Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R07G3_7
(576 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532607|ref|NP_495598.1| cell Division Cycle related, Rho GT... 389 e-107
gi|39596000|emb|CAE67503.1| Hypothetical protein CBG13013 [Caeno... 387 e-106
gi|461710|sp|Q05062|CC42_CAEEL Cell division control protein 42 ... 382 e-105
gi|7438363|pir||S68301 GTP-binding protein - Caenorhabditis eleg... 380 e-104
gi|5882244|gb|AAD55261.1| GTP-binding protein [Wuchereria bancro... 361 5e-99
gi|27923340|gb|AAO27573.1| GTP-binding protein [Brugia malayi] 359 2e-98
gi|11527245|gb|AAG36944.1| Rho GTPase Cdc42 [Xenopus laevis] >gn... 353 9e-97
gi|41055439|ref|NP_956926.1| Cdc42 protein homolog; wu:fb07d08 [... 353 1e-96
gi|48096108|ref|XP_394608.1| similar to CG12530-PA [Apis mellifera] 353 2e-96
gi|17647249|ref|NP_523414.1| CG12530-PA [Drosophila melanogaster... 353 2e-96
gi|31207077|ref|XP_312505.1| ENSANGP00000023777 [Anopheles gambi... 353 2e-96
gi|5457116|gb|AAD43792.1| CDC42 protein [Drosophila melanogaster] 351 6e-96
gi|5457117|gb|AAD43793.1| CDC42 protein [Drosophila melanogaster] 350 8e-96
gi|5457114|gb|AAD43790.1| CDC42 protein [Drosophila melanogaster] 350 1e-95
gi|4757952|ref|NP_001782.1| cell division cycle 42 isoform 1; ce... 350 1e-95
gi|5457112|gb|AAD43788.1| CDC42 protein [Drosophila melanogaster] 350 1e-95
gi|47229249|emb|CAG04001.1| unnamed protein product [Tetraodon n... 350 1e-95
gi|45384262|ref|NP_990379.1| CDC42 protein [Gallus gallus] >gnl|... 350 1e-95
gi|16357472|ref|NP_426359.1| cell division cycle 42 isoform 2; c... 349 2e-95
gi|31542368|ref|NP_741991.2| cell division cycle 42 [Rattus norv... 348 4e-95
gi|30385202|gb|AAP22282.1| Cdc42 [Aplysia californica] 348 4e-95
gi|26342014|dbj|BAC34669.1| unnamed protein product [Mus musculus] 348 4e-95
gi|46310188|gb|AAS87368.1| Rho family small GTP binding protein ... 348 4e-95
gi|46360341|gb|AAS88997.1| cell division cycle protein 42 [Sitob... 347 9e-95
gi|47227396|emb|CAF96945.1| unnamed protein product [Tetraodon n... 347 9e-95
gi|37681755|gb|AAQ97755.1| cell division cycle 42 [Danio rerio] 347 1e-94
gi|4557920|pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cd... 347 1e-94
gi|41054093|ref|NP_956159.1| cell division cycle 42 homolog; cel... 346 2e-94
gi|3036963|dbj|BAA25400.1| CsCDC42 [Ciona savignyi] 346 2e-94
gi|28948832|pdb|1NF3|A Chain A, Structure Of Cdc42 In A Complex ... 346 2e-94
gi|30962115|emb|CAD48472.1| Cdc42 protein [Ciona intestinalis] 345 3e-94
gi|7245832|pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-B... 345 3e-94
gi|30962117|emb|CAD48473.1| Cdc42 protein [Ciona intestinalis] 345 3e-94
gi|2624582|pdb|1AJE| Cdc42 From Human, Nmr, 20 Structures 345 3e-94
gi|20151145|pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FR... 345 3e-94
gi|4389379|pdb|1AN0|A Chain A, Cdc42hs-Gdp Complex >gnl|BL_ORD_I... 345 4e-94
gi|40352859|gb|AAH64792.1| Cdc42 protein [Mus musculus] 345 4e-94
gi|5542168|pdb|1CF4|A Chain A, Cdc42ACK GTPASE-Binding Domain Co... 341 5e-93
gi|7767047|pdb|1E0A|A Chain A, Cdc42 Complexed With The Gtpase B... 339 2e-92
gi|5542163|pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Co... 338 3e-92
gi|24158629|pdb|1GZS|A Chain A, Crystal Structure Of The Complex... 336 2e-91
gi|7546358|pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Com... 336 2e-91
gi|3402095|pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp An... 332 3e-90
gi|23095933|dbj|BAC16312.1| Raichu-1054X [synthetic construct] 330 9e-90
gi|44889622|gb|AAS48414.1| CDC42p [Pneumocystis carinii] 328 6e-89
gi|49067240|ref|XP_397910.1| CC42_CANAL CELL DIVISION CONTROL PR... 326 2e-88
gi|50255149|gb|EAL17887.1| hypothetical protein CNBL0140 [Crypto... 322 3e-87
gi|15072535|gb|AAK77967.1| small GTPase CDC42 [Schizophyllum com... 321 5e-87
gi|19114448|ref|NP_593536.1| cell division control protein 42 ho... 318 4e-86
gi|7188786|gb|AAF37871.1| small GTPase CDC42 [Suillus bovinus] 316 2e-85
gi|5679285|gb|AAD46909.1| Cdc42-1p [Exophiala dermatitidis] 316 2e-85
gi|50287543|ref|XP_446201.1| unnamed protein product [Candida gl... 315 5e-85
gi|50427097|ref|XP_462156.1| unnamed protein product [Debaryomyc... 315 5e-85
gi|3497|emb|CAA36186.1| unnamed protein product [Saccharomyces c... 314 8e-85
gi|6323259|ref|NP_013330.1| Small rho-like GTPase, essential for... 313 1e-84
gi|8132884|gb|AAF73431.1| GTP-binding protein [Magnaporthe grise... 313 1e-84
gi|50302503|ref|XP_451186.1| unnamed protein product [Kluyveromy... 313 2e-84
gi|40787183|gb|AAR90103.1| ras [Brugia malayi] 311 4e-84
gi|7648802|gb|AAF65675.1| Cdc42p [Yarrowia lipolytica] 311 4e-84
gi|45201003|ref|NP_986573.1| AGL093Wp [Eremothecium gossypii] >g... 311 7e-84
gi|46122139|ref|XP_385623.1| CD42_CHICK Cell division control pr... 311 7e-84
gi|3334139|sp|O14426|CC42_CANAL Cell division control protein 42... 310 9e-84
gi|13641190|gb|AAK31624.1| GTPase CDC42 [Colletotrichum trifolii] 309 3e-83
