Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R07E4_7
(1005 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|15055409|gb|AAK82909.1| Protein kinase protein 2, isoform b [... 667 0.0
gi|39598139|emb|CAE68831.1| Hypothetical protein CBG14791 [Caeno... 640 0.0
gi|17569325|ref|NP_508999.1| cAMP-dependent protein kinase subun... 617 e-175
gi|279512|pir||OKKW1R protein kinase (EC 2.7.1.37), cAMP-depende... 613 e-174
gi|26418843|gb|AAN78131.1| cAMP-dependent protein kinase [Onchoc... 483 e-135
gi|50755469|ref|XP_414754.1| PREDICTED: similar to protein kinas... 377 e-103
gi|28574658|ref|NP_524189.2| CG3263-PB [Drosophila melanogaster]... 374 e-102
gi|28574654|ref|NP_730574.2| CG3263-PC [Drosophila melanogaster]... 374 e-102
gi|24667745|ref|NP_730576.1| CG3263-PD [Drosophila melanogaster]... 374 e-102
gi|279511|pir||OKFF1R protein kinase (EC 2.7.1.37), cAMP-depende... 372 e-102
gi|295743|emb|CAA34839.1| type I regulatory subunit [Drosophila ... 372 e-102
gi|1209410|emb|CAA34837.1| cAMP-dependent protein kinase [Drosop... 372 e-102
gi|125192|sp|P00514|KAP0_BOVIN cAMP-dependent protein kinase typ... 371 e-101
gi|38257139|ref|NP_002726.1| protein kinase, cAMP-dependent, reg... 370 e-101
gi|6981396|ref|NP_037313.1| protein kinase, cAMP dependent regul... 370 e-101
gi|22477876|gb|AAH36828.1| Unknown (protein for IMAGE:5247772) [... 370 e-101
gi|30794476|ref|NP_068680.1| protein kinase, cAMP dependent regu... 369 e-101
gi|400119|sp|P31319|KAPR_APLCA cAMP-dependent protein kinase reg... 369 e-101
gi|50757877|ref|XP_415689.1| PREDICTED: similar to cAMP-dependen... 369 e-101
gi|49523206|gb|AAH75186.1| Unknown (protein for MGC:82149) [Xeno... 369 e-101
gi|31217712|ref|XP_316486.1| ENSANGP00000014053 [Anopheles gambi... 369 e-101
gi|12859200|dbj|BAB31568.1| unnamed protein product [Mus musculus] 368 e-100
gi|1346362|sp|P31321|KAP1_HUMAN cAMP-dependent protein kinase ty... 368 e-100
gi|47939663|gb|AAH72038.1| MGC82406 protein [Xenopus laevis] >gn... 368 e-100
gi|307377|gb|AAC37564.1| cAMP-dependent protein kinase RI-beta r... 368 e-100
gi|4506063|ref|NP_002725.1| cAMP-dependent protein kinase, regul... 367 e-100
gi|1942960|pdb|1RGS| Regulatory Subunit Of Camp Dependent Prote... 367 e-100
gi|47522874|ref|NP_999191.1| cAMP-dependent protein kinase type ... 367 e-100
gi|125194|sp|P12849|KAP1_MOUSE cAMP-dependent protein kinase typ... 367 e-100
gi|31543509|ref|NP_032949.2| protein kinase, cAMP dependent regu... 366 e-100
gi|6016420|sp|P81377|KAP1_RAT cAMP-dependent protein kinase type... 366 e-100
gi|34871307|ref|XP_341043.1| similar to cAMP-dependent protein k... 366 e-100
gi|42543060|pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Bin... 365 e-100
gi|48106841|ref|XP_396167.1| similar to CG3263-PC [Apis mellifera] 364 1e-99
gi|279508|pir||OKHUR1 protein kinase (EC 2.7.1.37), cAMP-depende... 364 2e-99
gi|1661221|gb|AAB18412.1| cAMP-dependent protein kinase type I r... 343 3e-93
gi|26350511|dbj|BAC38895.1| unnamed protein product [Mus musculus] 342 1e-92
gi|47217998|emb|CAG11403.1| unnamed protein product [Tetraodon n... 314 2e-84
gi|47226045|emb|CAG04419.1| unnamed protein product [Tetraodon n... 301 1e-80
gi|125220|sp|P05987|KAPR_DICDI cAMP-dependent protein kinase reg... 281 2e-74
gi|400120|sp|P31320|KAPR_BLAEM cAMP-dependent protein kinase reg... 245 1e-63
gi|167190|gb|AAA33015.1| cAMP-dependent protein kinase regulator... 243 5e-63
gi|1199786|dbj|BAA11899.1| regulatory subunit of cAMP-dependent ... 243 5e-63
gi|47551027|ref|NP_999688.1| cyclic AMP-dependent protein kinase... 239 6e-62
gi|38678736|gb|AAR26367.1| PKA type II regulatory subunit [Aplys... 234 2e-60
gi|17647815|ref|NP_523671.1| CG15862-PA [Drosophila melanogaster... 230 3e-59
gi|15825180|gb|AAL09588.1| cAMP-dependent protein kinase regulat... 221 2e-56
gi|27374246|gb|AAO01005.1| Pka-R2-PA [Drosophila erecta] 221 3e-56
gi|50308263|ref|XP_454132.1| unnamed protein product [Kluyveromy... 220 5e-56
gi|29789096|ref|NP_062137.1| protein kinase, cAMP-dependent, reg... 219 6e-56
gi|20218852|emb|CAC81804.1| cAMP-dependent protein kinase A, reg... 219 6e-56
gi|45187774|ref|NP_983997.1| ADL099Cp [Eremothecium gossypii] >g... 219 1e-55
gi|50290093|ref|XP_447478.1| unnamed protein product [Candida gl... 219 1e-55
gi|32412358|ref|XP_326659.1| CAMP-DEPENDENT PROTEIN KINASE REGUL... 218 2e-55
gi|125201|sp|P12368|KAP2_RAT cAMP-dependent protein kinase type ... 218 2e-55
gi|4758958|ref|NP_004148.1| cAMP-dependent protein kinase, regul... 218 2e-55
gi|50728011|ref|XP_415950.1| PREDICTED: similar to HMG-box trans... 217 4e-55
gi|49095326|ref|XP_409124.1| KAPR_EMENI CAMP-DEPENDENT PROTEIN K... 216 5e-55
gi|22550094|ref|NP_032950.1| protein kinase, cAMP dependent regu... 216 5e-55
gi|34864232|ref|XP_343047.1| protein kinase, cAMP dependent regu... 216 7e-55
gi|279517|pir||OKRTR2 protein kinase (EC 2.7.1.37), cAMP-depende... 216 7e-55
gi|12698442|gb|AAK01548.1| cAMP-dependent protein kinase regulat... 215 1e-54
gi|400115|sp|P31323|KAP3_HUMAN cAMP-dependent protein kinase typ... 215 1e-54
gi|13569719|gb|AAK31209.1| cAMP-dependent protein kinase regulat... 215 1e-54
gi|125199|sp|P12367|KAP2_MOUSE cAMP-dependent protein kinase typ... 215 1e-54
