Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R07E5_7
(681 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554494|ref|NP_497892.1| peroxiredoxin, thioredoxin-dependen... 466 e-130
gi|39591633|emb|CAE71210.1| Hypothetical protein CBG18073 [Caeno... 437 e-122
gi|1351314|sp|P48822|TDX1_BRUMA Thioredoxin peroxidase 1 (Thiore... 315 7e-85
gi|32483377|ref|NP_054817.2| peroxiredoxin 3 isoform b; antioxid... 274 1e-72
gi|5802974|ref|NP_006784.1| peroxiredoxin 3 isoform a precursor;... 271 9e-72
gi|14250063|gb|AAH08435.1| Peroxiredoxin 3, isoform a precursor ... 271 9e-72
gi|6680690|ref|NP_031478.1| peroxiredoxin 3; anti-oxidant protei... 267 2e-70
gi|49256209|gb|AAH74236.1| Unknown (protein for MGC:83969) [Xeno... 265 5e-70
gi|27806083|ref|NP_776857.1| peroxiredoxin 3 [Bos taurus] >gnl|B... 265 8e-70
gi|48139202|ref|XP_393445.1| similar to thiol peroxiredoxin [Api... 263 2e-69
gi|19698783|gb|AAL91102.1| thiredoxin peroxidase [Acanthocheilon... 262 4e-69
gi|11968132|ref|NP_071985.1| peroxiredoxin 3 [Rattus norvegicus]... 262 4e-69
gi|627764|pir||JC2258 substrate protein of mitochondrial ATP-dep... 260 2e-68
gi|2352262|gb|AAB68798.1| peroxidoxin-1 [Dirofilaria immitis] 259 3e-68
gi|46576851|sp|Q9NL98|PDX_ASCSU Peroxiredoxin (AsPrx) (Thioredox... 258 8e-68
gi|3193232|gb|AAC77922.1| peroxidoxin-2 [Onchocerca ochengi] 258 1e-67
gi|18152531|emb|CAD20737.1| thioredoxin peroxidase [Ostertagia o... 257 1e-67
gi|38260562|gb|AAR15420.1| thiol peroxiredoxin [Bombyx mori] 257 1e-67
gi|2347119|gb|AAC38831.1| thioredoxin peroxidase [Dirofilaria im... 257 2e-67
gi|8394432|ref|NP_058865.1| peroxiredoxin 2; thioredoxin peroxid... 256 2e-67
gi|32189392|ref|NP_005800.3| peroxiredoxin 2 isoform a; thioredo... 256 2e-67
gi|49659835|gb|AAT68217.1| GekBS014P [Gekko japonicus] 256 4e-67
gi|48098546|ref|XP_392086.1| similar to thioredoxin peroxidase [... 255 5e-67
gi|2851423|sp|Q17172|TDX2_BRUMA Thioredoxin peroxidase 2 (Thiore... 255 5e-67
gi|50539996|ref|NP_001002468.1| zgc:92891 [Danio rerio] >gnl|BL_... 255 6e-67
gi|2135069|pir||I68897 probable thioredoxin peroxidase (EC 1.11.... 255 6e-67
gi|12846252|dbj|BAB27093.1| unnamed protein product [Mus musculus] 255 6e-67
gi|2499469|sp|Q61171|PDX2_MOUSE Peroxiredoxin 2 (Thioredoxin per... 254 8e-67
gi|2829135|gb|AAC32810.1| peroxidoxin-2 [Onchocerca volvulus] 254 1e-66
gi|34849738|gb|AAH58481.1| Peroxiredoxin 2 [Rattus norvegicus] 254 1e-66
gi|27807469|ref|NP_777188.1| peroxiredoxin 2 [Bos taurus] >gnl|B... 254 1e-66
gi|31203511|ref|XP_310704.1| ENSANGP00000009997 [Anopheles gambi... 254 1e-66
gi|4505591|ref|NP_002565.1| peroxiredoxin 1; natural killer-enha... 253 2e-66
gi|6435547|pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian ... 253 2e-66
gi|47220267|emb|CAG03301.1| unnamed protein product [Tetraodon n... 253 2e-66
gi|3603241|gb|AAC35744.1| type II peroxiredoxin 1 [Mus musculus] 253 3e-66
gi|9965598|gb|AAG10102.1| peroxidoxin-2 [Litomosoides sigmodontis] 252 4e-66
gi|31198267|ref|XP_308081.1| ENSANGP00000019782 [Anopheles gambi... 252 4e-66
gi|9955007|pdb|1QMV|A Chain A, Thioredoxin Peroxidase B From Red... 252 4e-66
gi|50593309|gb|AAT79401.1| thioredoxin peroxidase [Myotis lucifu... 252 4e-66
gi|27806085|ref|NP_776858.1| peroxiredoxin 4 [Bos taurus] >gnl|B... 252 4e-66
gi|7498730|pir||T16005 hypothetical protein F09E5.2 - Caenorhabd... 252 6e-66
gi|32565831|ref|NP_872052.1| peroxiredoxin, thioredoxin peroxida... 252 6e-66
gi|2736280|gb|AAC48312.1| thioredoxin peroxidase [Onchocerca vol... 252 6e-66
gi|21685578|gb|AAM74564.1| antioxidant protein [Mus musculus] 251 7e-66
gi|16923958|ref|NP_476455.1| peroxiredoxin 1 [Rattus norvegicus]... 251 7e-66
gi|47499100|gb|AAT28331.1| peroxiredoxin [Haemonchus contortus] 251 9e-66
gi|10281259|gb|AAG15506.1| thioredoxin peroxidase 3 [Schistosoma... 251 9e-66
gi|22324906|gb|AAM95673.1| peroxiredoxin 2 [Cricetulus griseus] 251 1e-65
gi|27806081|ref|NP_776856.1| peroxiredoxin 1 [Bos taurus] >gnl|B... 250 2e-65
gi|50751518|ref|XP_422437.1| PREDICTED: similar to peroxiredoxin... 250 2e-65
gi|885932|gb|AAA69475.1| peroxidase 250 2e-65
gi|31560539|ref|NP_035693.2| peroxiredoxin 2; thioredoxin peroxi... 249 3e-65
gi|6754976|ref|NP_035164.1| peroxiredoxin 1; proliferation-assoc... 249 5e-65
gi|49456297|emb|CAG46469.1| PRDX4 [Homo sapiens] 249 5e-65
gi|5453549|ref|NP_006397.1| thioredoxin peroxidase; thioredoxin ... 249 5e-65
gi|16758274|ref|NP_445964.1| peroxiredoxin 4 [Rattus norvegicus]... 248 6e-65
gi|7948999|ref|NP_058044.1| peroxiredoxin 4; antioxidant enzyme ... 248 6e-65
gi|17225115|gb|AAL37254.1| 2-Cys thioredoxin peroxidase [Aedes a... 248 1e-64
gi|12846314|dbj|BAB27120.1| unnamed protein product [Mus musculus] 247 1e-64
gi|7963723|gb|AAF71324.1| natural killer cell enhancement factor... 247 2e-64
gi|17157991|ref|NP_477510.1| CG1633-PA [Drosophila melanogaster]... 246 2e-64
gi|39596861|emb|CAE59088.1| Hypothetical protein CBG02380 [Caeno... 246 2e-64
gi|49118952|gb|AAH73532.1| Unknown (protein for MGC:82793) [Xeno... 246 4e-64