gi|14209917|gb|AAK56917.1| CDC42-like protein CflA [Penicillium ... 306 2e-82
gi|49108622|ref|XP_411624.1| CD42_CHICK Cell division control pr... 303 2e-81
gi|50257420|gb|EAL20129.1| hypothetical protein CNBF4550 [Crypto... 302 3e-81
gi|32411657|ref|XP_326309.1| CELL DIVISION CONTROL PROTEIN 42 HO... 301 4e-81
gi|30027161|gb|AAP06754.1| cdc42 GTPase [Blumeria graminis] 299 2e-80
gi|26245440|gb|AAN77582.1| Cdc42 [Schistosoma mansoni] 290 2e-77
gi|32565662|ref|NP_500362.2| CEll Death abnormality CED-10, RAC ... 287 1e-76
gi|345368|pir||A45324 GTP-binding protein, ras-related - Caenorh... 286 2e-76
gi|47226063|emb|CAG04437.1| unnamed protein product [Tetraodon n... 283 1e-75
gi|30385200|gb|AAP22281.1| Rac [Aplysia californica] 283 2e-75
gi|30962119|emb|CAD48474.1| Rac1 protein [Ciona intestinalis] 282 3e-75
gi|9845511|ref|NP_008839.2| ras-related C3 botulinum toxin subst... 281 6e-75
gi|13279011|gb|AAH04247.1| Ras-related C3 botulinum toxin substr... 280 1e-74
gi|30585149|gb|AAP36847.1| Homo sapiens ras-related C3 botulinum... 280 1e-74
gi|5738220|gb|AAD50299.1| rac GTPase [Xenopus laevis] 280 1e-74
gi|30962121|emb|CAD48475.1| Rac2 protein [Ciona intestinalis] 280 1e-74
gi|190875|gb|AAA36544.1| ras-like protein 280 1e-74
gi|49116820|gb|AAH73303.1| Unknown (protein for MGC:80698) [Xeno... 280 2e-74
gi|12842616|dbj|BAB25667.1| unnamed protein product [Mus musculus] 280 2e-74
gi|27882091|gb|AAH44501.1| Zgc:55823 protein [Danio rerio] >gnl|... 278 4e-74
gi|14277769|pdb|1I4T|D Chain D, Crystal Structure Analysis Of Ra... 278 4e-74
gi|26344958|dbj|BAC36128.1| unnamed protein product [Mus musculus] 278 5e-74
gi|31652313|emb|CAD92550.1| dJ224A6.1.2 (cell division cycle 42 ... 278 5e-74
gi|31213011|ref|XP_315449.1| ENSANGP00000014228 [Anopheles gambi... 278 7e-74
gi|49903967|gb|AAH76433.1| Zgc:100831 protein [Danio rerio] 278 7e-74
gi|50728780|ref|XP_416280.1| PREDICTED: similar to Rac2 protein ... 277 9e-74
gi|37779070|gb|AAP20195.1| ras-related C3 botulinum toxin substr... 277 1e-73
gi|4506381|ref|NP_002863.1| ras-related C3 botulinum toxin subst... 276 1e-73
gi|11513661|pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX 276 1e-73
gi|30584041|gb|AAP36269.1| Homo sapiens ras-related C3 botulinum... 276 1e-73
gi|28461213|ref|NP_786986.1| ras-related C3 botulinum toxin subs... 276 2e-73
gi|15826630|pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In ... 276 2e-73
gi|50344776|ref|NP_001002061.1| zgc:86686 [Danio rerio] >gnl|BL_... 276 2e-73
gi|4826962|ref|NP_005043.1| ras-related C3 botulinum toxin subst... 276 2e-73
gi|45384328|ref|NP_990347.1| GTPase cRac1B [Gallus gallus] >gnl|... 275 3e-73
gi|17136856|ref|NP_476950.1| CG2248-PA [Drosophila melanogaster]... 275 3e-73
gi|6679601|ref|NP_033034.1| RAS-related C3 botulinum substrate 2... 275 3e-73
gi|2118452|pir||I45715 GTP-binding protein Rac1 - fruit fly (Dro... 275 4e-73
gi|13096378|pdb|1G4U|R Chain R, Crystal Structure Of The Salmone... 273 2e-72
gi|624236|gb|AAA67040.1| Rac1 gene product 273 2e-72
gi|32892148|gb|AAP89013.1| RAC1 [Colletotrichum trifolii] 273 2e-72
gi|6012993|emb|CAB57327.1| hypothetical protein [Homo sapiens] 273 2e-72
gi|50553983|ref|XP_504400.1| hypothetical protein [Yarrowia lipo... 272 3e-72
gi|12841184|dbj|BAB25109.1| unnamed protein product [Mus musculus] 272 4e-72
gi|21667516|gb|AAM74083.1| Rac1 GTP binding protein [Ustilago ma... 272 4e-72
gi|2914478|pdb|1MH1| Small G-Protein 271 6e-72
gi|22043610|ref|XP_171081.1| similar to ras-related C3 botulinum... 271 6e-72
gi|13096548|pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Com... 271 8e-72
gi|49068200|ref|XP_398389.1| hypothetical protein UM00774.1 [Ust... 271 8e-72
gi|2500186|sp|Q24814|RACA_ENTHI RAS-related protein racA >gnl|BL... 271 8e-72
gi|49094838|ref|XP_408880.1| hypothetical protein AN4743.2 [Aspe... 270 1e-71
gi|46129344|ref|XP_389033.1| hypothetical protein FG08857.1 [Gib... 270 1e-71
gi|38100351|gb|EAA47488.1| hypothetical protein MG02731.4 [Magna... 270 2e-71
gi|13878932|sp|P34144|RC1A_DICDI RAS-related protein rac1A >gnl|... 270 2e-71
gi|9845509|ref|NP_061485.1| ras-related C3 botulinum toxin subst... 270 2e-71
gi|23095931|dbj|BAC16311.1| Raichu-1011X [synthetic construct] 269 2e-71
gi|21356563|ref|NP_648121.1| CG8556-PA [Drosophila melanogaster]... 269 2e-71
gi|13633384|sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin ... 268 4e-71
gi|290047|gb|AAC37391.1| Rac1A protein >gnl|BL_ORD_ID|1216010 gi... 268 4e-71
gi|7188824|gb|AAF37890.1| small GTPase Rac1 [Suillus bovinus] 268 7e-71
gi|13096779|pdb|1HE1|C Chain C, Crystal Structure Of The Complex... 267 9e-71
gi|16758286|ref|NP_445974.1| ras homolog gene family, member Q [... 267 1e-70
gi|33604095|gb|AAH56154.2| ARHQ protein [Homo sapiens] 266 2e-70
gi|20278859|dbj|BAB91068.1| small GTPase Tc10 [Mus musculus] 266 2e-70
gi|50263042|ref|NP_036381.2| ras-like protein TC10; RAS-like, fa... 266 2e-70
gi|40807036|gb|AAH65291.1| ARHQ protein [Homo sapiens] 266 2e-70