gi|28913745|gb|AAH48710.1| Prkar2b protein [Mus musculus] 215 1e-54
gi|45598396|ref|NP_035288.2| protein kinase, cAMP dependent regu... 215 1e-54
gi|27807179|ref|NP_777074.1| cAMP-dependent protein kinase, regu... 214 2e-54
gi|46136785|ref|XP_390084.1| hypothetical protein FG09908.1 [Gib... 214 2e-54
gi|46847760|emb|CAG27571.1| cAMP-dependent protein kinase type I... 214 2e-54
gi|49904154|gb|AAH75800.1| CAMP-dependent protein kinase, regula... 214 3e-54
gi|47132585|ref|NP_002727.2| cAMP-dependent protein kinase, regu... 214 3e-54
gi|46249649|gb|AAH68931.1| MGC83177 protein [Xenopus laevis] 214 3e-54
gi|125197|sp|P00515|KAP2_BOVIN cAMP-dependent protein kinase typ... 213 4e-54
gi|6322156|ref|NP_012231.1| Regulatory subunit of the cyclic AMP... 213 6e-54
gi|11096028|gb|AAG30146.1| cAMP dependent protein kinase regulat... 213 7e-54
gi|13399443|pdb|1CX4|A Chain A, Crystal Structure Of A Deletion ... 212 9e-54
gi|50260536|gb|EAL23191.1| hypothetical protein CNBA5350 [Crypto... 212 9e-54
gi|21667390|gb|AAM74046.1| cAMP-dependent protein kinase regulat... 212 9e-54
gi|4303|emb|CAA28726.1| unnamed protein product [Saccharomyces c... 211 2e-53
gi|31212089|ref|XP_315029.1| ENSANGP00000022232 [Anopheles gambi... 211 3e-53
gi|49081280|ref|XP_404065.1| KAPR_USTMA cAMP-dependent protein k... 211 3e-53
gi|6225582|sp|O14448|KAPR_MAGGR cAMP-dependent protein kinase re... 209 6e-53
gi|13561052|emb|CAC36308.1| cAMP dependent protein kinase regula... 207 2e-52
gi|50555167|ref|XP_504992.1| hypothetical protein [Yarrowia lipo... 205 2e-51
gi|23491509|gb|EAA23025.1| putative cAMP-dependent protein kinas... 204 2e-51
gi|28194220|gb|AAO33461.1| cAMP-dependent protein kinase regulat... 204 2e-51
gi|7271929|gb|AAF44694.1| cAMP-dependent protein kinase regulato... 203 4e-51
gi|50754475|ref|XP_414401.1| PREDICTED: similar to protein kinas... 202 8e-51
gi|47085741|ref|NP_998123.1| hypothetical protein zgc:85886 [Dan... 202 1e-50
gi|11596393|gb|AAG38599.1| cAMP-dependent protein kinase regulat... 201 2e-50
gi|46441283|gb|EAL00581.1| hypothetical protein CaO19.2015 [Cand... 201 2e-50
gi|1346365|sp|P49605|KAPR_USTMA cAMP-dependent protein kinase re... 199 1e-49
gi|1513244|gb|AAC47268.1| 44 kDa regulatory subunit of cAMP-depe... 197 2e-49
gi|50405533|ref|XP_456402.1| unnamed protein product [Debaryomyc... 197 3e-49
gi|11991498|emb|CAC19660.1| PKA regulatory subunit [Blumeria gra... 197 4e-49
gi|30585317|gb|AAP36931.1| Homo sapiens protein kinase, cAMP-dep... 195 1e-48
gi|12803843|gb|AAH02763.1| PRKAR2A protein [Homo sapiens] >gnl|B... 195 1e-48
gi|5531239|emb|CAB51033.1| cAMP-dependent protein kinase regulat... 194 2e-48
gi|23508916|ref|NP_701584.1| cAMP-dependent protein kinase regul... 194 2e-48
gi|47220475|emb|CAG03255.1| unnamed protein product [Tetraodon n... 192 1e-47
gi|6002552|gb|AAF00035.1| cAMP-dependent protein kinase subunit ... 186 6e-46
gi|47224459|emb|CAG08709.1| unnamed protein product [Tetraodon n... 182 8e-45
gi|337358|gb|AAA60266.1| RET tyrosine kinase/cAMP protein kinase... 179 1e-43
gi|3676837|gb|AAC62114.1| cAMP-dependent protein kinase regulato... 177 3e-43
gi|47229664|emb|CAG06860.1| unnamed protein product [Tetraodon n... 176 8e-43
gi|19115186|ref|NP_594274.1| camp-dependent protein kinase regul... 172 8e-42
gi|7490178|pir||T39140 camp-dependent protein kinase regulatory ... 172 8e-42
gi|12232084|gb|AAG49384.1| regulatory subunit of protein kinase ... 170 4e-41
gi|10441122|gb|AAG16958.1| protein kinase A regulatory subunit [... 169 1e-40
gi|101017|pir||S18634 cgs1 protein - fission yeast (Schizosaccha... 165 1e-39
gi|8546862|emb|CAB94718.1| cAMP-dependent protein kinase regulat... 163 5e-39
gi|47228582|emb|CAG05402.1| unnamed protein product [Tetraodon n... 163 7e-39
gi|157224|gb|AAA28459.1| cGMP-dependent protein kinase 157 3e-37
gi|2134904|pir||S68217 protein kinase (EC 2.7.1.37) II, cGMP-dep... 157 3e-37
gi|5453978|ref|NP_006250.1| protein kinase, cGMP-dependent, type... 157 3e-37
gi|20455504|sp|Q03043|KGP2_DROME cGMP-dependent protein kinase, ... 157 3e-37
gi|6225586|sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 ... 157 4e-37
gi|18643252|gb|AAL76257.1| PKG-II [Bombyx mori] 157 5e-37
gi|18643248|gb|AAL76255.1| PKG-Ib [Bombyx mori] >gnl|BL_ORD_ID|8... 157 5e-37
gi|3123587|emb|CAA76073.1| cGMP-dependant protein kinase [Homo s... 157 5e-37
gi|44886086|dbj|BAD12117.1| cGMP-dependent protein kinase I alph... 156 8e-37
gi|17137764|ref|NP_477487.1| CG10033-PA [Drosophila melanogaster... 155 1e-36
gi|17137766|ref|NP_477488.1| CG10033-PB [Drosophila melanogaster... 155 1e-36
gi|44886088|dbj|BAD12118.1| cGMP-dependent protein kinase I beta... 155 2e-36
gi|2827754|sp|P21136|KGPB_BOVIN cGMP-dependent protein kinase 1,... 155 2e-36
gi|26332803|dbj|BAC30119.1| unnamed protein product [Mus musculus] 154 2e-36
gi|6981402|ref|NP_037144.1| protein kinase, cGMP- dependent, typ... 154 2e-36
gi|31982097|ref|NP_032952.2| protein kinase, cGMP-dependent, typ... 154 2e-36
gi|6755156|ref|NP_035290.1| protein kinase, cGMP-dependent, type... 154 3e-36
gi|33304009|gb|AAQ02512.1| protein kinase, cGMP-dependent, type ... 154 4e-36
gi|10835242|ref|NP_006249.1| protein kinase, cGMP-dependent, typ... 154 4e-36
