Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= R07A4_1
         (1583 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW f...   973   0.0
gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel al...   969   0.0
gi|2133555|pir||JC4787 shaw protein - California spiny lobster >...   534   e-150
gi|31223140|ref|XP_317268.1| ENSANGP00000022006 [Anopheles gambi...   529   e-149
gi|28574020|ref|NP_722937.2| CG2822-PB [Drosophila melanogaster]...   526   e-148
gi|17136468|ref|NP_476721.1| CG2822-PA [Drosophila melanogaster]...   526   e-148
gi|3219511|gb|AAC23503.1| Shaw potassium channel Kv3.1a [Aplysia...   526   e-148
gi|103308|pir||A41359 potassium channel protein shaw2 - fruit fl...   525   e-148
gi|37619860|emb|CAE48498.1| Hypothetical protein F14F11.1h [Caen...   513   e-144
gi|39593232|emb|CAE64702.1| Hypothetical protein CBG09488 [Caeno...   511   e-143
gi|17563264|ref|NP_506248.1| SHaW family of potassium channels (...   511   e-143
gi|48115206|ref|XP_396385.1| similar to Potassium voltage-gated ...   503   e-141
gi|32564088|ref|NP_871941.1| k+ channel tetramerisation and ion ...   491   e-137
gi|32564084|ref|NP_871939.1| k+ channel tetramerisation and ion ...   491   e-137
gi|32564076|ref|NP_495752.2| k+ channel tetramerisation and ion ...   491   e-137
gi|32564082|ref|NP_871938.1| k+ channel tetramerisation and ion ...   491   e-137
gi|32564086|ref|NP_871940.1| k+ channel tetramerisation and ion ...   491   e-137
gi|32564080|ref|NP_871937.1| k+ channel tetramerisation and ion ...   491   e-137
gi|32564090|ref|NP_871942.1| k+ channel tetramerisation and ion ...   491   e-137
gi|7499096|pir||T20896 hypothetical protein F14F11.1 - Caenorhab...   490   e-137
gi|39587219|emb|CAE57687.1| Hypothetical protein CBG00686 [Caeno...   483   e-135
gi|31223124|ref|XP_317266.1| ENSANGP00000006819 [Anopheles gambi...   472   e-132
gi|39579626|emb|CAE74565.1| Hypothetical protein CBG22329 [Caeno...   395   e-108
gi|5817540|gb|AAD52813.1| Kv3.1 potassium channel [Xenopus laevis]    385   e-105
gi|11878237|gb|AAG40860.1| Kv3.3 potassium channel subunit precu...   382   e-104
gi|47220492|emb|CAG05518.1| unnamed protein product [Tetraodon n...   379   e-103
gi|112166|pir||S17150 potassium channel protein - rat                 371   e-101
gi|41281706|ref|NP_631962.1| Shaw-related voltage-gated potassiu...   371   e-101
gi|21217559|ref|NP_631963.1| Shaw-related voltage-gated potassiu...   371   e-101
gi|285134|pir||S22703 voltage-gated potassium channel protein Ra...   371   e-101
gi|24497458|ref|NP_715624.1| Shaw-related voltage-gated potassiu...   370   e-101
gi|29692336|gb|AAO89503.1| Kv3.2d voltage-gated potassium channe...   370   e-101
gi|21217561|ref|NP_631874.1| Shaw-related voltage-gated potassiu...   370   e-101
gi|21217563|ref|NP_631875.1| Shaw-related voltage-gated potassiu...   370   e-101
gi|4960161|gb|AAD34618.1| Kv3.1 [Canis familiaris]                    368   e-100
gi|6680522|ref|NP_032447.1| potassium voltage gated channel, Sha...   367   e-100
gi|6981122|ref|NP_036988.1| potassium voltage gated channel, Sha...   367   e-100
gi|4826786|ref|NP_004967.1| Shaw-related voltage-gated potassium...   367   e-100
gi|6959886|gb|AAF33249.1| Shaw-related potassium channel protein...   363   8e-99
gi|27818774|gb|AAO23561.1| Kv3.3d voltage gated potassium channe...   362   1e-98
gi|6680524|ref|NP_032448.1| potassium voltage gated channel, Sha...   362   1e-98
gi|16758906|ref|NP_446449.1| potassium voltage gated channel, Sh...   362   1e-98
gi|27818772|gb|AAO23560.1| Kv3.3c voltage gated potassium channe...   362   1e-98
gi|3023480|sp|Q01956|KNC3_RAT Potassium voltage-gated channel su...   362   1e-98
gi|3023499|sp|Q63959|KNC3_MOUSE Potassium voltage-gated channel ...   362   1e-98
gi|24497460|ref|NP_004968.2| Shaw-related voltage-gated potassiu...   362   2e-98
gi|8488974|sp|Q14003|KNC3_HUMAN Potassium voltage-gated channel ...   362   2e-98
gi|23320901|gb|AAN15930.1| Shaw type potassium channel Kv3.3 [Or...   359   9e-98
gi|47228763|emb|CAG07495.1| unnamed protein product [Tetraodon n...   359   1e-97
gi|24497462|ref|NP_004969.2| Shaw-related voltage-gated potassiu...   356   1e-96
gi|12313899|emb|CAC19684.1| dJ1003J2.3.2 (potassium voltage-gate...   356   1e-96
gi|3023493|sp|Q03721|CIKG_HUMAN Potassium voltage-gated channel ...   356   1e-96
gi|24497464|ref|NP_720198.1| Shaw-related voltage-gated potassiu...   356   1e-96
gi|3023483|sp|Q63734|CIKG_RAT Potassium voltage-gated channel su...   354   4e-96
gi|22122333|ref|NP_666034.1| potassium voltage gated channel, Sh...   353   8e-96
gi|50747836|ref|XP_421008.1| PREDICTED: similar to Potassium vol...   298   3e-79
gi|31223131|ref|XP_317267.1| ENSANGP00000021912 [Anopheles gambi...   268   3e-70
gi|688438|gb|AAA62590.1| noninactivating potassium channel            268   4e-70
gi|3493321|gb|AAC33365.1| delayed rectifier potassium channel [D...   259   1e-67
gi|17380406|sp|P17970|CIKB_DROME Potassium voltage-gated channel...   259   1e-67
gi|24656289|ref|NP_523894.2| CG1066-PB [Drosophila melanogaster]...   259   2e-67
gi|24656294|ref|NP_728783.1| CG1066-PA [Drosophila melanogaster]...   259   2e-67
gi|158459|gb|AAA28896.1| Shab11 protein                               258   2e-67
gi|29373793|gb|AAO45534.1| potassium channel Kv3.1 [Notoplana at...   258   3e-67
gi|31215061|ref|XP_315955.1| ENSANGP00000013550 [Anopheles gambi...   258   4e-67
gi|4519932|dbj|BAA75810.1| Kv2 channel alpha-subunit [Halocynthi...   256   1e-66
gi|47229758|emb|CAG06954.1| unnamed protein product [Tetraodon n...   256   1e-66
gi|2315214|emb|CAA74748.1| Kv2 voltage-gated potassium channel [...   254   4e-66
gi|103386|pir||S12746 potassium channel protein shab11 - fruit f...   252   2e-65
gi|103307|pir||B41359 potassium channel protein shab11 - fruit f...   252   2e-65
gi|47523520|ref|NP_999383.1| delayed rectifier potassium channel...   251   3e-65