gi|3599485|gb|AAC35359.1| ras-related protein [Cavia porcellus] 266 2e-70
gi|134080|sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein R... 266 2e-70
gi|47124642|gb|AAH70485.1| RHOQ protein [Homo sapiens] 266 2e-70
gi|37181081|gb|AAQ88447.1| small GTPase rac1p [Schizophyllum com... 266 2e-70
gi|41054189|ref|NP_956112.1| ras-like protein TC10; wu:fi15a09 [... 265 3e-70
gi|2118453|pir||S54295 GTP-binding protein Rac1 - fruit fly (Dro... 265 3e-70
gi|45383243|ref|NP_989792.1| Rho small GTPase TC10 [Gallus gallu... 265 4e-70
gi|50259409|gb|EAL22082.1| hypothetical protein CNBC2200 [Crypto... 265 6e-70
gi|50254884|gb|EAL17625.1| hypothetical protein CNBM0090 [Crypto... 264 1e-69
gi|42543638|pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Gen... 263 1e-69
gi|13878933|sp|P34146|RC1C_DICDI RAS-related protein rac1C >gnl|... 263 2e-69
gi|12007286|gb|AAG45110.1| Rac1B [Dictyostelium discoideum] 262 3e-69
gi|38230174|gb|AAR14182.1| Rho family GTPase [Fucus distichus] 262 3e-69
gi|25992183|gb|AAN77094.1| CDC42-like protein CflB [Penicillium ... 261 8e-69
gi|464535|sp|P34145|RC1B_DICDI RAS-related protein rac1B >gnl|BL... 259 3e-68
gi|41125721|ref|XP_209429.4| similar to ARHQ protein [Homo sapiens] 259 3e-68
gi|17541974|ref|NP_502935.1| RAC related (rac-2) [Caenorhabditis... 258 7e-68
gi|17541972|ref|NP_502936.1| RAC related (rac-2) [Caenorhabditis... 257 9e-68
gi|27501389|ref|XP_210062.1| similar to Ras-related C3 botulinum... 255 5e-67
gi|47218017|emb|CAG11422.1| unnamed protein product [Tetraodon n... 254 6e-67
gi|464538|sp|P34148|RACB_DICDI RAS-related protein racB >gnl|BL_... 254 6e-67
gi|183709|gb|AAA35941.1| small G protein 254 8e-67
gi|46440527|gb|EAK99832.1| hypothetical protein CaO19.13617 [Can... 252 3e-66
gi|9972758|sp|O94103|CC42_COLGL Cell division control protein 42... 252 3e-66
gi|47221702|emb|CAG10174.1| unnamed protein product [Tetraodon n... 251 7e-66
gi|17569065|ref|NP_509931.1| abnormal cell MIGration MIG-2, ras-... 250 1e-65
gi|13432036|gb|AAG12157.1| GTPase Rho3 [Aspergillus fumigatus] 250 1e-65
gi|50748808|ref|XP_421413.1| PREDICTED: similar to raslp2 [Gallu... 249 2e-65
gi|49256197|gb|AAH74226.1| Unknown (protein for MGC:83410) [Xeno... 249 2e-65
gi|26245442|gb|AAN77583.1| Rac GTPase [Schistosoma mansoni] 248 4e-65
gi|33150588|gb|AAP97172.1| raslp2 [Homo sapiens] 248 6e-65
gi|16903164|ref|NP_065714.1| TC10-like Rho GTPase; RAS-like, fam... 248 6e-65
gi|39594750|emb|CAE70618.1| Hypothetical protein CBG17302 [Caeno... 248 6e-65
gi|17738249|ref|NP_524533.1| CG5588-PB [Drosophila melanogaster]... 248 6e-65
gi|15824687|gb|AAL09441.1| GTPase ARHJ [Mus musculus] 246 2e-64
gi|27665774|ref|XP_216737.1| similar to ras homolog gene family,... 246 2e-64
gi|9968513|emb|CAC06700.1| TC10-like Rho GTPase [Mus musculus] 246 2e-64
gi|13489097|ref|NP_075764.1| ras homolog gene family, member J; ... 246 2e-64
gi|290051|gb|AAC37393.1| Rac1C protein >gnl|BL_ORD_ID|1034335 gi... 245 4e-64
gi|32484284|gb|AAH54464.1| Arhj protein [Mus musculus] 244 6e-64
gi|37589358|gb|AAH59300.1| MGC68933 protein [Xenopus laevis] 244 8e-64
gi|41053313|ref|NP_956334.1| ras homolog gene family, member G; ... 244 1e-63
gi|30962137|emb|CAD48483.1| TC10 protein [Ciona intestinalis] 243 2e-63
gi|31242215|ref|XP_321538.1| ENSANGP00000022835 [Anopheles gambi... 241 5e-63
gi|30962131|emb|CAD48480.1| Rcl1 protein [Ciona intestinalis] 241 5e-63
gi|2144595|pir||TVHURG GTP-binding protein rhoG - human >gnl|BL_... 240 1e-62
gi|27923834|sp|O76321|RECG_ENTHI RAS-related protein racG >gnl|B... 240 2e-62
gi|9625037|ref|NP_062512.1| ras homolog gene family, member G; S... 239 2e-62
gi|19571841|emb|CAD27475.1| putative RHO small GTPase [Anopheles... 239 3e-62
gi|41054413|ref|NP_955986.1| ras homolog gene family, member G; ... 239 3e-62
gi|2500189|sp|Q24817|RACD_ENTHI RAS-related protein racD >gnl|BL... 239 3e-62
gi|13878672|sp|O96390|RCF1_DICDI RAS-related protein racF1 >gnl|... 238 4e-62
gi|13878690|sp|Q9GPS3|RCF2_DICDI RAS-related protein racF2 >gnl|... 238 6e-62
gi|41053433|ref|NP_956974.1| hypothetical protein MGC66008 [Dani... 237 1e-61
gi|20379122|gb|AAM21121.1| small GTP binding protein RhoG [Homo ... 237 1e-61
gi|50423877|ref|XP_460523.1| unnamed protein product [Debaryomyc... 237 1e-61
gi|6012995|emb|CAB57328.1| hypothetical protein [Homo sapiens] 236 2e-61
gi|30962129|emb|CAD48479.1| Rac5 protein [Ciona intestinalis] 236 2e-61
gi|47211360|emb|CAF95379.1| unnamed protein product [Tetraodon n... 234 6e-61
gi|17541978|ref|NP_502937.1| RAC related (rac-2) [Caenorhabditis... 234 8e-61
gi|7505228|pir||T23283 hypothetical protein K03D3.10 - Caenorhab... 234 1e-60
gi|2500187|sp|Q24815|RACB_ENTHI RAS-RELATED PROTEIN RACB >gnl|BL... 232 3e-60
gi|2833287|sp|Q17031|CC42_ANOGA CDC42 homolog (25 kDa GTP-bindin... 232 3e-60
gi|11034843|ref|NP_067028.1| ras homolog gene family, member U; ... 231 7e-60