gi|28195111|gb|AAO33766.1| protein kinase A regulatory subunit [... 152 2e-35
gi|27806091|ref|NP_776861.1| protein kinase, cGMP-dependent, typ... 149 8e-35
gi|41471204|gb|AAS07389.1| unknown [Homo sapiens] 149 1e-34
gi|26350901|dbj|BAC39087.1| unnamed protein product [Mus musculus] 149 1e-34
gi|47213374|emb|CAF90993.1| unnamed protein product [Tetraodon n... 148 2e-34
gi|6225588|sp|Q13976|KGPA_HUMAN cGMP-dependent protein kinase 1,... 148 2e-34
gi|11230987|dbj|BAB18105.1| cyclic nucreotide dependent protein ... 148 2e-34
gi|49119397|gb|AAH72999.1| Unknown (protein for MGC:82580) [Xeno... 146 6e-34
gi|20502826|gb|AAM22643.1| cGMP-dependent protein kinase [Eimeri... 145 1e-33
gi|41054123|ref|NP_957324.1| similar to protein kinase, cGMP-dep... 145 2e-33
gi|9663391|emb|CAB95241.2| cAMP-dependent protein kinase A regul... 145 2e-33
gi|6225589|sp|O77676|KGPA_RABIT cGMP-dependent protein kinase 1,... 144 3e-33
gi|23509568|ref|NP_702235.1| cGMP-dependent protein kinase 1, be... 144 4e-33
gi|20378272|gb|AAM20901.1| cGMP-dependent protein kinase [Toxopl... 144 4e-33
gi|20530638|gb|AAM27174.1| cGMP dependent protein kinase [Toxopl... 143 5e-33
gi|48103903|ref|XP_392905.1| similar to cAMP-dependent protein k... 141 2e-32
gi|1401293|gb|AAB03405.1| cGMP-dependent protein kinase [Drosoph... 141 3e-32
gi|39583741|emb|CAE63845.1| Hypothetical protein CBG08401 [Caeno... 140 4e-32
gi|17137294|ref|NP_477213.1| CG3324-PA [Drosophila melanogaster]... 140 4e-32
gi|50746847|ref|XP_426309.1| PREDICTED: similar to protein kinas... 140 6e-32
gi|19698423|gb|AAL93136.1| cGMP-dependent protein kinase foragin... 140 6e-32
gi|11230985|dbj|BAB18104.1| cyclic nucleotide dependent protein ... 139 1e-31
gi|47223227|emb|CAF98611.1| unnamed protein product [Tetraodon n... 138 2e-31
gi|6225580|sp|O42794|KAPR_COLTR cAMP-dependent protein kinase re... 138 2e-31
gi|37964177|gb|AAR06171.1| PKG [Aplysia californica] 136 9e-31
gi|38571600|gb|AAH62688.1| Protein kinase, cGMP-dependent, type ... 135 1e-30
gi|31233522|ref|XP_318891.1| ENSANGP00000015733 [Anopheles gambi... 135 1e-30
gi|17539608|ref|NP_500141.1| EGg Laying defective EGL-4, ODoRant... 135 2e-30
gi|17539610|ref|NP_500142.1| EGg Laying defective EGL-4, ODoRant... 135 2e-30
gi|25145047|ref|NP_741329.1| EGg Laying defective EGL-4, ODoRant... 135 2e-30
gi|19921038|ref|NP_609349.1| CG4839-PA [Drosophila melanogaster]... 131 3e-29
gi|48095348|ref|XP_394420.1| similar to ENSANGP00000015733 [Apis... 130 4e-29
gi|31211441|ref|XP_314690.1| ENSANGP00000013014 [Anopheles gambi... 130 5e-29
gi|29120038|emb|CAD79354.1| cGMP-dependent protein kinase [Param... 129 8e-29
gi|47227625|emb|CAG09622.1| unnamed protein product [Tetraodon n... 129 8e-29
gi|20378274|gb|AAM20902.1| cGMP-dependent protein kinase [Crypto... 129 8e-29
gi|20378270|gb|AAM20900.1| cGMP-dependent protein kinase [Eimeri... 128 2e-28
gi|1071847|pir||S05035 protein kinase (EC 2.7.1.37), cGMP-depend... 127 5e-28
gi|214|emb|CAA38184.1| unnamed protein product [Bos taurus] >gnl... 127 5e-28
gi|50405190|ref|YP_054282.1| cGMP-dependent protein kinase, puta... 125 2e-27
gi|2642296|gb|AAC23588.1| cyclic GMP-dependent protein kinase [H... 123 8e-27
gi|31237424|ref|XP_319605.1| ENSANGP00000006403 [Anopheles gambi... 121 3e-26
gi|25012677|gb|AAN71433.1| RE54985p [Drosophila melanogaster] 121 3e-26
gi|23489825|gb|EAA21741.1| cGMP-dependent protein kinase-related... 120 6e-26
gi|103328|pir||D34106 protein kinase (EC 2.7.1.37), cGMP-depende... 119 1e-25
gi|20532399|sp|P32023|KGP3_DROME cGMP-dependent protein kinase, ... 119 1e-25
gi|157214|gb|AAA28456.1| cGMP-dependent protein kinase >gnl|BL_O... 118 2e-25
gi|103326|pir||C34106 protein kinase (EC 2.7.1.37), cGMP-depende... 118 2e-25
gi|7512016|pir||T08418 protein kinase (EC 2.7.1.37), cGMP-depend... 117 4e-25
gi|157220|gb|AAA28457.1| cGMP-dependent protein kinase 116 9e-25
gi|17137768|ref|NP_477489.1| CG10033-PC [Drosophila melanogaster... 116 9e-25
gi|17137770|ref|NP_477490.1| CG10033-PE [Drosophila melanogaster... 114 3e-24
gi|47224315|emb|CAG09161.1| unnamed protein product [Tetraodon n... 114 5e-24
gi|29249329|gb|EAA40843.1| GLP_154_38670_37288 [Giardia lamblia ... 112 1e-23
gi|34495201|emb|CAE30452.1| cAMP-dependent protein kinase regula... 110 7e-23
gi|29120036|emb|CAD79353.1| cGMP-dependent protein kinase [Param... 109 1e-22
gi|15082052|gb|AAK84005.1| cAMP-dependant protein kinase [Aedes ... 107 4e-22
gi|48104111|ref|XP_395717.1| similar to cGMP-dependent protein k... 102 1e-20
gi|25145007|ref|NP_741467.1| mp-dependent protein kinase (70.9 k... 102 2e-20
gi|50660932|gb|AAT81143.1| cGMP-dependent protein kinase [Chlamy... 98 3e-19
gi|47848555|dbj|BAD22406.1| putative PKG-Ib [Oryza sativa (japon... 97 8e-19
gi|25145050|ref|NP_741330.1| EGg Laying defective EGL-4, ODoRant... 89 1e-16
gi|25528278|pir||D88640 protein F55A8.2 [imported] - Caenorhabdi... 89 2e-16
gi|47198534|emb|CAF87941.1| unnamed protein product [Tetraodon n... 88 4e-16
gi|280894|pir||A25652 protein kinase (EC 2.7.1.37), cAMP-depende... 86 2e-15
gi|47523592|ref|NP_999423.1| cAMP-dependent protein kinase regul... 86 2e-15
gi|39588816|emb|CAE69446.1| Hypothetical protein CBG15634 [Caeno... 84 4e-15
