identities = 482/526 (91%), Positives = 482/526 (91%)
Frame = +3
Query: 3 ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 182
ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI
Sbjct: 33 ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 92
Query: 183 LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 362
LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA
Sbjct: 93 LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 152
Query: 363 DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGXXXX 542
DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAG
Sbjct: 153 DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVL 212
Query: 543 XXXXXXXXXCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 722
CLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF
Sbjct: 213 FIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 272
Query: 723 TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 902
TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF
Sbjct: 273 TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 332
Query: 903 RLFKLTQHHQGLQILIHTFRASAKEXXXXXXXXXXXXXXXXXXXYYAEKMEANPNNQFQS 1082
RLFKLTQHHQGLQILIHTFRASAKE YYAEKMEANPNNQFQS
Sbjct: 333 RLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQS 392
Query: 1083 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 1262
IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN
Sbjct: 393 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 452
Query: 1263 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQXXXXXXQAIRRRNMPILIDQNCCD 1442
QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQ QAIRRRNMPILIDQNCCD
Sbjct: 453 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAIRRRNMPILIDQNCCD 512
Query: 1443 EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAXXXXXXS 1580
EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETA S
Sbjct: 513 EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAITTTIIS 558
>gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel alpha
subunit [Caenorhabditis elegans]
Length = 556
Score = 969 bits (2506), Expect = 0.0
Identities = 481/526 (91%), Positives = 481/526 (91%)
Frame = +3
Query: 3 ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 182
ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI
Sbjct: 31 ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 90
Query: 183 LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 362
LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA
Sbjct: 91 LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 150
Query: 363 DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGXXXX 542
DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAG
Sbjct: 151 DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVL 210
Query: 543 XXXXXXXXXCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 722
CLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF
Sbjct: 211 FIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 270
Query: 723 TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 902
TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF
Sbjct: 271 TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 330
Query: 903 RLFKLTQHHQGLQILIHTFRASAKEXXXXXXXXXXXXXXXXXXXYYAEKMEANPNNQFQS 1082
RLFKLTQHHQGLQILIHTFRASAKE YYAEKMEANPNNQFQS
Sbjct: 331 RLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQS 390
Query: 1083 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 1262
IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN
Sbjct: 391 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 450
Query: 1263 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQXXXXXXQAIRRRNMPILIDQNCCD 1442
QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQ QAIRRRNMPILIDQNCCD
Sbjct: 451 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAIRRRNMPILIDQNCCD 510
Query: 1443 EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAXXXXXXS 1580
EENHNHK REKSENSDEGTNSSSTTGVDTVVKLGPSETA S
Sbjct: 511 EENHNHKDREKSENSDEGTNSSSTTGVDTVVKLGPSETAITTTIIS 556