gi|12007295|gb|AAG45116.1| RacB [Dictyostelium discoideum] 230 1e-59
gi|19923060|ref|NP_598716.1| ras homolog gene family, member U; ... 230 2e-59
gi|30962133|emb|CAD48481.1| Rcl2 protein [Ciona intestinalis] 229 2e-59
gi|464539|sp|P34149|RACC_DICDI RAS-related protein racC >gnl|BL_... 229 3e-59
gi|30962127|emb|CAD48478.1| Rac4 protein [Ciona intestinalis] 228 5e-59
gi|29841326|gb|AAP06358.1| similar to GenBank Accession Number A... 227 1e-58
gi|47217310|emb|CAG12518.1| unnamed protein product [Tetraodon n... 225 4e-58
gi|50546949|ref|XP_500944.1| hypothetical protein [Yarrowia lipo... 223 1e-57
gi|30962123|emb|CAD48476.1| Rac3a protein [Ciona intestinalis] 223 2e-57
gi|30962125|emb|CAD48477.1| Rac3b protein [Ciona intestinalis] 222 4e-57
gi|19388021|gb|AAH25842.1| Rac3 protein [Mus musculus] 221 7e-57
gi|4588758|gb|AAD26198.1| rac-like GTP binding protein [Physcomi... 218 5e-56
gi|13878934|sp|P34147|RACA_DICDI RAS-related protein racA >gnl|B... 218 6e-56
gi|32309512|gb|AAP79439.1| Rac1-related protein [Trichomonas vag... 218 6e-56
gi|5532522|gb|AAD44768.1| Rac-like GTP binding protein [Physcomi... 218 6e-56
gi|15236247|ref|NP_195228.1| Rac-like GTP-binding protein (ARAC3... 218 8e-56
gi|6822324|gb|AAF28764.1| small GTP binding protein RACDP [Oryza... 217 1e-55
gi|38524283|emb|CAD27895.1| putative RACD protein [Hordeum vulga... 217 1e-55
gi|47217165|emb|CAG11001.1| unnamed protein product [Tetraodon n... 216 2e-55
gi|4097583|gb|AAD00118.1| NTGP3 [Nicotiana tabacum] >gnl|BL_ORD_... 216 2e-55
gi|28393687|gb|AAO42256.1| putative Rho1Ps homolog Rac protein [... 216 2e-55
gi|15230443|ref|NP_190698.1| Rac-like GTP-binding protein (ARAC1... 216 2e-55
gi|20269983|gb|AAM18133.1| small G-protein ROP3 [Medicago trunca... 215 4e-55
gi|2117168|emb|CAA98189.1| RAC1 [Lotus corniculatus var. japonicus] 215 4e-55
gi|9651980|gb|AAF91343.1| small GTP-binding protein RACBP [Oryza... 215 5e-55
gi|14278856|gb|AAK31299.1| Rac-like GTPase 1 [Nicotiana tabacum] 215 5e-55
gi|15227902|ref|NP_179371.1| Rac-like GTP-binding protein (ARAC1... 215 5e-55
gi|11274340|pir||JC7295 RacB protein - maize >gnl|BL_ORD_ID|5085... 215 5e-55
gi|1732519|gb|AAB38780.1| Rho1Ps homolog [Arabidopsis thaliana] 215 5e-55
gi|7243743|gb|AAF43429.1| rac 1 protein [Physcomitrella patens] 214 7e-55
gi|47600747|emb|CAG30067.1| small GTPase Rac4 [Medicago sativa] 214 7e-55
gi|27413417|gb|AAO11654.1| putative ROP family GTPase [Brassica ... 214 7e-55
gi|11274342|pir||JC7296 RacD protein - maize >gnl|BL_ORD_ID|1419... 214 7e-55
gi|2500197|sp|Q41253|RACD_GOSHI RAC-like GTP binding protein RAC... 214 7e-55
gi|15223765|ref|NP_173437.1| Rac-like GTP-binding protein (ARAC4... 214 7e-55
gi|4586584|dbj|BAA76424.1| rac-type small GTP-binding protein [C... 214 9e-55
gi|50415365|gb|AAH78037.1| Unknown (protein for MGC:82774) [Xeno... 214 1e-54
gi|50417995|gb|AAH77840.1| Unknown (protein for MGC:80531) [Xeno... 214 1e-54
gi|20269985|gb|AAM18134.1| small G-protein ROP6 [Medicago trunca... 214 1e-54
gi|2500199|sp|Q35638|RAC1_PEA RAC-like GTP binding protein RHO1 ... 214 1e-54
gi|15222879|ref|NP_177712.1| Rac-like GTP-binding protein (ARAC5... 214 1e-54
gi|2133397|pir||PC4200 GTP-binding protein racB - Entamoeba hist... 214 1e-54
gi|6522820|emb|CAB62075.1| rac G-Protein [Medicago sativa] 213 2e-54
gi|20269987|gb|AAM18135.1| small G-protein ROP9 [Medicago trunca... 213 2e-54
gi|19171526|emb|CAC83043.2| RACB protein [Hordeum vulgare subsp.... 213 2e-54
gi|4097581|gb|AAD00117.1| NTGP2 [Nicotiana tabacum] >gnl|BL_ORD_... 213 2e-54
gi|15233418|ref|NP_195320.1| Rac-like GTP-binding protein (ARAC6... 213 2e-54
gi|7438393|pir||T14384 small GTP binding protein, rac-type - tur... 213 2e-54
gi|2500188|sp|Q24816|RACC_ENTHI RAS-related protein racC >gnl|BL... 213 3e-54
gi|4585792|emb|CAA10815.2| Rop subfamily GTPase [Nicotiana tabacum] 212 3e-54
gi|26106075|dbj|BAC41518.1| Rac GTPase [Zinnia elegans] 212 3e-54
gi|4097565|gb|AAD00114.1| ATGP3 [Arabidopsis thaliana] 212 3e-54
gi|34421680|gb|AAD47828.2| RAC-like G-protein Rac1 [Gossypium hi... 212 3e-54
gi|2500195|sp|Q39435|RAC1_BETVU RAC-like GTP binding protein RHO... 212 4e-54
gi|49619167|gb|AAT68168.1| ras-related C3 botulinum toxin substr... 212 4e-54
gi|17541992|ref|NP_502959.1| small GTP-binding protein RHO RHO-1... 212 4e-54
gi|2654009|gb|AAC78242.1| Rho-like GTP binding protein [Arabidop... 212 4e-54
gi|50553756|ref|XP_504289.1| RHO1 [Yarrowia lipolytica] >gnl|BL_... 212 4e-54
gi|15237352|ref|NP_199409.1| Rac-like GTP-binding protein (ARAC2... 211 6e-54
gi|5902930|dbj|BAA84494.1| small GTP-binding protein OsRac3 [Ory... 211 8e-54
gi|19909069|gb|AAM03110.1| Rho1 GTP-binding protein [Mucor rouxii] 211 8e-54
gi|41777352|gb|AAQ93069.2| Rho1 GTPase [Paracoccidioides brasili... 211 1e-53
gi|38502276|emb|CAD57742.1| RAC-ROP-like G-protein [Hordeum vulg... 211 1e-53
gi|14030771|gb|AAK53060.1| putative Rop family GTPase ROP5 [Oryz... 210 1e-53
gi|27413419|gb|AAO11655.1| putative ROP family GTPase [Brassica ... 210 1e-53