gi|24418477|sp|Q9MZ19|KCB1_RABIT Potassium voltage-gated channel...   251   3e-65
gi|5031819|ref|NP_005540.1| potassium voltage-gated channel, sha...   251   3e-65
gi|13195252|gb|AAK15623.1| delayed rectifier potassium channel K...   250   6e-65
gi|186798|gb|AAA36156.1| voltage-gated potassium channel              250   8e-65
gi|30410858|gb|AAH51422.1| Kcnb1 protein [Mus musculus]               250   8e-65
gi|4826784|ref|NP_004966.1| potassium voltage-gated channel, Sha...   250   8e-65
gi|24418849|sp|P15387|KCB1_RAT Potassium voltage-gated channel s...   250   8e-65
gi|31560819|ref|NP_032446.2| potassium voltage gated channel, Sh...   250   8e-65
gi|24418471|sp|Q03717|KCB1_MOUSE Potassium voltage-gated channel...   250   8e-65
gi|6981120|ref|NP_037318.1| potassium voltage gated channel, Sha...   250   8e-65
gi|24418473|sp|Q95L11|KCB2_RABIT Potassium voltage-gated channel...   249   1e-64
gi|1163143|gb|AAC59758.1| potassium channel alpha subunit Kv2.1 ...   249   1e-64
gi|38049342|ref|XP_136482.3| RIKEN cDNA 9630047L19 [Mus musculus]     248   4e-64
gi|7321945|gb|AAC60504.2| action potential broadening potassium ...   248   4e-64
gi|743110|prf||2011375A K channel                                     248   4e-64
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh...   247   6e-64
gi|24418850|sp|Q63099|KCB2_RAT Potassium voltage-gated channel s...   247   6e-64
gi|48123471|ref|XP_396534.1| similar to ENSANGP00000016801 [Apis...   246   8e-64
gi|31223114|ref|XP_317265.1| ENSANGP00000025283 [Anopheles gambi...   246   1e-63
gi|27436974|ref|NP_004761.2| potassium voltage-gated channel, Sh...   245   2e-63
gi|45550160|ref|NP_609284.2| CG4450-PA [Drosophila melanogaster]...   245   2e-63
gi|47215595|emb|CAG11626.1| unnamed protein product [Tetraodon n...   245   2e-63
gi|1546839|gb|AAB08433.1| delayed rectifier potassium channel pr...   244   3e-63
gi|31295626|gb|AAP46292.1| voltage-gated potassium channel alpha...   244   3e-63
gi|1163141|gb|AAC59757.1| potassium channel alpha subunit Kv2.2 ...   244   4e-63
gi|20875435|ref|XP_143471.1| similar to potassium voltage-gated ...   244   4e-63
gi|34860120|ref|XP_227577.2| similar to potassium voltage-gated ...   243   9e-63
gi|29373795|gb|AAO45535.1| potassium channel Kv3.2 [Notoplana at...   242   2e-62
gi|47228621|emb|CAG07353.1| unnamed protein product [Tetraodon n...   234   3e-60
gi|47224426|emb|CAG08676.1| unnamed protein product [Tetraodon n...   234   4e-60
gi|45383239|ref|NP_989794.1| shaker subfamily potassium channel ...   234   6e-60
gi|21311755|gb|AAM46839.1| potassium channel alpha subunit Kv3.4...   234   6e-60
gi|8601|emb|CAA30143.1| unnamed protein product [Drosophila mela...   233   7e-60
gi|24642916|ref|NP_728123.1| CG12348-PE [Drosophila melanogaster...   233   1e-59
gi|16903202|gb|AAL27857.1| potassium channel shaker alpha subuni...   233   1e-59
gi|85242|pir||JH0193 potassium channel shaker form epsilon - fru...   233   1e-59
gi|13432103|sp|P08510|CIKS_DROME Potassium voltage-gated channel...   233   1e-59
gi|25742772|ref|NP_037102.1| potassium voltage-gated channel, sh...   233   1e-59
gi|24642914|ref|NP_728122.1| CG12348-PC [Drosophila melanogaster...   233   1e-59
gi|47220744|emb|CAG11813.1| unnamed protein product [Tetraodon n...   233   1e-59
gi|1546837|gb|AAB08432.1| delayed rectifier potassium channel pr...   233   1e-59
gi|24418856|sp|Q95167|KCB2_CANFA Potassium voltage-gated channel...   233   1e-59
gi|45383237|ref|NP_989793.1| shaker subfamily potassium channel ...   233   1e-59
gi|45549143|ref|NP_523393.3| CG12348-PB [Drosophila melanogaster...   231   3e-59
gi|7800634|gb|AAF70088.1| shaker-related potassium channel Tsha2...   231   3e-59
gi|24642910|ref|NP_728120.1| CG12348-PD [Drosophila melanogaster...   231   3e-59
gi|31203841|ref|XP_310869.1| ENSANGP00000008044 [Anopheles gambi...   231   4e-59
gi|4826782|ref|NP_004965.1| potassium voltage-gated channel, sha...   231   4e-59
gi|31543024|ref|NP_032443.2| potassium voltage-gated channel, sh...   231   4e-59
gi|29470162|gb|AAO74497.1| voltage-gated K channel [Limulus poly...   231   4e-59
gi|27465523|ref|NP_775118.1| potassium voltage-gated channel, sh...   231   5e-59
gi|116420|sp|P16388|CIK1_MOUSE Potassium voltage-gated channel s...   231   5e-59
gi|206549|gb|AAA19867.1| cardiac delayed rectifier potassium cha...   231   5e-59
gi|9652317|gb|AAF91476.1| potassium channel subunit Kv 1.2 [Oryc...   231   5e-59
gi|21392146|gb|AAM48427.1| RE58855p [Drosophila melanogaster]         231   5e-59
gi|108868|pir||S21144 potassium channel protein RCK5 - bovine (f...   230   6e-59
gi|31560570|ref|NP_034725.2| potassium voltage-gated channel, sh...   230   6e-59
gi|50731321|ref|XP_425660.1| PREDICTED: similar to potassium cha...   230   6e-59
gi|14190047|gb|AAK55539.1| potassium channel protein Shal 1.c [P...   230   8e-59
gi|4557685|ref|NP_000208.1| potassium voltage-gated channel, sha...   229   1e-58
gi|2134137|pir||I51532 potassium channel - African clawed frog >...   229   1e-58
gi|4996280|dbj|BAA78383.1| TuKvI [Halocynthia roretzi]                229   1e-58
gi|155764|gb|AAA27756.1| potassium channel                            229   1e-58
gi|510098|gb|AAC37227.1| potassium channel protein                    229   1e-58
gi|4204389|gb|AAD11454.1| potassium channel Shaker cKv1.4 [Gallu...   229   2e-58
gi|47224427|emb|CAG08677.1| unnamed protein product [Tetraodon n...   229   2e-58
gi|6981116|ref|NP_037103.1| potassium voltage gated channel, sha...   228   2e-58
gi|13021998|gb|AAK11604.1| Kv1.10 potassium channel [Xenopus lae...   228   2e-58
gi|13021992|gb|AAK11602.1| Kv1.2' potassium channel [Xenopus lae...   228   2e-58
gi|544035|sp|P22739|CIK2_XENLA Potassium voltage-gated channel s...   228   2e-58
gi|31543026|ref|NP_067250.2| potassium voltage-gated channel, sh...   227   5e-58