gi|5457310|emb|CAB48391.1| peroxiredoxin [Globodera rostochiensis] 246 4e-64
gi|38047571|gb|AAR09688.1| similar to Drosophila melanogaster Ja... 245 7e-64
gi|6942233|gb|AAF32369.1| thioredoxin peroxidase II [Cricetulus ... 245 7e-64
gi|38089528|ref|XP_125096.2| similar to MSP23 [Mus musculus] 244 9e-64
gi|440306|gb|AAA50464.1| enhancer protein 244 1e-63
gi|50749933|ref|XP_426543.1| PREDICTED: similar to Thioredoxin-d... 244 1e-63
gi|3399699|dbj|BAA32086.1| natural killer cell enhancing factor ... 243 2e-63
gi|47937782|gb|AAH72351.1| MGC83501 protein [Xenopus laevis] 243 2e-63
gi|45360655|ref|NP_989001.1| hypothetical protein MGC75718 [Xeno... 243 2e-63
gi|47215950|emb|CAF96352.1| unnamed protein product [Tetraodon n... 243 2e-63
gi|49898976|gb|AAH76692.1| Unknown (protein for MGC:79732) [Xeno... 243 2e-63
gi|38051985|gb|AAH60567.1| Prdx3 protein [Rattus norvegicus] 243 3e-63
gi|438069|emb|CAA80269.1| thiol-specific antioxidant protein [Ho... 241 7e-63
gi|49255979|gb|AAH72833.1| Unknown (protein for MGC:80194) [Xeno... 240 2e-62
gi|2499471|sp|Q90384|TDX_CYNPY Thioredoxin peroxidase (Thioredox... 239 3e-62
gi|47227198|emb|CAG00560.1| unnamed protein product [Tetraodon n... 239 3e-62
gi|50730180|ref|XP_416800.1| PREDICTED: similar to Peroxiredoxin... 239 4e-62
gi|38081078|ref|XP_359051.1| similar to MSP23 [Mus musculus] 238 6e-62
gi|11066203|gb|AAG28496.1| tryparedoxin peroxidase [Trypanosoma ... 237 1e-61
gi|48734656|gb|AAH72318.1| Unknown (protein for MGC:83078) [Xeno... 236 4e-61
gi|13488586|gb|AAK26236.1| thioredoxin peroxidase BgTPx [Biompha... 236 4e-61
gi|17738015|ref|NP_524387.1| CG5826-PA [Drosophila melanogaster]... 235 5e-61
gi|34853536|ref|XP_212921.2| similar to peroxiredoxin 1 [Rattus ... 235 7e-61
gi|38079952|ref|XP_147236.2| similar to MSP23 [Mus musculus] 235 7e-61
gi|21240672|gb|AAM44383.1| Peroxiredoxin 4 [Dictyostelium discoi... 234 2e-60
gi|31198777|ref|XP_308336.1| ENSANGP00000010951 [Anopheles gambi... 233 2e-60
gi|50426789|ref|XP_461992.1| unnamed protein product [Debaryomyc... 232 5e-60
gi|3776134|emb|CAA09922.1| tryparedoxin peroxidase homologue [Tr... 232 6e-60
gi|22775336|dbj|BAC11863.1| thioredoxin peroxidase [Echinococcus... 230 2e-59
gi|13959614|sp|Q9Y7F0|TSA1_CANAL Thiol-specific antioxidant prot... 230 2e-59
gi|1617118|emb|CAA57764.1| TSA [Homo sapiens] 230 2e-59
gi|50546891|ref|XP_500915.1| hypothetical protein [Yarrowia lipo... 229 4e-59
gi|38259184|dbj|BAD01572.1| thioredoxin peroxidase [Schistosoma ... 229 4e-59
gi|2499474|sp|Q26695|TDX_TRYBR Thioredoxin peroxidase (Thioredox... 229 5e-59
gi|19075930|ref|NP_588430.1| thioredoxin peroxidase [Schizosacch... 228 7e-59
gi|17224953|gb|AAL37182.1| tryparedoxin peroxidase [Trypanosoma ... 228 7e-59
gi|33863026|ref|NP_894586.1| thioredoxin peroxidase [Prochloroco... 228 1e-58
gi|4325211|gb|AAD17299.1| thioredoxin peroxidase [Schistosoma ma... 227 1e-58
gi|3493627|gb|AAC79432.1| peroxidoxin [Leishmania major] 227 2e-58
gi|17864676|ref|NP_525002.1| CG1274-PA [Drosophila melanogaster]... 226 3e-58
gi|6066432|emb|CAB58299.1| peroxidoxin precursor [Leishmania major] 226 3e-58
gi|34857333|ref|XP_213073.2| similar to peroxiredoxin 1 [Rattus ... 226 3e-58
gi|2499472|sp|Q91191|TDX_ONCMY Thioredoxin peroxidase (Thioredox... 226 4e-58
gi|16751316|gb|AAL25846.1| putative mitochondrial peroxiredoxin ... 226 4e-58
gi|29337026|sp|Q8T6C4|TDX_ECHGR Thioredoxin peroxidase (Thioredo... 225 6e-58
gi|24215509|ref|NP_712990.1| 2-Cys thioredoxin peroxidase [Lepto... 225 6e-58
gi|3411094|gb|AAC31146.1| thiol specific antioxidant [Leishmania... 225 6e-58
gi|4104346|gb|AAD02002.1| thioredoxin peroxidase [Echinococcus g... 225 6e-58
gi|45190914|ref|NP_985168.1| AER312Wp [Eremothecium gossypii] >g... 225 7e-58
gi|12655871|gb|AAK00633.1| tryparedoxin peroxidase [Leishmania d... 224 1e-57
gi|23095909|emb|CAD47838.1| thioredoxin peroxidase [Trichomonas ... 223 2e-57
gi|50303323|ref|XP_451603.1| unnamed protein product [Kluyveromy... 223 3e-57
gi|14582664|gb|AAK69587.1| peroxidoxin 3 [Leishmania chagasi] 223 3e-57
gi|34542000|gb|AAQ74891.1| thioredoxin peroxidase [Trichomonas v... 223 4e-57
gi|14582662|gb|AAK69586.1| peroxidoxin 2 [Leishmania chagasi] >g... 223 4e-57
gi|33865747|ref|NP_897306.1| thioredoxin peroxidase [Synechococc... 222 6e-57
gi|21357347|ref|NP_648759.1| CG6888-PA [Drosophila melanogaster]... 222 6e-57
gi|23394396|gb|AAN31487.1| thioredoxin peroxidase [Phytophthora ... 221 1e-56
gi|6323613|ref|NP_013684.1| antioxidant enzyme that provides pro... 221 1e-56
gi|4388655|emb|CAA06923.1| peroxiredoxin [Trypanosoma cruzi] 220 2e-56
gi|50292125|ref|XP_448495.1| unnamed protein product [Candida gl... 219 3e-56
gi|5163492|gb|AAD40685.1| thioredoxin peroxidase [Schistosoma ma... 219 4e-56
gi|21307665|gb|AAK58478.1| thiol-specific antioxidant protein [L... 218 7e-56
gi|3024714|sp|P91883|TDX_FASHE Thioredoxin peroxidase (Thioredox... 217 2e-55
gi|50288495|ref|XP_446677.1| unnamed protein product [Candida gl... 216 3e-55
gi|3549894|emb|CAA06158.1| thiol-specific antioxidant protein [F... 215 6e-55