gi|7495764|pir||T29830 hypothetical protein C09G4.2 - Caenorhabd... 84 4e-15
gi|25144999|ref|NP_741468.1| mp-dependent protein kinase (67.0 k... 84 4e-15
gi|34875246|ref|XP_343979.1| similar to cAMP-dependent protein k... 84 7e-15
gi|47125481|gb|AAH70478.1| Unknown (protein for MGC:90521) [Homo... 84 7e-15
gi|6002556|gb|AAF00037.1| cAMP-dependent protein kinase subunit ... 80 1e-13
gi|19173420|ref|NP_597223.1| cAMP-DEPENDENT PROTEIN KINASE TYPE ... 77 6e-13
gi|22973118|ref|ZP_00019961.1| hypothetical protein [Chloroflexu... 76 1e-12
gi|6002554|gb|AAF00036.1| cAMP-dependent protein kinase subunit ... 72 2e-11
gi|47220401|emb|CAG03181.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|46434896|gb|EAK94292.1| hypothetical protein CaO19.3720 [Cand... 72 3e-11
gi|2995608|gb|AAC08318.1| CAMP-DEPENDENT PROTEIN KINASE TYPE II-... 69 1e-10
gi|16332316|ref|NP_443044.1| cAMP protein kinase regulatory chai... 68 4e-10
gi|48850133|ref|ZP_00304375.1| COG0492: Thioredoxin reductase [N... 68 4e-10
gi|50554939|ref|XP_504878.1| hypothetical protein [Yarrowia lipo... 67 8e-10
gi|45507938|ref|ZP_00160279.1| COG1136: ABC-type antimicrobial p... 65 2e-09
gi|31199133|ref|XP_308514.1| ENSANGP00000009529 [Anopheles gambi... 65 2e-09
gi|23127862|ref|ZP_00109721.1| COG0664: cAMP-binding proteins - ... 64 4e-09
gi|47216444|emb|CAG01995.1| unnamed protein product [Tetraodon n... 63 9e-09
gi|22298372|ref|NP_681619.1| ORF_ID:tlr0829~hypothetical protein... 63 9e-09
gi|50806715|ref|XP_424494.1| PREDICTED: similar to cAMP-regulate... 62 3e-08
gi|46250001|gb|AAH68477.1| RAPGEF3 protein [Homo sapiens] 61 4e-08
gi|3978531|gb|AAC83381.1| Rap1 guanine-nucleotide exchange facto... 61 4e-08
gi|20070215|ref|NP_006096.2| RAP guanine-nucleotide-exchange fac... 61 4e-08
gi|24586077|ref|NP_724498.1| CG3427-PA [Drosophila melanogaster]... 61 4e-08
gi|8745509|gb|AAF78942.1| cAMP-dependent protein kinase regulato... 61 5e-08
gi|15842828|ref|NP_337865.1| drug transporter [Mycobacterium tub... 61 5e-08
gi|31794419|ref|NP_856912.1| PROBABLE CONSERVED TRANSMEMBRANE TR... 61 5e-08
gi|15610375|ref|NP_217756.1| hypothetical protein Rv3239c [Mycob... 61 5e-08
gi|45708619|gb|AAH40534.1| RAPGEF3 protein [Homo sapiens] 61 5e-08
gi|34497785|ref|NP_902000.1| conserved hypothetical protein [Chr... 61 5e-08
gi|24214629|ref|NP_712110.1| cAMP-dependent protein kinase regul... 61 5e-08
gi|17554418|ref|NP_499256.1| PDZ domain-containing guanine nucle... 60 6e-08
gi|630650|pir||S42368 guanine nucleotide releasing factor homolo... 60 6e-08
gi|11067419|ref|NP_067722.1| cAMP-regulated guanine nucleotide e... 60 8e-08
gi|50750555|ref|XP_426579.1| PREDICTED: similar to cAMP-regulate... 60 8e-08
gi|41406180|ref|NP_959016.1| hypothetical protein MAP0082 [Mycob... 60 8e-08
gi|47218090|emb|CAG09962.1| unnamed protein product [Tetraodon n... 60 8e-08
gi|42528225|ref|NP_973323.1| cyclic nucleotide binding domain/GG... 60 1e-07
gi|21450061|ref|NP_659099.1| Rap1 guanine-nucleotide-exchange fa... 60 1e-07
gi|15828234|ref|NP_302497.1| putative Crp/Fnr-family transcripti... 59 1e-07
gi|4079649|gb|AAD12740.1| cAMP-regulated guanine nucleotide exch... 59 1e-07
gi|4079651|gb|AAD02890.1| cAMP-regulated guanine nucleotide exch... 59 1e-07
gi|50293683|ref|XP_449253.1| unnamed protein product [Candida gl... 59 2e-07
gi|22974271|ref|ZP_00020578.1| hypothetical protein [Chloroflexu... 59 2e-07
gi|32472694|ref|NP_865688.1| ATP-binding subunit of ABC transpor... 59 2e-07
gi|42495700|gb|AAS17952.1| putative transcriptional regulator CR... 59 2e-07
gi|42495698|gb|AAS17951.1| putative transcriptional regulator CR... 59 2e-07
gi|15610812|ref|NP_218193.1| hypothetical protein Rv3676 [Mycoba... 59 2e-07
gi|25455682|gb|AAH40183.1| RAPGEF4 protein [Homo sapiens] 59 2e-07
gi|34855185|ref|XP_215985.2| similar to cAMP-GEFII [Rattus norve... 59 2e-07
gi|12836387|dbj|BAB23633.1| unnamed protein product [Mus musculus] 59 2e-07
gi|17061829|dbj|BAB72180.1| cAMP-GEFII [Mus musculus] 59 2e-07
gi|9790087|ref|NP_062662.1| cAMP-regulated guanine nucleotide ex... 59 2e-07
gi|27574262|pdb|1O7F|A Chain A, Crystal Structure Of The Regulat... 59 2e-07
gi|5901914|ref|NP_008954.1| Rap guanine nucleotide exchange fact... 59 2e-07
gi|32171491|sp|Q8WZA2|EPC2_HUMAN cAMP-regulated guanine nucleoti... 59 2e-07
gi|18645151|gb|AAH24004.1| Rap guanine nucleotide exchange facto... 59 2e-07
gi|32171510|sp|Q9EQZ6|RGE4_MOUSE RAP guanine-nucleotide-exchange... 59 2e-07
gi|23509394|ref|NP_702061.1| hypothetical protein [Plasmodium fa... 58 3e-07
gi|45511711|ref|ZP_00163278.1| COG0664: cAMP-binding proteins - ... 58 4e-07
gi|41406496|ref|NP_959332.1| hypothetical protein MAP0398c [Myco... 58 4e-07
gi|39590597|emb|CAE64967.1| Hypothetical protein CBG09801 [Caeno... 57 5e-07
gi|42495706|gb|AAS17955.1| putative transcriptional regulator CR... 57 7e-07
gi|31791282|ref|NP_853775.1| CONSERVED HYPOTHETICAL PROTEIN [Myc... 57 7e-07
gi|46201222|ref|ZP_00055505.2| COG0664: cAMP-binding proteins - ... 57 9e-07
gi|34862800|ref|XP_345020.1| similar to cGMP kinase type I alpha... 57 9e-07
gi|21221989|ref|NP_627768.1| putative transcriptional regulator ... 57 9e-07
gi|23014515|ref|ZP_00054327.1| COG2200: FOG: EAL domain [Magneto... 57 9e-07