gi|116431|sp|P15385|CIK4_RAT Potassium voltage-gated channel sub...   227   5e-58
gi|47220743|emb|CAG11812.1| unnamed protein product [Tetraodon n...   227   5e-58
gi|3023496|sp|Q28527|CIK4_MUSPF Potassium voltage-gated channel ...   227   7e-58
gi|47228620|emb|CAG07352.1| unnamed protein product [Tetraodon n...   227   7e-58
gi|1050332|gb|AAA80459.1| voltage-gated K+ channel                    226   9e-58
gi|14190045|gb|AAK55538.1| potassium channel protein Shal 1.b [P...   226   9e-58
gi|1587846|prf||2207310A shal gene                                    226   9e-58
gi|14190059|gb|AAK55545.1| potassium channel protein Shal 1.i [P...   226   9e-58
gi|4504817|ref|NP_002224.1| potassium voltage-gated channel, sha...   226   9e-58
gi|14190053|gb|AAK55542.1| potassium channel protein Shal 1.f [P...   226   9e-58
gi|14190051|gb|AAK55541.1| potassium channel protein Shal 1.e [P...   226   9e-58
gi|14190049|gb|AAK55540.1| potassium channel protein Shal 1.d [P...   226   9e-58
gi|13929491|gb|AAA81592.2| shal 1 potassium channel [Panulirus i...   226   9e-58
gi|14190055|gb|AAK55543.1| potassium channel protein Shal 1.g [P...   226   9e-58
gi|14190057|gb|AAK55544.1| potassium channel protein Shal 1.h [P...   226   9e-58
gi|27805965|ref|NP_776796.1| potassium voltage-gated channel, sh...   226   2e-57
gi|1168949|sp|Q05037|CIK4_BOVIN Potassium voltage-gated channel ...   226   2e-57
gi|1098962|gb|AAA92054.1| cGMP-gated potassium channel                226   2e-57
gi|2815400|dbj|BAA24525.1| Kv4.3 [Rattus norvegicus]                  225   2e-57
gi|38257804|sp|Q62897|KCD3_RAT Potassium voltage-gated channel s...   225   2e-57
gi|1658483|gb|AAB18337.1| Kv4.3 potassium channel [Rattus norveg...   225   2e-57
gi|15077851|gb|AAK83378.1| shaker-like potassium channel subunit...   225   2e-57
gi|33112054|gb|AAP94028.1| shaker subfamily potassium channel Kv...   225   2e-57
gi|539662|pir||A38101 potassium channel KCNA3 - human >gnl|BL_OR...   225   2e-57
gi|33112048|gb|AAP94025.1| shaker subfamily potassium channel Kv...   225   2e-57
gi|47230729|emb|CAF99922.1| unnamed protein product [Tetraodon n...   225   3e-57
gi|2959684|gb|AAC05909.1| potassium channel [Panulirus interruptus]   225   3e-57
gi|22122429|ref|NP_666095.1| potassium voltage-gated channel, sh...   224   3e-57
gi|539708|pir||A48672 delayed rectifier potassium channel Kv1.2,...   224   3e-57
gi|7800632|gb|AAF70087.1| shaker-related potassium channel Tsha1...   224   3e-57
gi|3023498|sp|Q61423|CIK4_MOUSE Potassium voltage-gated channel ...   224   4e-57
gi|112170|pir||A43531 potassium channel KV1.3 - rat                   224   4e-57
gi|9910302|ref|NP_064315.1| potassium voltage-gated channel, Sha...   224   4e-57
gi|38258267|sp|Q9UK17|KCD3_HUMAN Potassium voltage-gated channel...   224   4e-57
gi|38258261|sp|Q9TTT5|KCD3_RABIT Potassium voltage-gated channel...   224   4e-57
gi|12751419|gb|AAK07651.1| transient voltage dependent potassium...   224   4e-57
gi|27436984|ref|NP_004971.2| potassium voltage-gated channel, Sh...   224   4e-57
gi|13929040|ref|NP_113927.1| potassium voltage gated channel, Sh...   224   4e-57
gi|4324647|gb|AAD16974.1| potassium channel Kv4.3M [Mus musculus]     224   4e-57
gi|27436986|ref|NP_751948.1| potassium voltage-gated channel, Sh...   224   4e-57
gi|116430|sp|P22459|CIK4_HUMAN Potassium voltage-gated channel s...   224   4e-57
gi|26329581|dbj|BAC28529.1| unnamed protein product [Mus musculus]    224   4e-57
gi|21311753|gb|AAM46838.1| potassium channel alpha subunit Kv1.4...   224   4e-57
gi|40352738|gb|AAH64595.1| Unknown (protein for IMAGE:5755761) [...   224   4e-57
gi|3264841|gb|AAC24718.1| glibenclamide-sensitive voltage-gated ...   224   4e-57
gi|25952082|ref|NP_002223.2| potassium voltage-gated channel, sh...   224   4e-57
gi|2493594|sp|Q61762|CIK5_MOUSE Potassium voltage-gated channel ...   224   6e-57
gi|17981488|gb|AAL51038.1| voltage-gated potassium channel Kv4.3...   224   6e-57
gi|104160|pir||JH0313 potassium channel protein XSha2 - African ...   224   6e-57
gi|50731319|ref|XP_417226.1| PREDICTED: similar to K+ channel Kv...   223   8e-57
gi|6007795|gb|AAF01044.1| voltage gated potassium channel Kv4.3 ...   223   8e-57
gi|6007797|gb|AAF01045.1| voltage gated potassium channel Kv4.3 ...   223   8e-57
gi|50760247|ref|XP_429232.1| PREDICTED: hypothetical protein XP_...   223   8e-57
gi|46048948|ref|NP_989657.1| potassium voltage-gated channel, Sh...   223   8e-57
gi|9506827|ref|NP_062143.1| potassium voltage gated channel, sha...   223   1e-56
gi|206635|gb|AAA42035.1| voltage-gated potassium channel protein      223   1e-56
gi|6680516|ref|NP_032444.1| potassium voltage-gated channel, sha...   223   1e-56
gi|385223|gb|AAC31761.1| potassium channel [Homo sapiens]             223   1e-56
gi|47210943|emb|CAF91112.1| unnamed protein product [Tetraodon n...   223   1e-56
gi|1705863|sp|P22460|CIK5_HUMAN Potassium voltage-gated channel ...   222   2e-56
gi|25952087|ref|NP_002225.2| potassium voltage-gated channel, sh...   222   2e-56
gi|22252948|gb|AAM94168.1| shaker-like potassium channel Kv1.4 [...   222   2e-56
gi|190203|gb|AAA60146.1| potassium channel                            222   2e-56
gi|1705864|sp|P50638|CIK5_RABIT Potassium voltage-gated channel ...   222   2e-56
gi|6981118|ref|NP_037104.1| potassium voltage-gated channel, sha...   221   3e-56
gi|13021995|gb|AAK11603.1| Kv1.4 potassium channel [Xenopus laevis]   221   4e-56
gi|1082705|pir||A56031 potassium channel KCNA5 - human >gnl|BL_O...   221   4e-56
gi|47937676|gb|AAH72256.1| LOC432287 protein [Xenopus laevis]         221   4e-56
gi|48097437|ref|XP_391895.1| similar to ENSANGP00000008044 [Apis...   221   4e-56
gi|57035|emb|CAA34132.1| unnamed protein product [Rattus rattus]      221   5e-56
gi|17737641|ref|NP_524159.1| CG9262-PA [Drosophila melanogaster]...   221   5e-56
gi|45383576|ref|NP_989610.1| potassium voltage-gated channel, Sh...   220   8e-56