gi|27413411|gb|AAO11651.1| putative ROP family GTPase [Brassica ... 210 1e-53
gi|27413413|gb|AAO11652.1| putative ROP family GTPase [Brassica ... 210 1e-53
gi|31210169|ref|XP_314051.1| ENSANGP00000015684 [Anopheles gambi... 210 1e-53
gi|27527523|emb|CAD42725.1| putative rac protein [Nicotiana taba... 210 1e-53
gi|2500198|sp|Q40220|RAC2_LOTJA RAC-like GTP binding protein RAC... 210 1e-53
gi|49096834|ref|XP_409877.1| hypothetical protein AN5740.2 [Aspe... 210 2e-53
gi|2500196|sp|Q41254|RAC9_GOSHI RAC-like GTP binding protein RAC... 210 2e-53
gi|38524285|emb|CAD27896.1| putative ROP4 protein [Hordeum vulga... 209 2e-53
gi|13878935|sp|P34150|RACD_DICDI RAS-related protein racD >gnl|B... 209 2e-53
gi|290045|gb|AAC37390.1| RacD protein >gnl|BL_ORD_ID|483817 gi|7... 209 3e-53
gi|38111209|gb|EAA56821.1| hypothetical protein MG07176.4 [Magna... 209 3e-53
gi|27413409|gb|AAO11650.1| putative ROP family GTPase [Brassica ... 209 4e-53
gi|14165241|gb|AAK55445.1| putative Rop family GTPase ROP4 [Oryz... 209 4e-53
gi|50603708|gb|AAH78068.1| Unknown (protein for MGC:82924) [Xeno... 208 5e-53
gi|45332272|gb|AAS58058.1| RhoA [Tigriopus japonicus] 208 5e-53
gi|17137100|ref|NP_477098.1| CG8416-PA [Drosophila melanogaster]... 208 5e-53
gi|48138396|ref|XP_393401.1| similar to ENSANGP00000015684 [Apis... 208 5e-53
gi|28302169|gb|AAH46656.1| MGC52893 protein [Xenopus laevis] 208 6e-53
gi|25294127|pir||T51962 Rac-like GTP binding protein [imported] ... 208 6e-53
gi|50251424|dbj|BAD28462.1| putative RacD protein [Oryza sativa ... 208 6e-53
gi|19924081|ref|NP_612551.1| ras homolog gene family, member V; ... 207 8e-53
gi|27413415|gb|AAO11653.1| putative ROP family GTPase [Brassica ... 207 8e-53
gi|3334315|sp|O42825|RHO1_CANAL RHO1 protein >gnl|BL_ORD_ID|1943... 207 8e-53
gi|48766843|gb|AAT46562.1| Rho [Marsupenaeus japonicus] 207 1e-52
gi|29249145|gb|EAA40663.1| GLP_456_59757_59101 [Giardia lamblia ... 207 1e-52
gi|19114543|ref|NP_593631.1| rho1 protein paralogue; ras family ... 207 1e-52
gi|14030769|gb|AAK53059.1| putative Rop family GTPase ROP8 [Zea ... 207 1e-52
gi|21704044|ref|NP_663505.1| ras homolog gene family, member V [... 206 2e-52
gi|16508170|gb|AAL17966.1| Rho family GTPase Chp [Homo sapiens] 206 2e-52
gi|20070360|ref|NP_598378.2| ras homolog gene family, member V; ... 206 2e-52
gi|7438368|pir||T06679 GTP-binding protein Arac8 - Arabidopsis t... 206 2e-52
gi|11274344|pir||JC7297 RacA protein - maize >gnl|BL_ORD_ID|2171... 206 2e-52
gi|13385790|ref|NP_080570.1| RIKEN cDNA 4930544G11 [Mus musculus... 206 2e-52
gi|30962113|emb|CAD48471.1| RhoA protein [Ciona intestinalis] 206 2e-52
gi|47228644|emb|CAG07376.1| unnamed protein product [Tetraodon n... 206 2e-52
gi|18408564|ref|NP_566897.1| Rac-like GTP-binding protein (ARAC8... 206 2e-52
gi|7262647|gb|AAF43923.1| Rac-like protein Rop1 [Tradescantia vi... 206 2e-52
gi|11527801|dbj|BAB18640.1| GTP-binding protein like 1 [Xenopus ... 206 3e-52
gi|8979884|emb|CAB96794.1| putative Rop family GTPase ROP5 [Zea ... 206 3e-52
gi|47228611|emb|CAG07343.1| unnamed protein product [Tetraodon n... 205 4e-52
gi|16923986|ref|NP_476473.1| aplysia ras-related homolog A2 [Rat... 205 4e-52
gi|13878689|sp|Q9GPS0|RACG_DICDI RAS-related protein racG >gnl|B... 205 5e-52
gi|307375|gb|AAA50612.1| multidrug resistance protein 205 5e-52
gi|10835049|ref|NP_001655.1| ras homolog gene family, member A; ... 205 5e-52
gi|6721101|gb|AAF26755.1| T4O12.8 [Arabidopsis thaliana] 205 5e-52
gi|30962139|emb|CAD48484.1| Wrch protein [Ciona intestinalis] 204 7e-52
gi|47211651|emb|CAF94988.1| unnamed protein product [Tetraodon n... 204 7e-52
gi|45382667|ref|NP_990035.1| RhoA GTPase [Gallus gallus] >gnl|BL... 204 7e-52
gi|4218983|gb|AAD12256.1| GTP-binding protein [Gallus gallus] 204 7e-52
gi|50549595|ref|XP_502268.1| YlRHO1 [Yarrowia lipolytica] >gnl|B... 204 9e-52
gi|9887220|gb|AAG01806.1| GTP-binding protein [Yarrowia lipolytica] 204 9e-52
gi|5163414|gb|AAD40671.1| small Rho-like GTPase RhoA [Xenopus la... 204 9e-52
gi|28395033|ref|NP_786886.1| ras homolog gene family, member C; ... 204 9e-52
gi|47229669|emb|CAG06865.1| unnamed protein product [Tetraodon n... 204 9e-52
gi|27660254|ref|XP_215659.1| similar to Transforming protein Rho... 204 9e-52
gi|37805323|gb|AAH60193.1| Unknown (protein for MGC:73439) [Mus ... 204 9e-52
gi|48104384|ref|XP_395770.1| similar to GTP-binding protein like... 204 1e-51
gi|19115402|ref|NP_594490.1| rho1 protein [Schizosaccharomyces p... 204 1e-51
gi|21321628|gb|AAM47281.1| small GTPase RhoA [Xenopus laevis] 204 1e-51
gi|132535|sp|P24406|RHOA_CANFA Transforming protein RhoA (Rho1) ... 204 1e-51
gi|11274346|pir||JC7298 racC protein - maize >gnl|BL_ORD_ID|7253... 204 1e-51
gi|132545|sp|P01122|RHO_APLCA RAS-like GTP-binding protein RHO >... 203 2e-51
gi|28278280|gb|AAH44696.1| Arha2-prov protein [Xenopus laevis] 203 2e-51
gi|18406605|ref|NP_566024.1| Rac-like GTP-binding protein (ARAC9... 203 2e-51