gi|32475263|ref|NP_868257.1| peroxiredoxin 2 [Pirellula sp. 1] >... 214 1e-54
gi|17232133|ref|NP_488681.1| peroxiredoxin [Nostoc sp. PCC 7120]... 213 4e-54
gi|6320661|ref|NP_010741.1| thioredoxin peroxidase; Tsa2p [Sacch... 213 4e-54
gi|15054517|gb|AAK82654.1| peroxidoxin 1 [Leishmania donovani] 212 5e-54
gi|11761380|gb|AAG40074.1| peroxidoxin 1 [Leishmania chagasi] 211 8e-54
gi|11120591|gb|AAG30934.1| thioredoxin peroxidase [Chlamydomonas... 211 1e-53
gi|45513728|ref|ZP_00165294.1| COG0450: Peroxiredoxin [Synechoco... 211 1e-53
gi|46114676|ref|XP_383356.1| hypothetical protein FG03180.1 [Gib... 211 1e-53
gi|33591156|gb|AAQ23082.1| thioredoxin peroxidase [Ixodes ricinus] 211 1e-53
gi|32140413|gb|AAP68994.1| thiol-specific antioxidant protein 1 ... 209 5e-53
gi|1498198|emb|CAA63909.1| 2-Cys peroxiredoxin bas1 [Arabidopsis... 209 5e-53
gi|12751382|gb|AAK07634.1| thioredoxin peroxidase [Brugia malayi] 208 9e-53
gi|50257023|gb|EAL19741.1| hypothetical protein CNBG3690 [Crypto... 208 9e-53
gi|3851500|gb|AAC72300.1| tryparedoxin peroxidase [Crithidia fas... 206 3e-52
gi|3089370|gb|AAC15095.1| tryparedoxin peroxidase [Crithidia fas... 206 5e-52
gi|3121825|sp|O24364|BAS1_SPIOL 2-cys peroxiredoxin BAS1, chloro... 206 5e-52
gi|11995220|emb|CAC19677.1| peroxiredoxin [Chlamydomonas reinhar... 205 6e-52
gi|7339568|emb|CAB82860.1| 2-Cys-peroxiredoxin [Riccia fluitans] 205 8e-52
gi|22298997|ref|NP_682244.1| thioredoxin peroxidase [Thermosynec... 205 8e-52
gi|16331338|ref|NP_442066.1| thiol-specific antioxidant protein ... 204 1e-51
gi|46119174|ref|ZP_00176167.2| COG0450: Peroxiredoxin [Crocospha... 204 2e-51
gi|2829687|sp|P80602|BAS1_WHEAT 2-cys peroxiredoxin BAS1, chloro... 202 5e-51
gi|2499477|sp|Q96468|BAS1_HORVU 2-cys peroxiredoxin BAS1, chloro... 202 7e-51
gi|15229806|ref|NP_187769.1| 2-cys peroxiredoxin, chloroplast (B... 202 7e-51
gi|48895629|ref|ZP_00328613.1| COG0450: Peroxiredoxin [Trichodes... 201 1e-50
gi|13786919|pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Cri... 200 2e-50
gi|18415155|ref|NP_568166.1| 2-cys peroxiredoxin, chloroplast, p... 200 2e-50
gi|50251981|dbj|BAD27915.1| putative thioredoxin peroxidase [Ory... 200 2e-50
gi|9758409|dbj|BAB08951.1| 2-cys peroxiredoxin-like protein [Ara... 200 2e-50
gi|21553667|gb|AAM62760.1| 2-cys peroxiredoxin-like protein [Ara... 200 2e-50
gi|21592588|gb|AAM64537.1| putative 2-cys peroxiredoxin BAS1 pre... 199 3e-50
gi|11558242|emb|CAC17803.1| peroxiredoxin [Phaseolus vulgaris] >... 198 9e-50
gi|21912927|emb|CAC84143.2| thioredoxin peroxidase [Nicotiana ta... 197 1e-49
gi|13265490|gb|AAG40040.2| AT5g06290 [Arabidopsis thaliana] 197 1e-49
gi|11119229|gb|AAG30570.1| 2-Cys peroxiredoxin [Brassica napus] 197 1e-49
gi|3328221|gb|AAC78473.1| thioredoxin peroxidase [Secale cereale] 197 2e-49
gi|33861413|ref|NP_892974.1| thioredoxin peroxidase [Prochloroco... 196 4e-49
gi|21674312|ref|NP_662377.1| thiolredoxin peroxidase [Chlorobium... 196 4e-49
gi|15131688|emb|CAC48323.1| 2-Cys peroxiredoxin [Pisum sativum] 195 8e-49
gi|11465738|ref|NP_053882.1| ORF199 [Porphyra purpurea] >gnl|BL_... 194 1e-48
gi|1076722|pir||S49173 hypothetical protein - barley (fragment) 194 1e-48
gi|33240428|ref|NP_875370.1| Peroxiredoxin, AhpC/TSA family [Pro... 193 2e-48
gi|7242491|emb|CAA66484.2| 2-Cys peroxiredoxin [Arabidopsis thal... 193 2e-48
gi|48845075|ref|ZP_00299364.1| COG0450: Peroxiredoxin [Geobacter... 193 3e-48
gi|39998336|ref|NP_954287.1| thioredoxin peroxidase [Geobacter s... 193 3e-48
gi|47193078|emb|CAF87247.1| unnamed protein product [Tetraodon n... 191 9e-48
gi|48832498|ref|ZP_00289531.1| COG0450: Peroxiredoxin [Magnetoco... 191 2e-47
gi|29840734|ref|NP_829840.1| antioxidant, AhpC/TSA family [Chlam... 191 2e-47
gi|46445658|ref|YP_007023.1| probable proteins related to alkyl ... 186 3e-46
gi|37522727|ref|NP_926104.1| probable peroxiredoxin [Gloeobacter... 186 3e-46
gi|131774|sp|P23161|R20K_CLOPA 20 kDa protein in rubredoxin oper... 184 1e-45
gi|15618687|ref|NP_224973.1| Thio-specific Antioxidant (TSA) Per... 180 2e-44
gi|16752263|ref|NP_445631.1| antioxidant, AhpC/Tsa family [Chlam... 180 2e-44
gi|50657713|gb|AAT79698.1| thiol-specific antioxidant protein [G... 179 3e-44
gi|27232101|gb|AAG25678.2| peroxiredoxin [Toxoplasma gondii] 179 5e-44
gi|15605333|ref|NP_220119.1| Thio-specific Antioxidant (TSA) Per... 179 6e-44
gi|6002472|gb|AAF00001.1| 2Cys-peroxiredoxin precursor [Brassica... 177 1e-43
gi|15835506|ref|NP_297265.1| antioxidant, AhpC/Tsa family [Chlam... 176 4e-43
gi|48846943|ref|ZP_00301201.1| COG0450: Peroxiredoxin [Geobacter... 176 5e-43
gi|27363920|ref|NP_759448.1| Peroxiredoxin [Vibrio vulnificus CM... 175 7e-43
gi|34558282|ref|NP_908097.1| ALKYL HYDROPEROXIDE REDUCTASE SUBUN... 174 1e-42
gi|46580652|ref|YP_011460.1| antioxidant, AhpC/Tsa family [Desul... 174 1e-42
gi|41722952|ref|ZP_00149918.1| COG0450: Peroxiredoxin [Dechlorom... 174 2e-42
gi|28897354|ref|NP_796959.1| antioxidant, AhpC/Tsa family [Vibri... 173 3e-42