gi|189673|gb|AAA36425.1| potassium channel protein                    220   8e-56
gi|41054215|ref|NP_956096.1| potassium voltage-gated channel, Sh...   219   1e-55
gi|603152|gb|AAA57320.1| delayed rectifier K+ channel >gnl|BL_OR...   219   2e-55
gi|28261369|gb|AAO32845.1| delayed rectifier K+ channel [Canis f...   218   2e-55
gi|2935436|gb|AAC05122.1| Kv4.3 potassium channel long splice va...   218   2e-55
gi|2935434|gb|AAC05121.1| Kv4.3 potassium channel short splice v...   218   2e-55
gi|26006243|dbj|BAC41464.1| mKIAA1044 protein [Mus musculus]          218   2e-55
gi|17544122|ref|NP_500975.1| kv4.3 potassium channel (4H148) [Ca...   218   2e-55
gi|8918934|dbj|BAA97986.1| unnamed protein product [Mus musculus]     218   2e-55
gi|9790093|ref|NP_062671.1| potassium voltage-gated channel, Sha...   218   2e-55
gi|308765|gb|AAA61276.1| voltage-gated potassium channel              218   2e-55
gi|25952092|ref|NP_114092.2| potassium voltage-gated channel, sh...   218   3e-55
gi|12830377|emb|CAC29065.1| potassium voltage-gated channel, sha...   218   3e-55
gi|13929026|ref|NP_113918.1| potassium channel Kv4.2 [Rattus nor...   218   3e-55
gi|24061764|gb|AAN39878.1| voltage-gated potassium channel Kv4.2...   218   3e-55
gi|38257805|sp|Q63881|KCD2_RAT Potassium voltage-gated channel s...   218   3e-55
gi|7305201|ref|NP_038596.1| potassium voltage-gated channel, sha...   218   3e-55
gi|6685288|sp|P79197|CIK5_MUSPF Potassium voltage-gated channel ...   218   4e-55
gi|1085443|pir||S51212 BAK5 protein - bovine >gnl|BL_ORD_ID|5815...   218   4e-55
gi|47210727|emb|CAF95758.1| unnamed protein product [Tetraodon n...   218   4e-55
gi|6680526|ref|NP_032449.1| potassium voltage-gated channel, Sha...   218   4e-55
gi|31199537|ref|XP_308716.1| ENSANGP00000007629 [Anopheles gambi...   218   4e-55
gi|38257916|sp|P59995|KCD2_RABIT Potassium voltage-gated channel...   218   4e-55
gi|116435|sp|P17659|CIK6_RAT Potassium voltage-gated channel sub...   217   5e-55
gi|92635|pir||JH0167 potassium channel KV1.6 - rat                    217   5e-55
gi|34933431|ref|XP_217601.2| similar to potassium channel protei...   217   5e-55
gi|4530478|gb|AAD22053.1| potassium channel KV4.2 [Homo sapiens]      217   5e-55
gi|27436981|ref|NP_004970.3| potassium voltage-gated channel, Sh...   217   5e-55
gi|40789029|dbj|BAA82996.2| KIAA1044 protein [Homo sapiens]           217   7e-55
gi|9789987|ref|NP_036413.1| potassium voltage-gated channel, Sha...   217   7e-55
gi|21311759|gb|AAM46841.1| potassium channel alpha subunit Kv4.2...   216   9e-55
gi|48094389|ref|XP_392118.1| similar to potassium channel protei...   216   9e-55
gi|1245451|gb|AAB02884.1| voltage-dependent potassium channel Sq...   216   1e-54
gi|8272404|dbj|BAA96454.1| shal-type potassium channel (Kv4.1) [...   216   2e-54
gi|39584176|emb|CAE61551.1| Hypothetical protein CBG05460 [Caeno...   215   2e-54
gi|7648673|gb|AAF65618.1| voltage-gated potassium channel Kv4.2 ...   215   2e-54
gi|34856190|ref|XP_344890.1| similar to voltage-gated potassium ...   215   3e-54
gi|4504821|ref|NP_002226.1| potassium voltage-gated channel, sha...   214   4e-54
gi|1763619|gb|AAB39750.1| potassium channel alpha subunit [Polyo...   214   6e-54
gi|39589243|emb|CAE57976.1| Hypothetical protein CBG01037 [Caeno...   213   8e-54
gi|107365|pir||S12787 potassium channel KCNA2 - human                 213   1e-53
gi|38090715|ref|XP_193580.3| similar to Potassium voltage-gated ...   210   9e-53
gi|6754414|ref|NP_034726.1| potassium voltage-gated channel, sha...   209   1e-52
gi|987511|gb|AAB02604.1| potassium channel homolog                    209   2e-52
gi|346305|pir||S19552 potassium channel protein - human >gnl|BL_...   208   3e-52
gi|50745143|ref|XP_426211.1| PREDICTED: similar to potassium vol...   208   3e-52
gi|7514119|pir||JE0276 voltage-gated potassium channel alpha cha...   208   3e-52
gi|31543041|ref|NP_113966.2| Shab-related delayed-rectifier K+ c...   208   3e-52
gi|2739121|gb|AAB94882.1| Shab-related delayed-rectifier K+ chan...   208   3e-52
gi|41351867|gb|AAS00646.1| potassium channel Kv4; CionaKv4 [Cion...   207   4e-52
gi|50760255|ref|XP_417943.1| PREDICTED: similar to Shaw-related ...   207   4e-52
gi|47208124|emb|CAF91031.1| unnamed protein product [Tetraodon n...   207   7e-52
gi|47217887|emb|CAG05009.1| unnamed protein product [Tetraodon n...   207   7e-52
gi|32564070|ref|NP_871934.1| k+ channel tetramerisation and ion ...   206   2e-51
gi|50507493|emb|CAH04712.1| Hypothetical protein ZK1321.2e [Caen...   206   2e-51
gi|7510995|pir||T27759 hypothetical protein ZK1321.2 - Caenorhab...   206   2e-51
gi|32564068|ref|NP_496104.2| k+ channel tetramerisation and ion ...   206   2e-51
gi|24418478|sp|Q9TT17|KCS3_RABIT Potassium voltage-gated channel...   206   2e-51
gi|27734146|ref|NP_775593.1| potassium voltage-gated channel, de...   205   2e-51
gi|2815899|gb|AAC13164.1| Shab-related delayed-rectifier K+ chan...   204   6e-51
gi|25952108|ref|NP_002243.3| potassium voltage-gated channel del...   204   6e-51
gi|27530020|dbj|BAC53864.1| Kv4 class voltage-gated potassium ch...   203   8e-51
gi|50745141|ref|XP_426210.1| PREDICTED: similar to potassium vol...   203   8e-51
gi|21311763|gb|AAM46843.1| potassium channel alpha subunit Kv4.3...   203   8e-51
gi|27530018|dbj|BAC53863.1| Kv4 class voltage-gated potassium ch...   203   8e-51
gi|2738111|gb|AAB94379.1| potassium channel xKv4.3 [Xenopus laevis]   203   1e-50
gi|30584613|gb|AAP36559.1| Homo sapiens potassium voltage-gated ...   203   1e-50
gi|16198531|gb|AAH15947.1| Potassium voltage-gated channel delay...   203   1e-50
gi|24418475|sp|Q9BQ31|KCS3_HUMAN Potassium voltage-gated channel...   203   1e-50
gi|499659|gb|AAA29794.1| K+ channel protein [Panulirus interruptus]   202   1e-50
gi|1363211|pir||C49507 potassium channel Kv1.5, form 3 - mouse        202   1e-50