gi|45190729|ref|NP_984983.1| AER124Wp [Eremothecium gossypii] >g... 56 1e-06
gi|15607246|ref|NP_214618.1| hypothetical protein Rv0104 [Mycoba... 56 1e-06
gi|45657083|ref|YP_001169.1| cyclic nucleotide binding patatin-l... 56 1e-06
gi|24215532|ref|NP_713013.1| unknown protein [Leptospira interro... 56 1e-06
gi|17230422|ref|NP_486970.1| hypothetical protein [Nostoc sp. PC... 55 2e-06
gi|48863625|ref|ZP_00317519.1| COG0664: cAMP-binding proteins - ... 55 3e-06
gi|24216071|ref|NP_713552.1| probable cyclic nucleotide binding ... 55 3e-06
gi|27381171|ref|NP_772700.1| bll6060 [Bradyrhizobium japonicum U... 55 3e-06
gi|23509393|ref|NP_702060.1| hypothetical protein [Plasmodium fa... 55 3e-06
gi|45506906|ref|ZP_00159255.1| COG0664: cAMP-binding proteins - ... 55 3e-06
gi|23129025|ref|ZP_00110859.1| COG0845: Membrane-fusion protein ... 55 3e-06
gi|47212701|emb|CAF92368.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|23481091|gb|EAA17473.1| reticulocyte-binding protein 2 homolo... 54 4e-06
gi|50303609|ref|XP_451746.1| unnamed protein product [Kluyveromy... 54 4e-06
gi|46202091|ref|ZP_00053792.2| COG0664: cAMP-binding proteins - ... 54 4e-06
gi|13472836|ref|NP_104403.1| hypothetical protein, contains simi... 54 7e-06
gi|29831135|ref|NP_825769.1| putative cyclic nucleotide-binding ... 54 7e-06
gi|45525825|ref|ZP_00177046.1| COG0664: cAMP-binding proteins - ... 54 7e-06
gi|17228530|ref|NP_485078.1| transcriptional regulator [Nostoc s... 54 7e-06
gi|23014973|ref|ZP_00054765.1| COG0664: cAMP-binding proteins - ... 54 7e-06
gi|24213009|ref|NP_710490.1| cAMP-dependent protein kinase regul... 54 7e-06
gi|48863346|ref|ZP_00317240.1| COG0664: cAMP-binding proteins - ... 53 1e-05
gi|50413785|ref|XP_457315.1| unnamed protein product [Debaryomyc... 53 1e-05
gi|26332605|dbj|BAC30020.1| unnamed protein product [Mus musculus] 53 1e-05
gi|46134984|ref|ZP_00162213.2| COG0664: cAMP-binding proteins - ... 53 1e-05
gi|31542202|ref|NP_666363.2| cDNA sequence BC027342 [Mus musculu... 53 1e-05
gi|47217997|emb|CAG11402.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|41147674|ref|XP_374382.1| similar to cAMP-dependent protein k... 53 1e-05
gi|19343904|gb|AAH25621.1| BC027342 protein [Mus musculus] 53 1e-05
gi|38232924|ref|NP_938691.1| Putative transcription regulator [C... 53 1e-05
gi|15618214|ref|NP_224499.1| cAMP-Dependent Protein Kinase Regul... 52 2e-05
gi|22974809|ref|ZP_00020946.1| hypothetical protein [Chloroflexu... 52 2e-05
gi|41725242|ref|ZP_00152000.1| COG0664: cAMP-binding proteins - ... 52 2e-05
gi|41147535|ref|XP_373224.1| similar to cAMP-dependent protein k... 52 2e-05
gi|25026843|ref|NP_736897.1| putative regulatory protein [Coryne... 52 2e-05
gi|17936453|ref|NP_533243.1| cAMP-dependent protein kinase regul... 52 3e-05
gi|15889835|ref|NP_355516.1| AGR_C_4670p [Agrobacterium tumefaci... 52 3e-05
gi|48862113|ref|ZP_00316011.1| COG0664: cAMP-binding proteins - ... 52 3e-05
gi|9955728|emb|CAC05488.1| outward rectifying potassium channel ... 51 4e-05
gi|6323581|ref|NP_013652.1| Serine esterase that deacylates exog... 51 4e-05
gi|19551541|ref|NP_599543.1| cAMP-binding domain containing prot... 51 4e-05
gi|18031839|gb|AAL06059.1| cGMP-stimulated cGMP phosphodiesteras... 51 5e-05
gi|47229220|emb|CAG03972.1| unnamed protein product [Tetraodon n... 51 5e-05
gi|42524131|ref|NP_969511.1| hyperpolarization-activated, cyclic... 51 5e-05
gi|48131037|ref|XP_393323.1| cGMP-dependent protein kinase forag... 50 6e-05
gi|19912867|dbj|BAB88663.1| hypothetical protein [Corynebacteriu... 50 8e-05
gi|41725713|ref|ZP_00152471.1| COG0659: Sulfate permease and rel... 50 8e-05
gi|48890778|ref|ZP_00324396.1| COG0642: Signal transduction hist... 50 1e-04
gi|23129906|ref|ZP_00111727.1| COG0664: cAMP-binding proteins - ... 50 1e-04
gi|16332176|ref|NP_442904.1| hypothetical protein [Synechocystis... 50 1e-04
gi|16332334|ref|NP_443062.1| unknown protein [Synechocystis sp. ... 49 1e-04
gi|23129024|ref|ZP_00110858.1| COG1012: NAD-dependent aldehyde d... 49 2e-04
gi|27376358|ref|NP_767887.1| blr1247 [Bradyrhizobium japonicum U... 49 2e-04
gi|32451773|gb|AAH54789.1| Nte protein [Mus musculus] >gnl|BL_OR... 49 2e-04
gi|22969837|ref|ZP_00017053.1| hypothetical protein [Chloroflexu... 49 2e-04
gi|7657401|ref|NP_056616.1| neuropathy target esterase; Swiss ch... 49 2e-04
gi|13472825|ref|NP_104392.1| hypothetical protein, similar to po... 49 2e-04
gi|20073171|gb|AAH27204.1| 4921517L17Rik protein [Mus musculus] 49 2e-04
gi|16264522|ref|NP_437314.1| putative transcriptional regulator ... 49 2e-04
gi|49900126|gb|AAH75727.1| Unknown (protein for MGC:78281) [Mus ... 49 2e-04
gi|38075215|ref|XP_130609.3| RIKEN cDNA 4921517L17 [Mus musculus] 49 2e-04
gi|48832050|ref|ZP_00289094.1| COG0664: cAMP-binding proteins - ... 49 2e-04
gi|25090006|sp|Q9D5U8|CTFX_MOUSE Protein C20orf152 homolog 49 2e-04
gi|48787021|ref|ZP_00283103.1| COG0668: Small-conductance mechan... 48 3e-04
gi|46202730|ref|ZP_00052699.2| COG0642: Signal transduction hist... 48 3e-04
gi|49069112|ref|XP_398845.1| hypothetical protein UM01230.1 [Ust... 48 3e-04
gi|50757578|ref|XP_425345.1| PREDICTED: similar to cDNA sequence... 48 3e-04