gi|6680728|ref|NP_031510.1| ras homolog gene family, member C; a... 203 2e-51
gi|33991745|gb|AAH56556.1| Zgc:66058 protein [Danio rerio] >gnl|... 203 2e-51
gi|2981782|pdb|1FTN| Crystal Structure Of The Human RhoaGDP COM... 203 2e-51
gi|47087003|ref|NP_998515.1| zgc:63939 [Danio rerio] >gnl|BL_ORD... 203 2e-51
gi|26106073|dbj|BAC41517.1| Rac small GTPase [Zinnia elegans] 203 2e-51
gi|28828297|gb|AAO50961.1| similar to Dictyostelium discoideum (... 203 2e-51
gi|38505165|ref|NP_942126.1| ras-related C3 botulinum toxin subs... 203 2e-51
gi|32450470|gb|AAH53772.1| MGC64296 protein [Xenopus laevis] 202 3e-51
gi|47220729|emb|CAG11798.1| unnamed protein product [Tetraodon n... 202 3e-51
gi|15235495|ref|NP_194624.1| Rac-like GTP-binding protein (ARAC7... 202 3e-51
gi|3237320|gb|AAC23710.1| Rho family GTPase [Mus musculus] 202 4e-51
gi|290039|gb|AAC37387.1| RacA protein >gnl|BL_ORD_ID|1396024 gi|... 202 4e-51
gi|46117116|ref|XP_384576.1| hypothetical protein FG04400.1 [Gib... 202 4e-51
gi|45185091|ref|NP_982808.1| ABL139Cp [Eremothecium gossypii] >g... 202 4e-51
gi|49902749|gb|AAH75938.1| Unknown (protein for MGC:92206) [Dani... 202 5e-51
gi|41055843|ref|NP_957444.1| similar to ras homolog gene family,... 202 5e-51
gi|47086547|ref|NP_997914.1| small GTPase RhoA [Danio rerio] >gn... 202 5e-51
gi|32996719|ref|NP_872611.1| RSA-14-44 protein [Rattus norvegicu... 202 5e-51
gi|4757764|ref|NP_004031.1| ras homolog gene family, member B; o... 202 5e-51
gi|13432032|gb|AAG12155.1| GTPase Rho1 [Aspergillus fumigatus] 201 6e-51
gi|6980757|pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp... 201 6e-51
gi|19848942|gb|AAL99390.1| GTP-binding protein SB128 [Homo sapiens] 201 8e-51
gi|32417744|ref|XP_329350.1| hypothetical protein ( (AF385833) R... 201 8e-51
gi|15293426|gb|AAK94951.1| GTPase rho1 [Blumeria graminis] 201 8e-51
gi|49074510|ref|XP_401384.1| hypothetical protein UM03769.1 [Ust... 201 8e-51
gi|15241992|ref|NP_201093.1| Rac-like GTP-binding protein (ARAC1... 201 8e-51
gi|21466025|pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And... 201 1e-50
gi|50539958|ref|NP_001002445.1| zgc:92350 [Danio rerio] >gnl|BL_... 201 1e-50
gi|49079398|ref|XP_403349.1| hypothetical protein UM05734.1 [Ust... 201 1e-50
gi|45382499|ref|NP_990240.1| GTP-binding protein [Gallus gallus]... 201 1e-50
gi|37665520|dbj|BAC99017.1| Raichu-1237X [synthetic construct] 201 1e-50
gi|37718739|tpg|DAA01138.1| TPA: Ras-related small GTPase [Homo ... 200 1e-50
gi|7243745|gb|AAF43430.1| rac 4 protein [Physcomitrella patens] 200 1e-50
gi|50748265|ref|XP_426425.1| PREDICTED: similar to Rho family GT... 200 1e-50
gi|50415172|ref|XP_457455.1| unnamed protein product [Debaryomyc... 200 2e-50
gi|50306915|ref|XP_453433.1| unnamed protein product [Kluyveromy... 199 2e-50
gi|38502278|emb|CAD57743.1| RAC-ROP-like G-protein [Hordeum vulg... 199 3e-50
gi|45185413|ref|NP_983130.1| ABR182Wp [Eremothecium gossypii] >g... 199 3e-50
gi|45185414|ref|NP_983131.1| ABR183Wp [Eremothecium gossypii] >g... 199 4e-50
gi|34904284|ref|NP_913489.1| unnamed protein product [Oryza sati... 198 5e-50
gi|8979882|emb|CAB96793.1| putative Rop family GTPase, ROP6 [Zea... 198 5e-50
gi|47575740|ref|NP_001001214.1| hypothetical protein MGC69411 [X... 198 7e-50
gi|46015651|pdb|1S1C|A Chain A, Crystal Structure Of The Complex... 198 7e-50
gi|4519678|dbj|BAA75688.1| Rho1 GTPase [Hemicentrotus pulcherrimus] 197 9e-50
gi|6325423|ref|NP_015491.1| Gtp-binding protein of the rho subfa... 197 1e-49
gi|42656970|ref|XP_377847.1| similar to ras-related C3 botulinum... 197 1e-49
gi|38524281|emb|CAD27894.1| putative ROP6 protein [Hordeum vulga... 196 2e-49
gi|8979880|emb|CAB96792.1| putative Rop family GTPase, ROP7 [Zea... 196 2e-49
gi|5902928|dbj|BAA84493.1| small GTP-binding protein OsRac2 [Ory... 196 3e-49
gi|50304105|ref|XP_452002.1| unnamed protein product [Kluyveromy... 196 3e-49
gi|31210171|ref|XP_314052.1| ENSANGP00000024640 [Anopheles gambi... 195 4e-49
gi|17737865|ref|NP_524292.1| CG9366-PA [Drosophila melanogaster]... 195 4e-49
gi|21780200|gb|AAM77656.1| rho GTPase-like protein [Schistosoma ... 195 4e-49
gi|13878688|sp|Q9GPR7|RACH_DICDI RAS-related protein racH >gnl|B... 195 6e-49
gi|50290369|ref|XP_447616.1| unnamed protein product [Candida gl... 194 7e-49
gi|4877954|gb|AAD31508.1| Rho GTPase [Schistosoma mansoni] >gnl|... 194 7e-49
gi|3318980|pdb|1A2B| Human Rhoa Complexed With Gtp Analogue >gn... 194 7e-49
gi|132546|sp|P22122|RHO_DISOM RAS-like GTP-binding protein O-RHO... 194 1e-48
gi|2131910|pir||S63135 hypothetical protein YNL180c - yeast (Sac... 194 1e-48
gi|2225894|dbj|BAA20863.1| RhoA [Rattus norvegicus] 194 1e-48
gi|6324149|ref|NP_014219.1| Rho family of small GTPases; Rho5p [... 194 1e-48
gi|30749373|pdb|1KMQ|A Chain A, Crystal Structure Of A Constitut... 193 2e-48
gi|6517217|dbj|BAA87881.1| Drac3 [Drosophila melanogaster] 193 2e-48