gi|186673|gb|AAA59458.1| type l voltage-gated K+ channel of lymp...   202   2e-50
gi|987509|gb|AAB02603.1| potassium channel homolog                    202   2e-50
gi|34863358|ref|XP_216678.2| similar to potassium voltage-gated ...   198   3e-49
gi|50510805|dbj|BAD32388.1| mKIAA1144 protein [Mus musculus]          198   3e-49
gi|6680550|ref|NP_032462.1| K+ voltage-gated channel, subfamily ...   198   3e-49
gi|13027418|ref|NP_076456.1| potassium channel, alpha subunit (k...   198   3e-49
gi|41462415|ref|NP_963289.1| potassium voltage-gated channel, su...   198   3e-49
gi|20070166|ref|NP_002227.2| potassium voltage-gated channel, su...   198   3e-49
gi|6329973|dbj|BAA86458.1| KIAA1144 protein [Homo sapiens]            197   4e-49
gi|45383011|ref|NP_065748.1| potassium voltage-gated channel, de...   197   4e-49
gi|32564074|ref|NP_871936.1| k+ channel tetramerisation and ion ...   197   6e-49
gi|32564072|ref|NP_871935.1| k+ channel tetramerisation and ion ...   197   6e-49
gi|40557626|gb|AAR88106.1| potassium channel Kv3.1 [Taenopygia g...   196   1e-48
gi|7513252|pir||JC5919 potassium channel 1 - human >gnl|BL_ORD_I...   195   2e-48
gi|13492973|ref|NP_002242.2| potassium voltage-gated channel del...   194   5e-48
gi|5542588|pdb|3KVT|  Tetramerization Domain From Akv3.1 (Shaw-S...   193   1e-47
gi|16758838|ref|NP_446406.1| K+ voltage-gated channel, subfamily...   192   2e-47
gi|6680548|ref|NP_032461.1| K+ voltage-gated channel, subfamily ...   190   9e-47
gi|7514118|pir||JE0275 voltage-gated potassium channel alpha cha...   190   9e-47
gi|1438971|gb|AAC52727.1| potassium channel Kv8.1 [Mesocricetus ...   187   5e-46
gi|7657289|ref|NP_055194.1| potassium channel, subfamily V, memb...   187   6e-46
gi|20381121|gb|AAH28739.1| Potassium channel, subfamily V, membe...   187   6e-46
gi|3387822|gb|AAC28565.1| voltage-gated potassium-channel LKv1; ...   186   1e-45
gi|11067433|ref|NP_067729.1| potassium channel, subfamily V, mem...   186   2e-45
gi|28460685|ref|NP_080476.1| potassium channel Kv8.1 homolog; ne...   185   3e-45
gi|23943842|ref|NP_705732.1| potassium voltage-gated channel, su...   184   4e-45
gi|50740396|ref|XP_419451.1| PREDICTED: similar to potassium vol...   184   5e-45
gi|19071574|ref|NP_579875.1| potassium voltage-gated channel, su...   183   9e-45
gi|12848914|dbj|BAB28134.1| unnamed protein product [Mus musculus]    183   1e-44
gi|27704938|ref|XP_215951.1| similar to Potassium voltage-gated ...   181   3e-44
gi|22164090|gb|AAM93552.1| voltage-gated potassium channel subun...   181   4e-44
gi|27684873|ref|XP_220024.1| similar to potassium channel, subfa...   181   4e-44
gi|24418460|sp|Q8R523|KCG3_RAT Potassium voltage-gated channel s...   181   4e-44
gi|26345098|dbj|BAC36198.1| unnamed protein product [Mus musculus]    181   6e-44
gi|34147232|ref|NP_899002.1| potassium channel, subfamily V, mem...   181   6e-44
gi|27436993|ref|NP_758847.1| potassium voltage-gated channel, su...   181   6e-44
gi|38075353|ref|XP_141545.2| similar to Potassium voltage-gated ...   180   7e-44
gi|27436988|ref|NP_002228.2| potassium voltage-gated channel, su...   180   1e-43
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem...   179   1e-43
gi|28076887|ref|NP_080010.2| voltage-gated potassium channel sub...   179   1e-43
gi|50760267|ref|XP_417948.1| PREDICTED: similar to shaker subfam...   179   2e-43
gi|47222380|emb|CAG05129.1| unnamed protein product [Tetraodon n...   179   2e-43
gi|27436996|ref|NP_758857.1| potassium voltage-gated channel, su...   179   2e-43
gi|34851811|ref|XP_226524.2| similar to RIKEN cDNA 4921535I01 [R...   178   3e-43
gi|50470587|emb|CAA19530.3| Hypothetical protein Y48A6B.6a [Caen...   177   5e-43
gi|22164086|gb|AAM93550.1| voltage-gated potassium channel subun...   177   5e-43
gi|32564679|ref|NP_499417.2| k+ channel tetramerisation and ion ...   177   5e-43
gi|7509961|pir||T26983 hypothetical protein Y48A6B.6 - Caenorhab...   177   5e-43
gi|33112050|gb|AAP94026.1| shaker subfamily potassium channel Kv...   177   8e-43
gi|7513253|pir||JC5920 potassium channel 2 - human >gnl|BL_ORD_I...   177   8e-43
gi|28302320|gb|AAH46629.1| Potassium voltage-gated channel, subf...   176   1e-42
gi|47212908|emb|CAF90798.1| unnamed protein product [Tetraodon n...   176   1e-42
gi|47220096|emb|CAF99009.1| unnamed protein product [Tetraodon n...   175   3e-42
gi|50762086|ref|XP_429194.1| PREDICTED: similar to Potassium cha...   173   1e-41
gi|7494575|pir||T34417 delayed rectifier channel protein homolog...   172   2e-41
gi|39593041|emb|CAE64510.1| Hypothetical protein CBG09245 [Caeno...   172   2e-41
gi|32566100|ref|NP_504583.2| expulsion defective protein 2 like ...   172   2e-41
gi|6959888|gb|AAF33250.1| Shaw-related potassium channel protein...   171   3e-41
gi|34146982|gb|AAA83447.2| Hypothetical protein F44A2.2 [Caenorh...   171   5e-41
gi|47217776|emb|CAG05998.1| unnamed protein product [Tetraodon n...   171   6e-41
gi|47229124|emb|CAG03876.1| unnamed protein product [Tetraodon n...   170   8e-41
gi|45384276|ref|NP_990370.1| Shab-like voltage-gated potassium c...   169   1e-40
gi|47221868|emb|CAF98880.1| unnamed protein product [Tetraodon n...   169   2e-40
gi|48141224|ref|XP_393546.1| similar to CG1066-PA [Apis mellifera]    169   2e-40
gi|40737187|gb|AAR89084.1| shaker-like potassium channel [Callip...   168   3e-40
gi|40737185|gb|AAR89083.1| shaker-like potassium channel [Callip...   168   3e-40
gi|6912444|ref|NP_036415.1| potassium voltage-gated channel, sub...   166   1e-39
gi|39591750|emb|CAE71328.1| Hypothetical protein CBG18227 [Caeno...   166   1e-39
gi|29123088|gb|AAO65852.1| KVS-1 [Caenorhabditis elegans]             166   2e-39
gi|37359267|gb|AAN75511.1| KVS-2 [Caenorhabditis elegans]             166   2e-39
gi|50794590|ref|XP_428021.1| PREDICTED: similar to potassium cha...   164   7e-39
gi|50759023|ref|XP_425704.1| PREDICTED: similar to delayed recti...   162   2e-38