gi|32418576|ref|XP_329766.1| hypothetical protein [Neurospora cr... 48 4e-04
gi|2982501|emb|CAA06164.1| neuropathy target esterase [Homo sapi... 48 4e-04
gi|31543299|ref|NP_006693.2| neuropathy target esterase [Homo sa... 48 4e-04
gi|48731771|ref|ZP_00265515.1| COG0668: Small-conductance mechan... 48 4e-04
gi|15607215|ref|NP_214587.1| hypothetical protein Rv0073 [Mycoba... 48 4e-04
gi|37515235|gb|AAM98011.2| Egg laying defective protein 4, isofo... 47 5e-04
gi|50772322|ref|XP_423161.1| PREDICTED: similar to neuropathy ta... 47 5e-04
gi|45684345|ref|ZP_00195776.1| COG0664: cAMP-binding proteins - ... 47 5e-04
gi|31203357|ref|XP_310627.1| ENSANGP00000020064 [Anopheles gambi... 47 5e-04
gi|31198195|ref|XP_308045.1| ENSANGP00000006339 [Anopheles gambi... 47 5e-04
gi|3970750|emb|CAA10110.1| cyclic nucleotide and voltage-activat... 47 5e-04
gi|48096555|ref|XP_392484.1| hyperpolarization-activated ion cha... 47 5e-04
gi|38524589|ref|NP_689499.2| chromosome 9 open reading frame 111... 47 5e-04
gi|33355927|gb|AAQ16312.1| hyperpolarization-activated ion chann... 47 5e-04
gi|15609701|ref|NP_217080.1| glnQ [Mycobacterium tuberculosis H3... 47 5e-04
gi|27379909|ref|NP_771438.1| bll4798 [Bradyrhizobium japonicum U... 47 7e-04
gi|38605636|sp|O60741|HCN1_HUMAN Potassium/sodium hyperpolarizat... 47 7e-04
gi|46107866|ref|XP_380992.1| hypothetical protein FG00816.1 [Gib... 47 7e-04
gi|24653608|ref|NP_610949.2| CG8585-PA [Drosophila melanogaster]... 47 7e-04
gi|33355925|gb|AAQ16311.1| hyperpolarization-activated ion chann... 47 7e-04
gi|25012387|gb|AAN71302.1| RE10840p [Drosophila melanogaster] 47 7e-04
gi|16125661|ref|NP_420225.1| transcriptional regulator, putative... 47 7e-04
gi|3168874|gb|AAC39759.1| ion channel BCNG-1 [Homo sapiens] 47 7e-04
gi|5326833|gb|AAD42059.1| putative voltage- and cyclic nucleotid... 47 7e-04
gi|12852742|dbj|BAB29519.1| unnamed protein product [Mus musculus] 47 7e-04
gi|38605639|sp|Q9MZS1|HCN1_RABIT Potassium/sodium hyperpolarizat... 47 7e-04
gi|16758108|ref|NP_445827.1| hyperpolarization-activated, cyclic... 47 7e-04
gi|29840778|sp|O88704|HCN1_MOUSE Potassium/sodium hyperpolarizat... 47 7e-04
gi|6754168|ref|NP_034538.1| hyperpolarization-activated, cyclic ... 47 7e-04
gi|32698746|ref|NP_066550.1| hyperpolarization activated cyclic ... 47 9e-04
gi|33864413|ref|NP_895973.1| possible mechanosensitive ion chann... 47 9e-04
gi|34860264|ref|XP_215902.2| similar to 4921517L17Rik protein [R... 47 9e-04
gi|48728456|ref|ZP_00262217.1| COG0664: cAMP-binding proteins - ... 47 9e-04
gi|47220545|emb|CAG05571.1| unnamed protein product [Tetraodon n... 47 9e-04
gi|38106746|gb|EAA53015.1| hypothetical protein MG06143.4 [Magna... 47 9e-04
gi|46365250|ref|ZP_00227752.1| COG0664: cAMP-binding proteins - ... 47 9e-04
gi|31792861|ref|NP_855354.1| PROBABLE TRANSCRIPTIONAL REGULATORY... 46 0.001
gi|48834378|ref|ZP_00291393.1| COG0659: Sulfate permease and rel... 46 0.001
gi|42523448|ref|NP_968828.1| hypothetical protein Bd1971 [Bdello... 46 0.001
gi|42523009|ref|NP_968389.1| putative cAMP-dependent protein kin... 46 0.001
gi|48835206|ref|ZP_00292207.1| COG0664: cAMP-binding proteins - ... 46 0.001
gi|23398599|gb|AAH38229.1| neuropathy target esterase [Homo sapi... 46 0.001
gi|22970946|ref|ZP_00017957.1| hypothetical protein [Chloroflexu... 46 0.001
gi|16331729|ref|NP_442457.1| hypothetical protein [Synechocystis... 46 0.001
gi|47572547|ref|ZP_00242590.1| COG0664: cAMP-binding proteins - ... 46 0.001
gi|49094372|ref|XP_408647.1| hypothetical protein AN4510.2 [Aspe... 46 0.001
gi|47216170|emb|CAG03158.1| unnamed protein product [Tetraodon n... 46 0.002
gi|27375922|ref|NP_767451.1| bll0811 [Bradyrhizobium japonicum U... 46 0.002
gi|29840776|sp|O70507|HCN4_MOUSE Potassium/sodium hyperpolarizat... 46 0.002
gi|23014934|ref|ZP_00054727.1| COG0664: cAMP-binding proteins - ... 46 0.002
gi|15639083|ref|NP_218529.1| cyclic nucleotide binding protein [... 46 0.002
gi|50761639|ref|XP_429145.1| PREDICTED: similar to Potassium/sod... 46 0.002
gi|48892124|ref|ZP_00325536.1| COG0664: cAMP-binding proteins - ... 46 0.002
gi|47185111|emb|CAF95008.1| unnamed protein product [Tetraodon n... 46 0.002
gi|46119975|ref|ZP_00179251.2| COG3264: Small-conductance mechan... 46 0.002
gi|50752723|ref|XP_425050.1| PREDICTED: similar to hyperpolariza... 45 0.002
gi|45478094|gb|AAS66218.1| LRRGT00127 [Rattus norvegicus] 45 0.002
gi|15608813|ref|NP_216191.1| hypothetical protein Rv1675c [Mycob... 45 0.002
gi|15843349|ref|NP_338386.1| drug transporter [Mycobacterium tub... 45 0.002
gi|45190750|ref|NP_985004.1| AER145Wp [Eremothecium gossypii] >g... 45 0.002
gi|38089858|ref|XP_287905.2| similar to hyperpolarization-activa... 45 0.002
gi|31794900|ref|NP_857393.1| PROBABLE CONSERVED TWO-DOMAIN MEMBR... 45 0.002
gi|15610864|ref|NP_218245.1| hypothetical protein Rv3728 [Mycoba... 45 0.002
gi|49074550|ref|XP_401401.1| hypothetical protein UM03786.1 [Ust... 45 0.002
gi|48788828|ref|ZP_00284807.1| COG2274: ABC-type bacteriocin/lan... 45 0.002
gi|30249275|ref|NP_841345.1| Cyclic nucleotide-binding domain:cA... 45 0.002
gi|47551101|ref|NP_999729.1| hyperpolarization-activated (Ih) ch... 45 0.002
gi|790610|gb|AAA65649.1| unknown 45 0.002