gi|38074841|ref|XP_194026.2| similar to plysia ras-related homol... 193 2e-48
gi|27525290|emb|CAC82554.1| ras-like GTP-binding protein rhoa [C... 193 2e-48
gi|26245436|gb|AAN77580.1| Rho2 GTPase [Schistosoma mansoni] 193 2e-48
gi|9257040|pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Fo... 192 5e-48
gi|49619169|gb|AAT68169.1| small GTP-binding protein RhoA; ras h... 191 1e-47
gi|2500185|sp|Q23862|RACE_DICDI RAS-related protein racE >gnl|BL... 190 1e-47
gi|50415618|gb|AAH78131.1| Unknown (protein for MGC:84534) [Xeno... 190 1e-47
gi|50756383|ref|XP_415141.1| PREDICTED: similar to Rho-related G... 189 3e-47
gi|3660276|pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX 189 4e-47
gi|31207629|ref|XP_312781.1| ENSANGP00000020445 [Anopheles gambi... 188 5e-47
gi|3641690|dbj|BAA33396.1| CnRho1 [Cryptococcus neoformans var. ... 187 2e-46
gi|27527525|emb|CAD42726.1| putative rac protein [Nicotiana taba... 186 2e-46
gi|39588146|emb|CAE68070.1| Hypothetical protein CBG13699 [Caeno... 186 3e-46
gi|47219152|emb|CAG01815.1| unnamed protein product [Tetraodon n... 186 3e-46
gi|13878685|sp|Q9GPQ8|RACL_DICDI RAS-related protein racL >gnl|B... 184 1e-45
gi|50256867|gb|EAL19585.1| hypothetical protein CNBG2140 [Crypto... 184 1e-45
gi|14275894|dbj|BAB58893.1| rac-like protein A [Giardia intestin... 184 1e-45
gi|3184518|gb|AAC18964.1| GTPase cRhoC [Gallus gallus] 183 2e-45
gi|1850601|gb|AAB68394.1| Rac-like protein [Arabidopsis thaliana] 182 3e-45
gi|47225036|emb|CAF97451.1| unnamed protein product [Tetraodon n... 180 2e-44
gi|29841145|gb|AAP06158.1| similar to GenBank Accession Number M... 179 2e-44
gi|50546757|ref|XP_500848.1| hypothetical protein [Yarrowia lipo... 178 5e-44
gi|32418658|ref|XP_329807.1| hypothetical protein [Neurospora cr... 177 9e-44
gi|32404104|ref|XP_322665.1| hypothetical protein [Neurospora cr... 176 2e-43
gi|18376342|emb|CAD21120.1| probable RHO1 PROTEIN [Neurospora cr... 176 2e-43
gi|7656900|ref|NP_055393.1| ras homolog D; ras homolog gene fami... 176 2e-43
gi|38016957|ref|NP_061907.2| ras homolog gene family, member F [... 174 8e-43
gi|47223665|emb|CAF99274.1| unnamed protein product [Tetraodon n... 173 2e-42
gi|50257180|gb|EAL19893.1| hypothetical protein CNBG0360 [Crypto... 173 2e-42
gi|41017712|sp|Q874R1|RHO4_SCHPO Rho4 protein >gnl|BL_ORD_ID|365... 172 3e-42
gi|46105352|ref|XP_380480.1| hypothetical protein FG00304.1 [Gib... 172 3e-42
gi|337393|gb|AAA36565.1| rho protein 172 3e-42
gi|40549130|gb|AAR87661.1| Rho2 GTPase [Paracoccidioides brasili... 172 3e-42
gi|19114956|ref|NP_594044.1| rho1-like protein. [Schizosaccharom... 172 3e-42
gi|41017782|sp|Q96WY0|RHOC_EMENI RhoC protein (Rho3 protein homo... 172 4e-42
gi|38103445|gb|EAA50142.1| hypothetical protein MG03901.4 [Magna... 172 4e-42
gi|49090726|ref|XP_406824.1| hypothetical protein AN2687.2 [Aspe... 172 4e-42
gi|19115481|ref|NP_594569.1| rho2 protein [Schizosaccharomyces p... 172 4e-42
gi|28201958|ref|NP_780301.1| ras homolog gene family, member f; ... 171 9e-42
gi|7020212|dbj|BAA91034.1| unnamed protein product [Homo sapiens] 171 9e-42
gi|49899204|gb|AAH75783.1| Unknown (protein for MGC:86879) [Dani... 171 9e-42
gi|27661195|ref|XP_215193.1| similar to RHOD [Rattus norvegicus] 169 4e-41
gi|6671573|ref|NP_031511.1| ras homolog D; aplysia ras-related h... 169 4e-41
gi|7438367|pir||T01596 GTP-binding protein At2g44690 - Arabidops... 166 3e-40
gi|38078678|ref|XP_355511.1| similar to plysia ras-related homol... 165 5e-40
gi|49095258|ref|XP_409090.1| conserved hypothetical protein [Asp... 164 1e-39
gi|439540|gb|AAA57056.1| guanine nucleotide regulatory protein 163 2e-39
gi|50302629|ref|XP_451250.1| unnamed protein product [Kluyveromy... 163 2e-39
gi|46116452|ref|XP_384244.1| conserved hypothetical protein [Gib... 162 3e-39
gi|13940163|emb|CAC37796.1| small GTP-binding protein [Hordeum v... 162 5e-39
gi|47213020|emb|CAF93507.1| unnamed protein product [Tetraodon n... 161 7e-39
gi|27527521|emb|CAD42724.1| putative rac protein [Nicotiana taba... 161 9e-39
gi|12718513|emb|CAC28868.1| rho GTPase [Platichthys flesus] 160 1e-38
gi|7597006|gb|AAA34337.2| unknown [Candida albicans] >gnl|BL_ORD... 160 2e-38
gi|34879898|ref|XP_228861.2| similar to Mcm2 protein [Rattus nor... 160 2e-38
gi|416842|sp|P33153|CRL1_CANAL GTP-binding RHO-like protein >gnl... 160 2e-38
gi|20859680|ref|XP_134050.1| similar to cell division cycle 42 h... 158 6e-38
gi|6322908|ref|NP_012981.1| ras homolog--GTP binding protein; Rh... 158 8e-38
gi|218476|dbj|BAA00898.1| RHO4p [Saccharomyces cerevisiae] 158 8e-38
gi|50419027|ref|XP_458035.1| unnamed protein product [Debaryomyc... 157 1e-37
gi|17565372|ref|NP_505688.1| cdc42 (21.1 kD) (5K959) [Caenorhabd... 157 2e-37
gi|50747083|ref|XP_426342.1| PREDICTED: similar to Rho-related G... 156 2e-37
gi|50421193|ref|XP_459142.1| unnamed protein product [Debaryomyc... 156 2e-37
gi|50741497|ref|XP_426146.1| PREDICTED: similar to ras homolog g... 155 4e-37
gi|49457029|emb|CAG46835.1| ARHE [Homo sapiens] 155 4e-37