gi|17225492|gb|AAL37430.1| potassium voltage-gated channel [Sus ...   162   3e-38
gi|39593393|emb|CAE64863.1| Hypothetical protein CBG09661 [Caeno...   162   3e-38
gi|7497879|pir||T15829 hypothetical protein C53C9.3 - Caenorhabd...   161   4e-38
gi|25147276|ref|NP_509301.2| K (potassium) Voltage-gated Sensory...   161   5e-38
gi|39752857|gb|AAR30209.1| K (potassium) voltage-gated sensory c...   161   5e-38
gi|39594151|emb|CAE70261.1| Hypothetical protein CBG16762 [Caeno...   161   5e-38
gi|31249890|gb|AAB52604.3| K (potassium) voltage-gated sensory c...   161   5e-38
gi|1763617|gb|AAB39749.1| potassium channel gamma subunit [Polyo...   160   6e-38
gi|50759082|ref|XP_417510.1| PREDICTED: similar to Potassium vol...   160   6e-38
gi|7496828|pir||T19635 hypothetical protein C32C4.1 - Caenorhabd...   160   8e-38
gi|32566712|ref|NP_505725.2| k+ channel tetramerisation and ion ...   160   1e-37
gi|24418462|sp|Q9QYU3|KCG2_RAT Potassium voltage-gated channel s...   159   1e-37
gi|50470586|emb|CAH04760.1| Hypothetical protein Y48A6B.6b [Caen...   158   3e-37
gi|3415132|gb|AAC31613.1| shaker related delayed rectifier potas...   157   5e-37
gi|47224674|emb|CAG03658.1| unnamed protein product [Tetraodon n...   157   9e-37
gi|26329483|dbj|BAC28480.1| unnamed protein product [Mus musculus]    156   1e-36
gi|47224454|emb|CAG08704.1| unnamed protein product [Tetraodon n...   155   3e-36
gi|5814288|gb|AAD52159.1| voltage-gated potassium channel protei...   155   3e-36
gi|41473939|gb|AAS07530.1| unknown [Homo sapiens]                     155   3e-36
gi|39583546|emb|CAE65650.1| Hypothetical protein CBG10711 [Caeno...   148   4e-34
gi|25148255|ref|NP_499978.2| voltage-gated channel family member...   147   5e-34
gi|47209609|emb|CAF89593.1| unnamed protein product [Tetraodon n...   147   5e-34
gi|50728348|ref|XP_416101.1| PREDICTED: similar to Shaw-related ...   147   9e-34
gi|47228622|emb|CAG07354.1| unnamed protein product [Tetraodon n...   143   1e-32
gi|47216576|emb|CAG00611.1| unnamed protein product [Tetraodon n...   139   1e-31
gi|19173804|ref|NP_596917.1| potassium voltage-gated channel, su...   137   7e-31
gi|47214297|emb|CAG00963.1| unnamed protein product [Tetraodon n...   136   2e-30
gi|554466|gb|AAA41499.1| potassium channel-Kv2                        135   2e-30
gi|39594573|emb|CAE72151.1| Hypothetical protein CBG19249 [Caeno...   135   4e-30
gi|38078841|ref|XP_357386.1| hypothetical protein XP_357386 [Mus...   133   1e-29
gi|47212422|emb|CAF93578.1| unnamed protein product [Tetraodon n...   132   3e-29
gi|2143920|pir||I57681 potassium channel protein - rat (fragment...   132   3e-29
gi|45382465|ref|NP_990230.1| potassium channel Shaker alpha subu...   129   2e-28
gi|47217564|emb|CAG02491.1| unnamed protein product [Tetraodon n...   127   7e-28
gi|47222813|emb|CAF96480.1| unnamed protein product [Tetraodon n...   126   2e-27
gi|50731856|ref|XP_418390.1| PREDICTED: similar to potassium cha...   125   4e-27
gi|47212272|emb|CAF89504.1| unnamed protein product [Tetraodon n...   123   1e-26
gi|975333|gb|AAA75181.1| shaker-like potassium channel homolog, ...   122   2e-26
gi|26332573|dbj|BAC30004.1| unnamed protein product [Mus musculus]    121   4e-26
gi|28175209|gb|AAH43564.1| Similar to potassium voltage-gated ch...   119   2e-25
gi|24642918|ref|NP_728124.1| CG12348-PA [Drosophila melanogaster...   118   3e-25
gi|45555851|ref|NP_996497.1| CG12348-PF [Drosophila melanogaster...   118   3e-25
gi|50753909|ref|XP_425129.1| PREDICTED: similar to Voltage-gated...   114   9e-24
gi|47220741|emb|CAG11810.1| unnamed protein product [Tetraodon n...   112   3e-23
gi|48129508|ref|XP_396650.1| similar to ENSANGP00000013550 [Apis...   109   2e-22
gi|11141731|gb|AAG32051.1| putative potassium channel Kv1 [Trema...   109   2e-22
gi|18252526|gb|AAL66301.1| voltage-gated potassium channel Kv3.4...   108   4e-22
gi|34932488|ref|XP_225718.2| similar to Potassium voltage-gated ...   107   6e-22
gi|5468522|gb|AAD43822.1| voltage-gated potassium channel isofor...   105   3e-21
gi|9454360|gb|AAF87774.1| delayed rectifier potassium ion channe...   105   3e-21
gi|38084655|ref|XP_140499.3| similar to Potassium voltage-gated ...   105   3e-21
gi|1705862|sp|Q09081|CIK2_RABIT Potassium voltage-gated channel ...   104   7e-21
gi|48895851|ref|ZP_00328835.1| COG1226: Kef-type K+ transport sy...   104   7e-21
gi|5468523|gb|AAD43823.1| voltage-gated potassium channel isofor...   103   1e-20
gi|47223540|emb|CAF98027.1| unnamed protein product [Tetraodon n...   102   3e-20
gi|5468519|gb|AAD43819.1| voltage-gated potassium channel isofor...   101   4e-20
gi|47216402|emb|CAG01953.1| unnamed protein product [Tetraodon n...   101   6e-20
gi|47229620|emb|CAG06816.1| unnamed protein product [Tetraodon n...   100   7e-20
gi|21229291|ref|NP_635213.1| Potassium channel protein [Methanos...   100   1e-19
gi|206046|gb|AAA41820.1| potassium channel Kv3.2c                      99   4e-19
gi|40737183|gb|AAR89082.1| shaker-like potassium channel [Callip...    98   5e-19
gi|9711573|dbj|BAB07847.1| voltage-dependent K channel [Sus scrofa]    97   8e-19
gi|48854478|ref|ZP_00308640.1| COG1226: Kef-type K+ transport sy...    96   3e-18
gi|46141646|ref|ZP_00204009.1| COG1226: Kef-type K+ transport sy...    96   3e-18
gi|5468520|gb|AAD43820.1| voltage-gated potassium channel isofor...    96   3e-18
gi|50731357|ref|XP_425662.1| PREDICTED: similar to Potassium vol...    96   3e-18
gi|9967389|dbj|BAB12398.1| voltage-dependent potassium channel [...    95   4e-18
gi|33337887|gb|AAQ13572.1| voltage-gated Kv1.3 potassium channel...    95   4e-18
gi|33590528|gb|AAQ22995.1| voltage-gated potassium channel, Shal...    95   5e-18
gi|46201458|ref|ZP_00054971.2| COG1226: Kef-type K+ transport sy...    94   9e-18
gi|50405239|ref|YP_054331.1| K+ channel, putative [Paramecium te...    93   2e-17
gi|28870782|ref|NP_793401.1| ion transport protein, putative [Ps...    92   3e-17