gi|46914174|emb|CAG20954.1| putative antioxidant, AhpC/Tsa famil... 172 4e-42
gi|48765945|ref|ZP_00270495.1| COG0450: Peroxiredoxin [Rhodospir... 172 6e-42
gi|15791702|ref|NP_281525.1| alkyl hydroperoxide reductase [Camp... 172 7e-42
gi|15604195|ref|NP_220710.1| THIOREDOXIN PEROXIDASE 1 (tdpX1) [R... 172 7e-42
gi|15602660|ref|NP_245732.1| TsaA [Pasteurella multocida Pm70] >... 171 1e-41
gi|46912356|emb|CAG19148.1| putative antioxidant, AhpC/Tsa famil... 170 3e-41
gi|45511540|gb|AAS67289.1| TsaA [Haemophilus influenzae] 170 3e-41
gi|15892374|ref|NP_360088.1| thioredoxin peroxidase 1 [EC:1.6.4.... 170 3e-41
gi|46132967|ref|ZP_00155972.2| COG0450: Peroxiredoxin [Haemophil... 170 3e-41
gi|5762303|gb|AAD51093.1| thioredoxin peroxidase homolog [Giardi... 170 3e-41
gi|29251327|gb|EAA42809.1| GLP_574_29623_29018 [Giardia lamblia ... 170 3e-41
gi|28189631|dbj|BAC56430.1| similar to peroxiredoxin 1 [Bos taurus] 169 4e-41
gi|34580622|ref|ZP_00142102.1| thioredoxin peroxidase 1 [Rickett... 169 5e-41
gi|15982705|gb|AAL09838.1| thioredoxin peroxidase [Bacteroides f... 168 1e-40
gi|1717797|sp|P52552|PDX2_PIG Peroxiredoxin 2 (Thioredoxin perox... 168 1e-40
gi|29245971|gb|EAA37586.1| GLP_503_26300_26905 [Giardia lamblia ... 167 2e-40
gi|158936|gb|AAA29095.1| cysteine-rich surface antigen 167 2e-40
gi|217354|dbj|BAA00749.1| 30,000-Mr antigen [Entamoeba histolytica] 167 2e-40
gi|19880968|gb|AAM00601.1| peroxynitrite reductase [Legionella p... 167 2e-40
gi|965473|gb|AAA74933.1| alkylhydrogenperoxide reductase 167 2e-40
gi|39995998|ref|NP_951949.1| thioredoxin peroxidase [Geobacter s... 166 3e-40
gi|48863544|ref|ZP_00317438.1| COG0450: Peroxiredoxin [Microbulb... 166 3e-40
gi|34499194|ref|NP_903409.1| probable peroxidase [Chromobacteriu... 166 3e-40
gi|7416016|dbj|BAA93646.1| peroxiredoxin [Entamoeba dispar] 166 4e-40
gi|26987820|ref|NP_743245.1| antioxidant, AhpC/Tsa family [Pseud... 166 4e-40
gi|544092|sp|P19476|CR29_ENTHI 29 kDa cysteine-rich surface anti... 166 5e-40
gi|46200747|ref|ZP_00056418.2| COG0450: Peroxiredoxin [Magnetosp... 166 5e-40
gi|15640750|ref|NP_230380.1| antioxidant, AhpC/Tsa family [Vibri... 166 5e-40
gi|48730311|ref|ZP_00264059.1| COG0450: Peroxiredoxin [Pseudomon... 166 5e-40
gi|482366|pir||A43862 29K peripheral membrane protein - Entamoeb... 165 7e-40
gi|15596045|ref|NP_249539.1| probable alkyl hydroperoxide reduct... 165 9e-40
gi|49082744|gb|AAT50772.1| PA0848 [synthetic construct] 165 9e-40
gi|23466433|ref|ZP_00122021.1| COG0450: Peroxiredoxin [Haemophil... 164 1e-39
gi|37527763|ref|NP_931108.1| alkyl hydroperoxide reductase, smal... 164 1e-39
gi|32029501|ref|ZP_00132514.1| COG0450: Peroxiredoxin [Haemophil... 164 2e-39
gi|50120056|ref|YP_049223.1| probable peroxidase [Erwinia caroto... 162 6e-39
gi|16759380|ref|NP_454997.1| probable peroxidase [Salmonella ent... 162 7e-39
gi|23478642|gb|EAA15674.1| thioredoxin peroxidase 1 [Plasmodium ... 162 7e-39
gi|30692541|gb|AAP33385.1| thioredoxin peroxidase [Spironucleus ... 160 2e-38
gi|48854556|ref|ZP_00308718.1| COG0450: Peroxiredoxin [Cytophaga... 159 4e-38
gi|29249220|gb|EAA40736.1| GLP_608_3867_3127 [Giardia lamblia AT... 159 4e-38
gi|5814209|gb|AAD52147.1| alkyl hydroperoxide reductase subunit ... 159 4e-38
gi|16123356|ref|NP_406669.1| putative alkyl hydroperoxide reduct... 159 5e-38
gi|42520597|ref|NP_966512.1| antioxidant, AhpC/Tsa family [Wolba... 159 6e-38
gi|34540424|ref|NP_904903.1| alkyl hydroperoxide reductase, C su... 159 6e-38
gi|23509590|ref|NP_702257.1| 2-Cys peroxiredoxin [Plasmodium fal... 158 8e-38
gi|12718511|emb|CAC28867.1| peroxiredoxin [Platichthys flesus] 158 1e-37
gi|16078486|ref|NP_389305.1| ykuU [Bacillus subtilis subsp. subt... 158 1e-37
gi|15615228|ref|NP_243531.1| 2-cys peroxiredoxin [Bacillus halod... 158 1e-37
gi|15598725|ref|NP_252219.1| probable peroxidase [Pseudomonas ae... 157 1e-37
gi|23471828|ref|ZP_00127157.1| COG0450: Peroxiredoxin [Pseudomon... 157 2e-37
gi|16803644|ref|NP_465129.1| similar to 2-cys peroxiredoxin [Lis... 156 4e-37
gi|48733206|ref|ZP_00266949.1| COG0450: Peroxiredoxin [Pseudomon... 156 4e-37
gi|46907834|ref|YP_014223.1| peroxiredoxin, putative [Listeria m... 155 5e-37
gi|16800713|ref|NP_470981.1| similar to 2-cys peroxiredoxin [Lis... 155 5e-37
gi|33188452|ref|NP_859427.1| peroxiredoxin 2 isoform b; thioredo... 155 7e-37
gi|28870281|ref|NP_792900.1| alkyl hydroperoxide reductase, subu... 155 7e-37
gi|4097710|gb|AAD09523.1| 30 kDa type I collagen binding protein... 154 1e-36
gi|29654995|ref|NP_820687.1| antioxidant, AhpC/Tsa family [Coxie... 153 3e-36
gi|29150177|emb|CAD79632.1| alkyl hydroperoxide reductase C22 pr... 153 3e-36
gi|15612536|ref|NP_224189.1| putative peroxidase [Helicobacter p... 152 6e-36
gi|29150161|emb|CAD79624.1| alkyl hydroperoxide reductase C22 pr... 152 6e-36
gi|29348221|ref|NP_811724.1| alkyl hydroperoxide reductase C22 p... 152 6e-36
gi|30250386|ref|NP_842456.1| Alkyl hydroperoxide reductase/ Thio... 152 6e-36
gi|23508842|ref|NP_701510.1| thioredoxin peroxidase [Plasmodium ... 152 8e-36