gi|25742571|ref|NP_067690.1| hyperpolarization-activated, cyclic... 45 0.002
gi|17229817|ref|NP_486365.1| transcriptional regulator [Nostoc s... 45 0.002
gi|48833642|ref|ZP_00290659.1| COG0664: cAMP-binding proteins - ... 45 0.002
gi|5734516|emb|CAB52754.1| hyperpolarization-activated channel t... 45 0.002
gi|4885407|ref|NP_005468.1| hyperpolarization activated cyclic n... 45 0.002
gi|38605640|sp|Q9TV66|HCN4_RABIT Potassium/sodium hyperpolarizat... 45 0.002
gi|38104891|gb|EAA51391.1| hypothetical protein MG09408.4 [Magna... 45 0.003
gi|34809839|pdb|1Q43|A Chain A, Hcn2i 443-640 In The Presence Of... 45 0.003
gi|34809837|pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of... 45 0.003
gi|46192783|ref|ZP_00006015.2| COG1252: NADH dehydrogenase, FAD-... 45 0.003
gi|50761013|ref|XP_425895.1| PREDICTED: similar to hyperpolariza... 45 0.003
gi|23127322|ref|ZP_00109195.1| COG0664: cAMP-binding proteins - ... 45 0.003
gi|21359848|ref|NP_001185.2| hyperpolarization activated cyclic ... 45 0.003
gi|4996894|gb|AAC28444.2| hyperpolarization-activated, cyclic nu... 45 0.003
gi|34862345|ref|XP_343171.1| hyperpolarization activated cyclic ... 45 0.003
gi|24217093|ref|NP_714576.1| cyclic nucleotide dependent protein... 45 0.003
gi|3168868|gb|AAC40125.1| ion channel BCNG-2 [Mus musculus] 45 0.003
gi|6680189|ref|NP_032252.1| hyperpolarization-activated, cyclic ... 45 0.003
gi|50878267|ref|NP_446136.1| hyperpolarization activated cyclic ... 45 0.003
gi|7407647|gb|AAF62174.1| hyperpolarization-activated, cyclic nu... 45 0.003
gi|29840773|sp|Q9JKA9|HCN2_RAT Potassium/sodium hyperpolarizatio... 45 0.003
gi|3168876|gb|AAC39760.1| ion channel BCNG-2 [Homo sapiens] 45 0.003
gi|42525669|ref|NP_970767.1| ribonuclease BN-like family protein... 45 0.003
gi|33357049|pdb|1I6X|A Chain A, Structure Of A Star Mutant Crp-C... 45 0.003
gi|46132534|ref|ZP_00202930.1| COG2274: ABC-type bacteriocin/lan... 45 0.003
gi|47221973|emb|CAG08228.1| unnamed protein product [Tetraodon n... 45 0.003
gi|16768108|gb|AAL28273.1| GH17414p [Drosophila melanogaster] 44 0.004
gi|47219889|emb|CAF97159.1| unnamed protein product [Tetraodon n... 44 0.004
gi|38104053|gb|EAA50674.1| hypothetical protein MG04433.4 [Magna... 44 0.004
gi|47208024|emb|CAF90035.1| unnamed protein product [Tetraodon n... 44 0.004
gi|45550482|ref|NP_611607.2| CG17922-PA [Drosophila melanogaster... 44 0.004
gi|15639254|ref|NP_218703.1| catabolite gene activator (crp) [Tr... 44 0.004
gi|23024071|ref|ZP_00063295.1| COG0664: cAMP-binding proteins - ... 44 0.004
gi|38345758|emb|CAE03486.2| OSJNBa0065O17.11 [Oryza sativa (japo... 44 0.004
gi|13096634|pdb|1HW5|A Chain A, The CapCRP VARIANT T127LS128A >g... 44 0.004
gi|15607061|ref|NP_214443.1| hypothetical protein aq_2107 [Aquif... 44 0.004
gi|48763468|ref|ZP_00268023.1| COG0664: cAMP-binding proteins - ... 44 0.004
gi|8393164|ref|NP_038955.1| cyclic nucleotide gated channel beta... 44 0.006
gi|33312350|gb|AAQ04053.1| hyperpolarization-activated cyclic nu... 44 0.006
gi|23012500|ref|ZP_00052569.1| COG0664: cAMP-binding proteins - ... 44 0.006
gi|48848763|ref|ZP_00303008.1| COG0664: cAMP-binding proteins - ... 44 0.006
gi|48926676|gb|AAT47465.1| putative potassium channel protein [O... 44 0.008
gi|32044035|ref|ZP_00141136.1| COG0664: cAMP-binding proteins - ... 44 0.008
gi|48474485|sp|Q8MJD7|CNB3_CANFA Cyclic-nucleotide-gated cation ... 44 0.008
gi|32044037|ref|ZP_00141138.1| COG0664: cAMP-binding proteins - ... 44 0.008
gi|46108248|ref|XP_381182.1| hypothetical protein FG01006.1 [Gib... 44 0.008
gi|19075586|ref|NP_588086.1| hypothetical UPF0028 family protein... 44 0.008
gi|46391141|gb|AAS90668.1| putative potassium channel protein [O... 44 0.008
gi|7959337|dbj|BAA96059.1| KIAA1535 protein [Homo sapiens] 43 0.010
gi|15826998|ref|NP_301261.1| conserved hypothetical protein [Myc... 43 0.010
gi|16758502|ref|NP_446137.1| hyperpolarization-activated, cyclic... 43 0.010
gi|49082788|gb|AAT50794.1| PA4704 [synthetic construct] 43 0.010
gi|12231708|gb|AAG49220.1| cyclic AMP receptor protein [Serratia... 43 0.010
gi|15599898|ref|NP_253392.1| hypothetical protein [Pseudomonas a... 43 0.010
gi|3044100|gb|AAC13290.1| cAMP-dependent protein kinase [Pseudom... 43 0.010
gi|15242009|ref|NP_198254.1| hypothetical protein [Arabidopsis t... 43 0.010
gi|23014258|ref|ZP_00054084.1| COG2199: FOG: GGDEF domain [Magne... 43 0.010
gi|47574023|ref|ZP_00244060.1| COG0515: Serine/threonine protein... 43 0.010
gi|25089999|sp|Q96M20|CTFX_HUMAN Protein C20orf152 43 0.010
gi|11356602|pir||T45457 hypothetical protein MLCB373.38 [importe... 43 0.010
gi|48892039|ref|ZP_00325472.1| COG0664: cAMP-binding proteins - ... 43 0.010
gi|6680191|ref|NP_032253.1| hyperpolarization-activated, cyclic ... 43 0.010
gi|14329782|emb|CAC34368.2| dJ1121G12.3 (Novel gene) [Homo sapiens] 43 0.010
gi|22506657|dbj|BAC10627.1| CRP [Pectobacterium carotovorum subs... 43 0.010
gi|16120516|ref|NP_403829.1| cAMP-regulatory protein [Yersinia p... 43 0.010
gi|20380242|gb|AAH28024.1| HCN3 protein [Homo sapiens] 43 0.010
gi|38327037|ref|NP_065948.1| hyperpolarization activated cyclic ... 43 0.010
gi|28629108|gb|AAO49470.1| hyperpolarization activated cyclic nu... 43 0.010