gi|46912722|emb|CAG19512.1| Putative potassium channel [Photobac...    91   8e-17
gi|29349894|ref|NP_813397.1| voltage-gated K+ channel protein [B...    91   1e-16
gi|5468521|gb|AAD43821.1| voltage-gated potassium channel isofor...    91   1e-16
gi|50085477|ref|YP_046987.1| putative potassium channel protein ...    91   1e-16
gi|48729526|ref|ZP_00263276.1| COG1226: Kef-type K+ transport sy...    90   2e-16
gi|41689524|ref|ZP_00146057.1| COG1226: Kef-type K+ transport sy...    89   2e-16
gi|37679357|ref|NP_933966.1| putative potassium channel protein ...    89   3e-16
gi|27366380|ref|NP_761908.1| Probable potassium channel [Vibrio ...    89   3e-16
gi|2137051|pir||I46855 voltage-gated potassium channel - rabbit ...    89   4e-16
gi|22997750|ref|ZP_00041977.1| COG1226: Kef-type K+ transport sy...    89   4e-16
gi|28198561|ref|NP_778875.1| ion transporter 33.9 kDa [Xylella f...    89   4e-16
gi|20090882|ref|NP_616957.1| potassium channel protein [Methanos...    89   4e-16
gi|15838027|ref|NP_298715.1| ion transporter [Xylella fastidiosa...    88   5e-16
gi|24637840|gb|AAN63887.1| potassium channel [Drosophila melanog...    88   7e-16
gi|15596693|ref|NP_250187.1| probable potassium channel [Pseudom...    88   7e-16
gi|25012477|gb|AAN71343.1| RE26469p [Drosophila melanogaster]          88   7e-16
gi|34499017|ref|NP_903232.1| probable ion transporter [Chromobac...    87   9e-16
gi|26990995|ref|NP_746420.1| cation transporter, VIC family [Pse...    87   1e-15
gi|28898897|ref|NP_798502.1| putative potassium channel [Vibrio ...    86   2e-15
gi|47191214|emb|CAF94881.1| unnamed protein product [Tetraodon n...    86   2e-15
gi|27436990|ref|NP_758529.1| potassium voltage-gated channel, su...    86   2e-15
gi|49083349|gb|AAT51009.1| PA1496 [synthetic construct]                86   2e-15
gi|19424124|ref|NP_597997.1| potassium voltage-gated channel, su...    86   3e-15
gi|48861391|ref|ZP_00315293.1| COG1226: Kef-type K+ transport sy...    86   3e-15
gi|39937293|ref|NP_949569.1| Cyclic nucleotide regulated K+ chan...    86   3e-15
gi|1575023|gb|AAB09438.1| potassium channel mKv3.2                     85   6e-15
gi|47168964|pdb|1S1G|A Chain A, Crystal Structure Of Kv4.3 T1 Do...    84   9e-15
gi|45552041|ref|NP_788300.2| CG33135-PA [Drosophila melanogaster...    84   9e-15
gi|45552039|ref|NP_788299.2| CG33135-PB [Drosophila melanogaster...    84   9e-15
gi|47207670|emb|CAF93764.1| unnamed protein product [Tetraodon n...    84   9e-15
gi|34810965|pdb|1NN7|A Chain A, Crystal Structure Of The Tetrame...    84   1e-14
gi|48768627|ref|ZP_00272976.1| COG1226: Kef-type K+ transport sy...    84   1e-14
gi|25147242|ref|NP_741819.1| potassium channel, KvQLT family (82...    83   2e-14
gi|25147238|ref|NP_741820.1| potassium channel, KvQLT family (77...    83   2e-14
gi|15805856|ref|NP_294554.1| ion transporter, putative [Deinococ...    83   2e-14
gi|34541624|ref|NP_906103.1| ion transporter [Porphyromonas ging...    83   2e-14
gi|7511689|pir||T34116 voltage-gated potassium channel klq-1 - C...    83   2e-14
gi|31217139|ref|XP_316369.1| ENSANGP00000004228 [Anopheles gambi...    83   2e-14
gi|39586721|emb|CAE65763.1| Hypothetical protein CBG10852 [Caeno...    83   2e-14
gi|45517076|ref|ZP_00168628.1| COG1226: Kef-type K+ transport sy...    82   4e-14
gi|45517078|ref|ZP_00168630.1| COG1226: Kef-type K+ transport sy...    82   4e-14
gi|45517074|ref|ZP_00168626.1| COG1226: Kef-type K+ transport sy...    82   4e-14
gi|46106887|ref|ZP_00200211.1| COG1226: Kef-type K+ transport sy...    81   8e-14
gi|23473800|ref|ZP_00129095.1| COG1226: Kef-type K+ transport sy...    81   8e-14
gi|21232712|ref|NP_638629.1| ion transporter [Xanthomonas campes...    79   2e-13
gi|21244155|ref|NP_643737.1| ion transporter [Xanthomonas axonop...    79   3e-13
gi|45513140|ref|ZP_00164706.1| COG1226: Kef-type K+ transport sy...    79   3e-13
gi|34494838|dbj|BAC85099.1| potassium channel, subfamily V, memb...    79   4e-13
gi|33862490|ref|NP_894050.1| possible potassium channel, VIC fam...    77   9e-13
gi|26333633|dbj|BAC30534.1| unnamed protein product [Mus musculus]     77   1e-12
gi|23121342|ref|ZP_00103672.1| COG1226: Kef-type K+ transport sy...    77   1e-12
gi|34871140|ref|XP_233477.2| similar to potassium voltage-gated ...    77   1e-12
gi|26638655|ref|NP_751895.1| potassium voltage-gated channel KQT...    77   1e-12
gi|26638653|ref|NP_004691.2| potassium voltage-gated channel KQT...    77   1e-12
gi|6166006|sp|P56696|CIQ4_HUMAN Potassium voltage-gated channel ...    77   1e-12
gi|38078783|ref|XP_143960.4| potassium voltage-gated channel, su...    77   1e-12
gi|8648988|emb|CAB94847.1| Kv4.2 voltage-gated potassium channel...    77   2e-12
gi|39591253|emb|CAE73306.1| Hypothetical protein CBG20733 [Caeno...    77   2e-12
gi|16760140|ref|NP_455757.1| possible membrane transport protein...    76   2e-12
gi|16765085|ref|NP_460700.1| putative voltage-gated potassium ch...    76   2e-12
gi|47211206|emb|CAF90163.1| unnamed protein product [Tetraodon n...    75   6e-12
gi|14285403|sp|Q9NR82|CIQ5_HUMAN Potassium voltage-gated channel...    75   6e-12
gi|8132997|gb|AAF73446.1| voltage-gated potassium channel KCNQ5 ...    75   6e-12
gi|50259918|gb|EAL22586.1| hypothetical protein CNBB4630 [Crypto...    75   6e-12
gi|33864687|ref|NP_896246.1| possible potassium channel, VIC fam...    75   6e-12
gi|46187362|ref|ZP_00205309.1| COG1226: Kef-type K+ transport sy...    75   6e-12
gi|28373065|ref|NP_062816.2| potassium voltage-gated channel, KQ...    75   6e-12
gi|9651967|gb|AAF91335.1| voltage-gated potassium channel [Homo ...    75   6e-12
gi|29791782|gb|AAH50689.1| Unknown (protein for IMAGE:6137109) [...    75   6e-12
gi|32564066|ref|NP_496875.2| potassium channel, KvQLT family (kq...    74   7e-12
gi|4176412|dbj|BAA37165.1| alternative splicing:see accession be...    74   1e-11


>gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW family
            of potassium channels (egl-36) [Caenorhabditis elegans]
 gi|7506376|pir||T23991 hypothetical protein R07A4.1 - Caenorhabditis
            elegans
 gi|3878927|emb|CAA91765.1| C. elegans EGL-36 protein (corresponding
            sequence R07A4.1) [Caenorhabditis elegans]
 gi|3879241|emb|CAA92011.1| Hypothetical protein R07A4.1
            [Caenorhabditis elegans]
          Length = 558

 Score =  973 bits (2515), Expect = 0.0
 Identities = 482/526 (91%), Positives = 482/526 (91%)
 Frame = +3

Query: 3    ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 182
            ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI
Sbjct: 33   ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 92

Query: 183  LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 362
            LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA
Sbjct: 93   LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 152

Query: 363  DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGXXXX 542
            DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAG
Sbjct: 153  DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVL 212

Query: 543  XXXXXXXXXCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 722
                     CLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF
Sbjct: 213  FIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 272

Query: 723  TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 902
            TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF
Sbjct: 273  TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 332

Query: 903  RLFKLTQHHQGLQILIHTFRASAKEXXXXXXXXXXXXXXXXXXXYYAEKMEANPNNQFQS 1082
            RLFKLTQHHQGLQILIHTFRASAKE                   YYAEKMEANPNNQFQS
Sbjct: 333  RLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQS 392

Query: 1083 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 1262
            IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN
Sbjct: 393  IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 452

Query: 1263 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQXXXXXXQAIRRRNMPILIDQNCCD 1442
            QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQ      QAIRRRNMPILIDQNCCD
Sbjct: 453  QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAIRRRNMPILIDQNCCD 512

Query: 1443 EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAXXXXXXS 1580
            EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETA      S
Sbjct: 513  EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAITTTIIS 558


>gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel alpha
            subunit [Caenorhabditis elegans]
          Length = 556

 Score =  969 bits (2506), Expect = 0.0
 Identities = 481/526 (91%), Positives = 481/526 (91%)
 Frame = +3

Query: 3    ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 182
            ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI
Sbjct: 31   ISMDERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMI 90

Query: 183  LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 362
            LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA
Sbjct: 91   LNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDA 150

Query: 363  DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGXXXX 542
            DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAG
Sbjct: 151  DHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVL 210

Query: 543  XXXXXXXXXCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 722
                     CLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF
Sbjct: 211  FIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQIEMLCNIWF 270

Query: 723  TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 902
            TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF
Sbjct: 271  TLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDVVEFLSMIRIF 330

Query: 903  RLFKLTQHHQGLQILIHTFRASAKEXXXXXXXXXXXXXXXXXXXYYAEKMEANPNNQFQS 1082
            RLFKLTQHHQGLQILIHTFRASAKE                   YYAEKMEANPNNQFQS
Sbjct: 331  RLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQS 390

Query: 1083 IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 1262
            IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN
Sbjct: 391  IPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHN 450

Query: 1263 QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQXXXXXXQAIRRRNMPILIDQNCCD 1442
            QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQ      QAIRRRNMPILIDQNCCD
Sbjct: 451  QARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAIRRRNMPILIDQNCCD 510

Query: 1443 EENHNHKHREKSENSDEGTNSSSTTGVDTVVKLGPSETAXXXXXXS 1580
            EENHNHK REKSENSDEGTNSSSTTGVDTVVKLGPSETA      S
Sbjct: 511  EENHNHKDREKSENSDEGTNSSSTTGVDTVVKLGPSETAITTTIIS 556




[DB home][top]