gi|29150183|emb|CAD79635.1| alkyl hydroperoxide reductase C22 pr... 152 8e-36
gi|29150187|emb|CAD79637.1| alkyl hydroperoxide reductase C22 pr... 152 8e-36
gi|15646170|ref|NP_208354.1| alkyl hydroperoxide reductase (tsaA... 151 1e-35
gi|23024604|ref|ZP_00063809.1| COG0450: Peroxiredoxin [Leuconost... 151 1e-35
gi|19338954|gb|AAL86893.1| putative alkyl hydroperoxide reductas... 151 1e-35
gi|34850269|emb|CAE47410.1| alkyl hydorperoxide reductase C22 [H... 151 1e-35
gi|29150165|emb|CAD79626.1| alkyl hydroperoxide reductase C22 pr... 151 1e-35
gi|26989162|ref|NP_744587.1| alkyl hydroperoxide reductase, C su... 151 1e-35
gi|14029099|gb|AAK51148.1| 26,000 kDa protein [Helicobacter pylori] 151 1e-35
gi|29150163|emb|CAD79625.1| alkyl hydroperoxide reductase C22 pr... 151 1e-35
gi|29150167|emb|CAD79627.1| alkyl hydroperoxide reductase C22 pr... 151 1e-35
gi|29150169|emb|CAD79628.1| alkyl hydroperoxide reductase C22 pr... 151 1e-35
gi|34850275|emb|CAE47413.1| alkyl hydroperoxide reductase C22 [H... 150 2e-35
gi|29150171|emb|CAD79629.1| alkyl hydroperoxide reductase C22 pr... 150 2e-35
gi|24372545|ref|NP_716587.1| alkyl hydroperoxide reductase, C su... 150 2e-35
gi|42523944|ref|NP_969324.1| alkyl hydroperoxide reductase, C22 ... 150 3e-35
gi|32491236|ref|NP_871490.1| ahpC [Wigglesworthia glossinidia en... 149 4e-35
gi|38082199|ref|XP_356930.1| similar to Peroxiredoxin 2 (Thiored... 149 5e-35
gi|16081313|ref|NP_393630.1| probable peroxiredoxin [Thermoplasm... 148 9e-35
gi|32267043|ref|NP_861075.1| alkyl hydroperoxide reductase TsaA ... 147 2e-34
gi|47575301|ref|ZP_00245336.1| COG0450: Peroxiredoxin [Rubriviva... 147 2e-34
gi|19173077|ref|NP_597628.1| THIOREDOXIN PEROXIDASE (THIOL-SPECI... 147 2e-34
gi|48861916|ref|ZP_00315815.1| COG0450: Peroxiredoxin [Microbulb... 147 2e-34
gi|23102151|ref|ZP_00088675.1| COG0450: Peroxiredoxin [Azotobact... 146 3e-34
gi|46313100|ref|ZP_00213692.1| COG0450: Peroxiredoxin [Burkholde... 146 3e-34
gi|50085223|ref|YP_046733.1| alkyl hydroperoxide reductase, C22 ... 146 4e-34
gi|46321606|ref|ZP_00221982.1| COG0450: Peroxiredoxin [Burkholde... 145 6e-34
gi|13541053|ref|NP_110741.1| Peroxiredoxin [Thermoplasma volcani... 145 7e-34
gi|46141286|ref|ZP_00146503.2| COG0450: Peroxiredoxin [Psychroba... 145 9e-34
gi|29377215|ref|NP_816369.1| alkyl hydroperoxide reductase, C su... 145 9e-34
gi|42524877|ref|NP_970257.1| conserved hypothetical protein [Bde... 145 9e-34
gi|23490460|gb|EAA22232.1| thioredoxin peroxidase 2 [Plasmodium ... 144 2e-33
gi|18309764|ref|NP_561698.1| alkyl hydrogen peroxide reductase [... 142 5e-33
gi|28189861|dbj|BAC56545.1| similar to peroxiredoxin 1 [Bos taurus] 142 6e-33
gi|19705279|ref|NP_602774.1| Alkyl hydroperoxide reductase C22 p... 142 6e-33
gi|45522288|ref|ZP_00173803.1| COG0450: Peroxiredoxin [Methyloba... 142 8e-33
gi|34762754|ref|ZP_00143742.1| Alkyl hydroperoxide reductase C22... 142 8e-33
gi|33519693|ref|NP_878525.1| alkyl hydroperoxide reductase C22 p... 141 1e-32
gi|50083688|ref|YP_045198.1| alkyl hydroperoxide reductase prote... 141 1e-32
gi|27904673|ref|NP_777799.1| peroxiredoxin 2 [Buchnera aphidicol... 141 1e-32
gi|45826512|gb|AAS77881.1| peroxiredoxin [Acinetobacter radiores... 141 1e-32
gi|48785817|ref|ZP_00282026.1| COG0450: Peroxiredoxin [Burkholde... 140 2e-32
gi|8927563|gb|AAF82118.1| peroxiredoxin [Thermus aquaticus] 140 2e-32
gi|28901538|ref|NP_801193.1| alkyl hydroperoxide reductase c22 p... 140 3e-32
gi|48825063|ref|ZP_00286360.1| COG0450: Peroxiredoxin [Enterococ... 140 3e-32
gi|48849523|ref|ZP_00303766.1| COG0450: Peroxiredoxin [Novosphin... 139 4e-32
gi|29027461|gb|AAO62417.1| peroxiredoxin 3 [Toxoplasma gondii] 139 5e-32
gi|15616801|ref|NP_240013.1| alkyl hydroperoxide reductase [Buch... 139 5e-32
gi|37676710|ref|NP_937106.1| peroxiredoxin [Vibrio vulnificus YJ... 139 5e-32
gi|17548466|ref|NP_521806.1| PROBABLE ALKYL HYDROPEROXIDE REDUCT... 139 5e-32
gi|27366935|ref|NP_762462.1| Peroxiredoxin [Vibrio vulnificus CM... 139 7e-32
gi|16127148|ref|NP_421712.1| alkyl hydroperoxide reductase, subu... 139 7e-32
gi|15672319|ref|NP_266493.1| alkyl hydroperoxide reductase [Lact... 139 7e-32
gi|4097708|gb|AAD09522.1| 30 kDa type I collagen binding protein... 138 9e-32
gi|48858351|ref|ZP_00312308.1| COG0450: Peroxiredoxin [Clostridi... 138 9e-32
gi|46204795|ref|ZP_00209561.1| COG0450: Peroxiredoxin [Magnetosp... 138 1e-31
gi|23114010|ref|ZP_00099338.1| COG0450: Peroxiredoxin [Desulfito... 138 1e-31
gi|46308436|ref|ZP_00210629.1| COG0450: Peroxiredoxin [Ehrlichia... 137 2e-31
gi|29654768|ref|NP_820460.1| antioxidant, AhpC/TSA family [Coxie... 137 3e-31
gi|21672464|ref|NP_660531.1| alkyl hydroperoxide reductase subun... 136 4e-31
gi|28198651|ref|NP_778965.1| subunit C of alkyl hydroperoxide re... 135 6e-31
gi|13541930|ref|NP_111618.1| Peroxiredoxin [Thermoplasma volcani... 135 8e-31
gi|48764780|ref|ZP_00269331.1| COG0450: Peroxiredoxin [Rhodospir... 135 8e-31
gi|21398291|ref|NP_654276.1| AhpC-TSA, AhpC/TSA family [Bacillus... 135 8e-31