gi|50876174|emb|CAG36014.1| related to nitrogen assimilation reg... 43 0.010
gi|18030046|gb|AAL56585.1| histidine kinase-like protein [Myxoco... 43 0.010
gi|18201890|ref|NP_543024.1| chromosome 20 open reading frame 15... 43 0.010
gi|12652639|gb|AAH00066.1| Unknown (protein for IMAGE:3507934) [... 43 0.010
gi|46130106|ref|ZP_00202233.1| COG0664: cAMP-binding proteins - ... 43 0.013
gi|21241032|ref|NP_640614.1| conserved hypothetical protein [Xan... 43 0.013
gi|15208029|dbj|BAB63039.1| hypothetical protein [Macaca fascicu... 43 0.013
gi|50258835|gb|EAL21520.1| hypothetical protein CNBD2140 [Crypto... 43 0.013
gi|42524448|ref|NP_969828.1| cyclic AMP receptor protein,catabol... 43 0.013
gi|24251270|gb|AAN46190.1| unknown protein [Synechococcus sp. PC... 43 0.013
gi|6562375|emb|CAB62555.1| potassium channel [Daucus carota] 43 0.013
gi|23111484|ref|ZP_00097123.1| COG0664: cAMP-binding proteins - ... 42 0.017
gi|13507752|ref|NP_109701.1| hypothetical protein MPN013 [Mycopl... 42 0.017
gi|50303651|ref|XP_451767.1| unnamed protein product [Kluyveromy... 42 0.017
gi|24215242|ref|NP_712723.1| probable cyclic nucleotide binding ... 42 0.017
gi|39937293|ref|NP_949569.1| Cyclic nucleotide regulated K+ chan... 42 0.017
gi|50122984|ref|YP_052151.1| cyclic AMP receptor protein [Erwini... 42 0.017
gi|50404904|ref|YP_053996.1| K+ channel, putative [Paramecium te... 42 0.017
gi|22299279|ref|NP_682526.1| ORF_ID:tlr1736~hypothetical protein... 42 0.017
gi|34870074|ref|XP_341026.1| similar to neuropathy target estera... 42 0.017
gi|3168870|gb|AAC40126.1| ion channel BCNG-3 [Mus musculus] 42 0.022
gi|23127316|ref|ZP_00109189.1| COG0664: cAMP-binding proteins - ... 42 0.022
gi|46188626|ref|ZP_00124912.2| COG0664: cAMP-binding proteins - ... 42 0.022
gi|23015629|ref|ZP_00055399.1| COG0784: FOG: CheY-like receiver ... 42 0.022
gi|13471089|ref|NP_102658.1| probable integral membrane protein ... 42 0.022
gi|16762818|ref|NP_458435.1| cyclic AMP receptor protein,catabol... 42 0.022
gi|16766754|ref|NP_462369.1| catabolite activator protein [Salmo... 42 0.022
gi|15964225|ref|NP_384578.1| PUTATIVE TRANSCRIPTION REGULATOR PR... 42 0.022
gi|23472789|ref|ZP_00128111.1| COG0664: cAMP-binding proteins - ... 42 0.022
gi|15842103|ref|NP_337140.1| cyclic nucleotide-binding protein [... 42 0.022
>gi|15055409|gb|AAK82909.1| Protein kinase protein 2, isoform b
[Caenorhabditis elegans]
Length = 334
Score = 667 bits (1722), Expect = 0.0
Identities = 334/334 (100%), Positives = 334/334 (100%)
Frame = -1
Query: 1005 MGQQLSNRRNSQSVGATKNAKTPKPKEGGNPDAADDDDIIVEPPKRSGGRRTGISAEPIK 826
MGQQLSNRRNSQSVGATKNAKTPKPKEGGNPDAADDDDIIVEPPKRSGGRRTGISAEPIK
Sbjct: 1 MGQQLSNRRNSQSVGATKNAKTPKPKEGGNPDAADDDDIIVEPPKRSGGRRTGISAEPIK 60
Query: 825 EDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQ 646
EDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQ
Sbjct: 61 EDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQ 120
Query: 645 GEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAID 466
GEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAID
Sbjct: 121 GEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAID 180
Query: 465 RLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQ 286
RLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQ
Sbjct: 181 RLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQ 240
Query: 285 PGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKC 106
PGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKC
Sbjct: 241 PGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKC 300
Query: 105 IKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT 4
IKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT
Sbjct: 301 IKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT 334
>gi|39598139|emb|CAE68831.1| Hypothetical protein CBG14791
[Caenorhabditis briggsae]
Length = 336
Score = 640 bits (1651), Expect = 0.0
Identities = 321/336 (95%), Positives = 327/336 (96%), Gaps = 2/336 (0%)
Frame = -1
Query: 1005 MGQQLSNRRNSQSVGATKNAKTPKP--KEGGNPDAADDDDIIVEPPKRSGGRRTGISAEP 832
MGQQLSNRRNSQ+VGA + AK+P KEGGNPD DDDDIIVEPPKRSGGRRTGISAEP
Sbjct: 1 MGQQLSNRRNSQAVGAKEKAKSPTKIKKEGGNPDTVDDDDIIVEPPKRSGGRRTGISAEP 60
Query: 831 IKEDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETII 652
IKEDDTEYKKVVIPKDDATR+SLE+AMRKNLLFAHLEEDEQKTMYDAMFPVEK+ GETII
Sbjct: 61 IKEDDTEYKKVVIPKDDATRKSLEAAMRKNLLFAHLEEDEQKTMYDAMFPVEKNGGETII 120
Query: 651 EQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWA 472
EQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWA
Sbjct: 121 EQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWA 180
Query: 471 IDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQ 292
IDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQ
Sbjct: 181 IDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQ 240
Query: 291 GQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHL 112
GQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHL
Sbjct: 241 GQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHL 300
Query: 111 KCIKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT 4
KCIKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT
Sbjct: 301 KCIKLDRNRFERVMGPVREILKRDVSNYNSYVKLMT 336