gi|1839517|gb|AAB47133.1| RhoE [Homo sapiens] >gnl|BL_ORD_ID|139... 155 5e-37
gi|30584527|gb|AAP36516.1| Homo sapiens ras homolog gene family,... 155 5e-37
gi|47123149|gb|AAH70797.1| MGC83857 protein [Xenopus laevis] 155 5e-37
gi|46250165|gb|AAH68920.1| MGC83149 protein [Xenopus laevis] 155 5e-37
gi|49523003|gb|AAH75375.1| Unknown (protein for MGC:89092) [Xeno... 155 5e-37
gi|4885069|ref|NP_005159.1| ras homolog gene family, member E [H... 155 5e-37
gi|50750816|ref|XP_422158.1| PREDICTED: similar to ras homolog g... 154 1e-36
gi|39593340|emb|CAE64810.1| Hypothetical protein CBG09604 [Caeno... 154 1e-36
gi|47523654|ref|NP_999461.1| Rho related protein Rnd3/Rho8 [Sus ... 154 1e-36
gi|47207873|emb|CAF90636.1| unnamed protein product [Tetraodon n... 154 1e-36
gi|14041855|dbj|BAB55013.1| unnamed protein product [Homo sapiens] 154 1e-36
gi|22219411|pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: F... 154 1e-36
gi|16555421|gb|AAL23699.1| Rho-like small GTPase [Entamoeba hist... 154 1e-36
gi|32408599|ref|XP_324780.1| hypothetical protein [Neurospora cr... 154 1e-36
gi|27695617|ref|XP_223404.1| similar to Rho-related GTP-binding ... 154 1e-36
gi|20663754|pdb|1GWN|A Chain A, The Crystal Structure Of The Cor... 154 1e-36
gi|17560062|ref|NP_505686.1| ras homolog gene family member (5K9... 153 2e-36
gi|4757770|ref|NP_004301.1| ras homolog gene family, member H; T... 153 2e-36
gi|39593338|emb|CAE64808.1| Hypothetical protein CBG09601 [Caeno... 153 2e-36
gi|20831163|ref|XP_132051.1| ras homolog gene family, member H [... 152 3e-36
gi|26245615|gb|AAN77489.1| Rho-like small GTPase [Entamoeba hist... 152 3e-36
gi|26245613|gb|AAN77488.1| Rho-like small GTPase [Entamoeba hist... 152 5e-36
gi|34870449|ref|XP_344080.1| similar to ras-related C3 botulinum... 150 2e-35
gi|26245611|gb|AAN77487.1| Rho-like small GTPase [Entamoeba hist... 149 4e-35
gi|26245607|gb|AAN77485.1| Rho-like small GTPase [Entamoeba hist... 149 4e-35
gi|26245609|gb|AAN77486.1| Rho-like small GTPase [Entamoeba hist... 149 5e-35
gi|12054272|emb|CAC20376.1| rho3 protein [Hypocrea jecorina] 149 5e-35
gi|38101274|gb|EAA48260.1| hypothetical protein MG10323.4 [Magna... 149 5e-35
gi|26372503|dbj|BAC25321.1| unnamed protein product [Mus musculus] 148 6e-35
gi|50556240|ref|XP_505528.1| hypothetical protein [Yarrowia lipo... 148 8e-35
gi|47230243|emb|CAG10657.1| unnamed protein product [Tetraodon n... 147 1e-34
gi|41152486|ref|NP_955816.1| Unknown (protein for MGC:73080); id... 147 1e-34
gi|45185601|ref|NP_983317.1| ACL087Cp [Eremothecium gossypii] >g... 147 1e-34
gi|17390468|gb|AAH18208.1| ARHF protein [Homo sapiens] 147 1e-34
gi|49071640|ref|XP_400109.1| hypothetical protein UM02494.1 [Ust... 147 2e-34
gi|19074644|ref|NP_586150.1| RAS-LIKE GTP-BINDING PROTEIN OF THE... 147 2e-34
gi|46105084|ref|XP_380346.1| hypothetical protein FG00170.1 [Gib... 147 2e-34
gi|50775471|ref|XP_427270.1| PREDICTED: similar to ras homolog g... 146 2e-34
gi|4355|emb|CAA78500.1| RhoNUC protein [Saccharomyces cerevisiae] 146 2e-34
gi|50291035|ref|XP_447950.1| unnamed protein product [Candida gl... 146 3e-34
gi|13432034|gb|AAG12156.1| GTPase Rho2 [Aspergillus fumigatus] 145 4e-34
gi|50305713|ref|XP_452817.1| unnamed protein product [Kluyveromy... 145 5e-34
gi|30962135|emb|CAD48482.1| Rif protein [Ciona intestinalis] 145 7e-34
gi|12230529|sp|Q9P8J9|RHO3_SCHCO Rho3 protein >gnl|BL_ORD_ID|724... 144 9e-34
gi|21667512|gb|AAM74081.1| Rho2 GTP binding protein [Ustilago ma... 144 1e-33
gi|158985|gb|AAA29115.1| G protein 143 3e-33
gi|19880907|gb|AAM00553.1| RHO2 [Saccharomyces cerevisiae] >gnl|... 143 3e-33
gi|400978|sp|P31021|RHO1_ENTHI RAS-LIKE GTP-BINDING PROTEIN RHO1... 143 3e-33
gi|50288609|ref|XP_446734.1| unnamed protein product [Candida gl... 142 3e-33
gi|50310433|ref|XP_455236.1| unnamed protein product [Kluyveromy... 142 3e-33
>gi|17532607|ref|NP_495598.1| cell Division Cycle related, Rho
GTPase cdc42 (21.2 kD) (cdc-42) [Caenorhabditis elegans]
gi|7438396|pir||T16707 hypothetical protein R07G3.1 -
Caenorhabditis elegans
gi|13592449|gb|AAK31543.1| Cell division cycle related protein 42
[Caenorhabditis elegans]
Length = 191
Score = 389 bits (999), Expect = e-107
Identities = 191/191 (100%), Positives = 191/191 (100%)
Frame = +1
Query: 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG 180
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
Sbjct: 1 MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG 60
Query: 181 QEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLR 360
QEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLR
Sbjct: 61 QEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLR 120
Query: 361 DDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPP 540
DDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPP
Sbjct: 121 DDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPP 180
Query: 541 QQEKKKKCNIL 573
QQEKKKKCNIL
Sbjct: 181 QQEKKKKCNIL 191