gi|30018585|ref|NP_830216.1| Alkyl hydroperoxide reductase C22 [... 135 8e-31
gi|34558053|ref|NP_907868.1| ALKYL HYDROPEROXIDE REDUCTASE [Woli... 134 2e-30
gi|15838131|ref|NP_298819.1| subunit C of alkyl hydroperoxide re... 134 2e-30
gi|22996745|ref|ZP_00040991.1| COG0450: Peroxiredoxin [Xylella f... 134 2e-30
gi|49082568|gb|AAT50684.1| PA0139 [synthetic construct] 133 3e-30
gi|15595337|ref|NP_248829.1| alkyl hydroperoxide reductase subun... 133 3e-30
gi|21241677|ref|NP_641259.1| alkyl hydroperoxide reductase subun... 133 4e-30
gi|50843436|ref|YP_056663.1| alkyl hydroperoxide reductase C22 p... 133 4e-30
gi|21230308|ref|NP_636225.1| alkyl hydroperoxide reductase subun... 132 6e-30
gi|27469275|ref|NP_765912.1| alkyl hydroperoxide reductase subun... 132 8e-30
gi|22994709|ref|ZP_00039203.1| COG0450: Peroxiredoxin [Xylella f... 132 8e-30
gi|50122862|ref|YP_052029.1| alkyl hydroperoxide reductase C22 p... 131 1e-29
gi|11467494|ref|NP_043640.1| ORF204 [Odontella sinensis] >gnl|BL... 131 1e-29
gi|3759181|dbj|BAA33808.1| alkyl hydroperoxide reductase C [Amph... 129 4e-29
gi|48854278|ref|ZP_00308441.1| COG0450: Peroxiredoxin [Cytophaga... 128 1e-28
gi|14285790|sp|Q9HJL3|TDX2_THEAC Probable peroxiredoxin 2 >gnl|B... 128 1e-28
gi|16082572|ref|NP_394414.1| Peroxiredoxin [Thermoplasma acidoph... 128 1e-28
gi|15639500|ref|NP_218950.1| alkyl hydroperoxide reductase (ahpC... 128 1e-28
gi|3650468|gb|AAC61301.1| alkylhydroperoxide reductase; AhpC [My... 127 2e-28
gi|45533075|ref|ZP_00184069.1| COG0450: Peroxiredoxin [Exiguobac... 127 2e-28
gi|16081061|ref|NP_391889.1| alkyl hydroperoxide reductase (smal... 127 2e-28
gi|15675837|ref|NP_270011.1| putative alkyl hydroperoxidase [Str... 127 2e-28
gi|6850955|emb|CAB71140.1| selenocysteine-containing peroxiredox... 127 3e-28
gi|15800320|ref|NP_286332.1| alkyl hydroperoxide reductase, C22 ... 127 3e-28
gi|15923371|ref|NP_370905.1| alkyl hydroperoxide reductase subun... 126 5e-28
gi|1075669|pir||S52934 alkyl hydroperoxide reductase (EC 1.6.4.-... 126 5e-28
gi|4433065|dbj|BAA20964.1| antigen [Entamoeba histolytica] 126 5e-28
gi|18977094|ref|NP_578451.1| alkyl hydroperoxide reductase subun... 125 6e-28
gi|16759567|ref|NP_455184.1| alkyl hydroperoxide reductase c22 p... 125 1e-27
gi|20151112|pdb|1KYG|A Chain A, X-Ray Crystal Structure Of Ahpc ... 125 1e-27
gi|4433793|dbj|BAA20970.1| antigen [Entamoeba histolytica] 124 1e-27
gi|141082|sp|P26830|YNDH_BACYN Hypothetical protein in NDH 5'reg... 124 1e-27
gi|23465199|ref|NP_695802.1| alkyl hydroperoxide reductase C22 p... 124 2e-27
gi|48853071|ref|ZP_00307252.1| COG0450: Peroxiredoxin [Ferroplas... 124 2e-27
gi|38234005|ref|NP_939772.1| iron repressible polypeptide (putat... 123 3e-27
gi|23336373|ref|ZP_00121593.1| COG0450: Peroxiredoxin [Bifidobac... 123 3e-27
gi|22537972|ref|NP_688823.1| alkyl hydroperoxide reductase, subu... 123 3e-27
gi|25011913|ref|NP_736308.1| Unknown [Streptococcus agalactiae N... 123 3e-27
gi|48477799|ref|YP_023505.1| hypothetical peroxiredoxin [Picroph... 123 3e-27
gi|15609565|ref|NP_216944.1| ahpC [Mycobacterium tuberculosis H3... 122 5e-27
gi|15605962|ref|NP_213339.1| alkyl hydroperoxide reductase [Aqui... 122 5e-27
gi|24379223|ref|NP_721178.1| alkyl hydroperoxide reductase [Stre... 122 7e-27
gi|1408576|gb|AAC44148.1| alkyl hydroperoxide reductase C >gnl|B... 122 9e-27
gi|30749577|pdb|1N8J|A Chain A, Crystal Structure Of Ahpc With A... 121 1e-26
gi|282517|pir||A43858 alkyl hydroperoxidase C (EC 1.6.4.-) - Myc... 120 2e-26
gi|622969|gb|AAA96946.1| iron repressible polypeptide [Corynebac... 120 2e-26
gi|48784531|ref|ZP_00280897.1| COG0450: Peroxiredoxin [Burkholde... 120 2e-26
gi|41407687|ref|NP_960523.1| AhpC [Mycobacterium avium subsp. pa... 120 2e-26
gi|18313088|ref|NP_559755.1| peroxiredoxin, probable [Pyrobaculu... 119 4e-26
gi|15643570|ref|NP_228616.1| alkyl hydroperoxide reductase, puta... 118 1e-25
gi|15828102|ref|NP_302365.1| alkyl hydroperoxide reductase [Myco... 118 1e-25
gi|48783877|ref|ZP_00280258.1| COG0450: Peroxiredoxin [Burkholde... 117 2e-25
gi|13375557|gb|AAK20392.1| alkylhydroperoxidase C [Mycobacterium... 117 2e-25
gi|23500448|ref|NP_699888.1| alkyl hydroperoxide reductase C [Br... 117 3e-25
gi|6288866|gb|AAF06744.1| AhpC [Streptomyces coelicolor A3(2)] 115 6e-25
gi|17988922|ref|NP_541555.1| ALKYL HYDROPEROXIDE REDUCTASE C22 P... 115 6e-25
gi|15606208|ref|NP_213585.1| alkyl hydroperoxide reductase [Aqui... 115 6e-25
gi|4927942|gb|AAD33340.1| alkyl hydroperoxide reductase [Strepto... 115 8e-25
gi|14286174|sp|O29969|TDXH_ARCFU Probable peroxiredoxin 115 1e-24
gi|11497886|ref|NP_069108.1| alkyl hydroperoxide reductase [Arch... 115 1e-24
gi|13186328|gb|AAK15374.1| alkyl hydroperoxide reductase small s... 115 1e-24
gi|3334372|sp|O33665|TDX2_SULME Probable peroxiredoxin 2 >gnl|BL... 114 1e-24
gi|21223405|ref|NP_629184.1| alkyl hydroperoxide reductase [Stre... 114 2e-24
gi|13186352|gb|AAK15391.1| alkyl hydroperoxide reductase small s... 114 2e-24
gi|48772738|ref|ZP_00277080.1| COG0450: Peroxiredoxin [Ralstonia... 114 2e-24
gi|14285791|sp|Q9HKX0|TDX1_THEAC Probable peroxiredoxin 1 112 5e-24
gi|16081592|ref|NP_393951.1| peroxiredoxin related protein [Ther... 112 5e-24
gi|48852427|ref|ZP_00306614.1| COG0450: Peroxiredoxin [Ferroplas... 112 5e-24
gi|3334373|sp|Q55060|TDX1_SULME Probable peroxiredoxin 1 >gnl|BL... 112 9e-24
gi|45519095|ref|ZP_00170646.1| COG0450: Peroxiredoxin [Ralstonia... 112 9e-24
gi|29829774|ref|NP_824408.1| putative alkyl hydroperoxide reduct... 112 9e-24
gi|20806791|ref|NP_621962.1| Peroxiredoxin [Thermoanaerobacter t... 111 2e-23
gi|15920801|ref|NP_376470.1| 215aa long hypothetical peroxiredox... 110 2e-23
gi|33188454|ref|NP_859428.1| peroxiredoxin 2 isoform c; thioredo... 110 2e-23
gi|46141914|ref|ZP_00147406.2| COG0450: Peroxiredoxin [Methanoco... 110 2e-23
gi|15668917|ref|NP_247721.1| alkyl hydroperoxide reductase [Meth... 110 3e-23
gi|14286184|sp|Q58146|TDXH_METJA Probable peroxiredoxin 110 3e-23
gi|15922774|ref|NP_378443.1| 212aa long hypothetical peroxiredox... 110 3e-23
gi|41614986|ref|NP_963484.1| NEQ191 [Nanoarchaeum equitans Kin4-... 110 3e-23
gi|15898905|ref|NP_343510.1| Peroxiredoxin, bacterioferritin com... 109 4e-23
gi|17546365|ref|NP_519767.1| PUTATIVE ALKYL HYDROPEROXIDE REDUCT... 109 4e-23
gi|33594422|ref|NP_882066.1| alkyl hydroperoxide reductase [Bord... 108 8e-23
gi|27376888|ref|NP_768417.1| alkyl hydroperoxide reductase [Brad... 108 8e-23
gi|23474088|ref|ZP_00129383.1| COG0450: Peroxiredoxin [Desulfovi... 108 8e-23
gi|13186341|gb|AAK15383.1| alkyl hydroperoxide reductase small s... 108 1e-22
gi|20808569|ref|NP_623740.1| Peroxiredoxin [Thermoanaerobacter t... 107 2e-22
gi|48477449|ref|YP_023155.1| hypothetical alkyl hydroperoxide re... 106 5e-22
gi|13186337|gb|AAK15380.1| alkyl hydroperoxide reductase small s... 105 6e-22
gi|14601964|ref|NP_148509.1| thioredoxin peroxidase [Aeropyrum p... 105 8e-22
gi|21674562|ref|NP_662627.1| peroxiredoxin, putative [Chlorobium... 104 1e-21
gi|14591037|ref|NP_143112.1| alkyl hydroperoxide reductase [Pyro... 104 2e-21
gi|45358737|ref|NP_988294.1| Alkyl hydroperoxide reductase/ Thio... 103 2e-21
gi|48852757|ref|ZP_00306940.1| COG0450: Peroxiredoxin [Ferroplas... 103 4e-21
gi|14521246|ref|NP_126721.1| probable peroxiredoxin [Pyrococcus ... 103 4e-21
gi|42525530|ref|NP_970628.1| alkyl hydroperoxide reductase/perox... 103 4e-21
gi|13186345|gb|AAK15386.1| alkyl hydroperoxide reductase small s... 102 9e-21
gi|23612983|ref|NP_704522.1| 1-cys peroxidoxin [Plasmodium falci... 100 2e-20
gi|18977405|ref|NP_578762.1| alkyl hydroperoxide reductase [Pyro... 100 3e-20
gi|48840920|ref|ZP_00297846.1| COG0450: Peroxiredoxin [Methanosa... 100 3e-20
gi|20092896|ref|NP_618971.1| peroxiredoxin (alkyl hydroperoxide ... 100 3e-20
gi|48478594|ref|YP_024300.1| alkyl hydroperoxide reductase subun... 100 3e-20
gi|38344034|emb|CAE01526.2| OJ991214_12.15 [Oryza sativa (japoni... 100 5e-20
gi|21226916|ref|NP_632838.1| putative peroxiredoxin [Methanosarc... 99 6e-20
gi|28210605|ref|NP_781549.1| putative peroxiredoxin, alkyl hydro... 99 1e-19
gi|39935509|ref|NP_947785.1| probable antioxidant protein [Rhodo... 98 2e-19
gi|3024730|sp|Q57109|TDXH_METTM Probable peroxiredoxin >gnl|BL_O... 98 2e-19
gi|15678187|ref|NP_275302.1| alkyl hydroperoxide reductase [Meth... 97 3e-19
gi|14286173|sp|O26262|TDXH_METTH Probable peroxiredoxin 97 3e-19
gi|23479236|gb|EAA16120.1| 1-cys peroxidoxin [Plasmodium yoelii ... 96 9e-19
gi|41689318|ref|ZP_00145852.1| COG0450: Peroxiredoxin [Psychroba... 96 9e-19
gi|16768422|gb|AAL28430.1| GM04269p [Drosophila melanogaster] 95 1e-18
gi|24581278|ref|NP_523463.2| CG3083-PA [Drosophila melanogaster]... 95 1e-18
gi|12044361|gb|AAG47822.1| 1-cys peroxiredoxin DPx-6005 [Drosoph... 94 2e-18
gi|10180976|gb|AAG14353.1| 1-Cys peroxiredoxin [Plasmodium falci... 94 2e-18
gi|49093298|ref|XP_408110.1| hypothetical protein AN3973.2 [Aspe... 94 3e-18
gi|50285063|ref|XP_444960.1| unnamed protein product [Candida gl... 93 6e-18
gi|23123779|ref|ZP_00105824.1| COG0450: Peroxiredoxin [Nostoc pu... 93 6e-18
gi|16329971|ref|NP_440699.1| rehydrin [Synechocystis sp. PCC 680... 92 7e-18
gi|48894522|ref|ZP_00327631.1| COG0450: Peroxiredoxin [Trichodes... 92 7e-18
gi|45513856|ref|ZP_00165422.1| COG0450: Peroxiredoxin [Synechoco... 92 1e-17
gi|50555488|ref|XP_505152.1| hypothetical protein [Yarrowia lipo... 92 1e-17
gi|49087888|ref|XP_405829.1| hypothetical protein AN1692.2 [Aspe... 91 2e-17
gi|37521724|ref|NP_925101.1| AhpC/TSA family protein [Gloeobacte... 90 4e-17
gi|33592121|ref|NP_879765.1| antioxidant protein [Bordetella per... 90 5e-17
gi|15598646|ref|NP_252140.1| probable antioxidant protein [Pseud... 89 6e-17
gi|50419761|ref|XP_458412.1| unnamed protein product [Debaryomyc... 89 6e-17
gi|28872429|ref|NP_795048.1| antioxidant, AhpC/Tsa family [Pseud... 89 8e-17
gi|46120640|ref|ZP_00171827.2| COG0450: Peroxiredoxin [Methyloba... 89 1e-16
gi|48786702|ref|ZP_00282836.1| COG0450: Peroxiredoxin [Burkholde... 89 1e-16
gi|22299804|ref|NP_683051.1| AhpC/TSA family protein [Thermosyne... 89 1e-16
gi|14041706|emb|CAC38779.1| glutathione peroxidase [Suberites do... 88 1e-16
gi|6319407|ref|NP_009489.1| Mitochondrial peroxiredoxin (1-Cys P... 88 1e-16
gi|48784519|ref|ZP_00280885.1| COG0450: Peroxiredoxin [Burkholde... 88 1e-16
gi|46164253|ref|ZP_00205020.1| COG0450: Peroxiredoxin [Pseudomon... 88 1e-16
gi|26986978|ref|NP_742403.1| antioxidant protein LsfA [Pseudomon... 88 1e-16
gi|23102543|ref|ZP_00089048.1| COG0450: Peroxiredoxin [Azotobact... 87 2e-16
gi|50309715|ref|XP_454869.1| unnamed protein product [Kluyveromy... 87 3e-16
gi|23126633|ref|ZP_00108523.1| COG0450: Peroxiredoxin [Nostoc pu... 87 3e-16
gi|21623834|dbj|BAC00970.1| thiol-specific antioxidant protein [... 87 4e-16
gi|46187765|ref|ZP_00126668.2| COG0450: Peroxiredoxin [Pseudomon... 87 4e-16
gi|32140415|gb|AAP68995.1| thiol-specific antioxidant protein 3 ... 86 5e-16
gi|32475261|ref|NP_868255.1| hypothetical protein-signal peptide... 86 7e-16
gi|50255243|gb|EAL17979.1| hypothetical protein CNBK3300 [Crypto... 86 7e-16
gi|15221082|ref|NP_175247.1| peroxiredoxin (PER1) / rehydrin, pu... 86 7e-16
gi|28393058|gb|AAO41963.1| putative peroxiredoxin [Arabidopsis t... 86 7e-16
gi|17231896|ref|NP_488444.1| AhpC/TSA family protein [Nostoc sp.... 86 7e-16
gi|45505468|ref|ZP_00157848.1| COG0450: Peroxiredoxin [Anabaena ... 86 7e-16
gi|25990368|gb|AAN76502.1| 1-cys-peroxiredoxin [Brassica napus] 85 1e-15
gi|46316197|ref|ZP_00216777.1| COG0450: Peroxiredoxin [Burkholde... 85 1e-15
gi|47574058|ref|ZP_00244095.1| COG0450: Peroxiredoxin [Rubriviva... 85 2e-15
gi|12044365|gb|AAG47824.1| 1-cys peroxiredoxin DPx-2540-2 [Droso... 85 2e-15
gi|17975518|ref|NP_523683.1| CG11765-PA [Drosophila melanogaster... 85 2e-15
gi|12044363|gb|AAG47823.1| 1-cys peroxiredoxin DPx-2540-1 [Droso... 85 2e-15
gi|48731032|ref|ZP_00264778.1| COG0450: Peroxiredoxin [Pseudomon... 84 3e-15
gi|3420603|gb|AAC31902.1| LsfA [Pseudomonas putida] 84 3e-15
gi|24652434|ref|NP_724931.1| CG12405-PA [Drosophila melanogaster... 84 3e-15
gi|24652436|ref|NP_610584.2| CG12896-PA [Drosophila melanogaster... 84 3e-15
gi|7381260|gb|AAF61460.1| peroxiredoxin antioxidant [Brassica na... 83 4e-15
gi|49081162|ref|XP_404019.1| hypothetical protein UM06404.1 [Ust... 83 6e-15
gi|17545473|ref|NP_518875.1| PROBABLE ANTIOXIDANT (PEROXIDASE) O... 83 6e-15
gi|32410811|ref|XP_325886.1| hypothetical protein [Neurospora cr... 82 8e-15
gi|31199611|ref|XP_308753.1| ENSANGP00000015116 [Anopheles gambi... 82 8e-15
gi|46310668|ref|ZP_00211297.1| COG0450: Peroxiredoxin [Burkholde... 82 1e-14
gi|96711|pir||A35441 alkyl hydroperoxide reductase (EC 1.6.-.-) ... 82 1e-14
gi|48768856|ref|ZP_00273204.1| COG0450: Peroxiredoxin [Ralstonia... 82 1e-14
gi|31240553|ref|XP_320690.1| ENSANGP00000020201 [Anopheles gambi... 82 1e-14
gi|46319504|ref|ZP_00219909.1| COG0450: Peroxiredoxin [Burkholde... 82 1e-14
gi|50424391|ref|XP_460782.1| unnamed protein product [Debaryomyc... 81 2e-14
gi|6646878|gb|AAF21098.1| thioredoxin peroxidase [Brugia malayi] 81 2e-14
gi|50545407|ref|XP_500241.1| hypothetical protein [Yarrowia lipo... 80 3e-14
gi|11139253|gb|AAG31645.1| putative thiol-specific antioxidant p... 80 5e-14
gi|15888804|ref|NP_354485.1| AGR_C_2729p [Agrobacterium tumefaci... 80 5e-14
gi|15428288|gb|AAK97814.1| glutathione peroxidase [Ixodes scapul... 79 6e-14
gi|46126317|ref|XP_387712.1| conserved hypothetical protein [Gib... 79 6e-14
gi|15922428|ref|NP_378097.1| 150aa long hypothetical thioredoxin... 79 6e-14
gi|49618728|gb|AAT67997.1| 1-cys peroxiredoxin [Medicago truncat... 79 6e-14
gi|12229556|sp|O17433|1CPX_DIRIM 1-Cys peroxidoxin (1-CysPxn) >g... 79 8e-14
>gi|17554494|ref|NP_497892.1| peroxiredoxin, thioredoxin-dependent
peroxide reductase, mitochondrial (24.9 kD) (3F499)
[Caenorhabditis elegans]
gi|3024728|sp|Q21824|TDX1_CAEEL Probable thioredoxin peroxidase
(Thioredoxin-dependent peroxide reductase)
(Thiol-specific antioxidant protein)
gi|630729|pir||S43598 mer5 homolog R07E5.2 - Caenorhabditis elegans
gi|3878943|emb|CAA83619.1| Hypothetical protein R07E5.2
[Caenorhabditis elegans]
Length = 226
Score = 466 bits (1199), Expect = e-130
Identities = 226/226 (100%), Positives = 226/226 (100%)
Frame = +1
Query: 1 MFSSAVRALCRTVPTVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVISDQDY 180
MFSSAVRALCRTVPTVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVISDQDY
Sbjct: 1 MFSSAVRALCRTVPTVATRQLSTSRALLSLRPLGPKNTVPAFKGTAVVDGDFKVISDQDY 60
Query: 181 KGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKD 360
KGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKD
Sbjct: 61 KGKWLVMFFYPLDFTFVCPTEIIAYGDRANEFRSLGAEVVACSCDSHFSHLAWVNTPRKD 120
Query: 361 GGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVD 540
GGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVD
Sbjct: 121 GGLGDMDIPLLADFNKKIADSFGVLDKESGLSYRGLFLIDPSGTVRHTTCNDLPVGRSVD 180
Query: 541 ETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVNK 678
ETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVNK
Sbjct: 181 ETLRVLKAFQFSDKHGEVCPADWHEDSPTIKPGVATSKEYFNKVNK 226