Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R08B4_4
(1089 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17569327|ref|NP_509860.1| aristaless (XL742) [Caenorhabditis ... 571 e-162
gi|39594830|emb|CAE70698.1| Hypothetical protein CBG17430 [Caeno... 468 e-130
gi|31224752|ref|XP_317481.1| ENSANGP00000011877 [Anopheles gambi... 123 9e-27
gi|5902763|sp|Q06453|AL_DROME Homeobox protein aristaless >gnl|B... 122 1e-26
gi|24580629|ref|NP_722629.1| CG3935-PA [Drosophila melanogaster]... 122 1e-26
gi|424034|pir||A46403 transcription factor with prd-type homeo d... 122 1e-26
gi|18858285|ref|NP_571459.1| aristaless related homeobox; arista... 122 2e-26
gi|48098743|ref|XP_392557.1| similar to CG6860-PB [Apis mellifera] 121 2e-26
gi|24497589|ref|NP_620689.1| aristaless related homeobox; arista... 119 1e-25
gi|23499459|gb|AAN05413.1| aristaless-related homeobox [Xenopus ... 119 1e-25
gi|26024213|ref|NP_031518.2| aristaless related homeobox gene [M... 119 1e-25
gi|34880683|ref|XP_228590.2| similar to Arx homeoprotein [Rattus... 119 1e-25
gi|19168460|dbj|BAB85815.1| aristaless protein [Gryllus bimacula... 118 2e-25
gi|18202522|sp|Q26657|ALX_STRPU Aristaless homeobox protein (ALX... 118 3e-25
gi|46395020|gb|AAS91656.1| aristaless-related homeobox 2 [Xenopu... 118 3e-25
gi|3021450|emb|CAA75668.1| prdl-a [Hydra vulgaris] 117 5e-25
gi|47223503|emb|CAF97990.1| unnamed protein product [Tetraodon n... 114 4e-24
gi|6136895|dbj|BAA85852.1| Arx homeodomain protein [Mus musculus] 111 3e-23
gi|16758738|ref|NP_446321.1| aristaless homeobox [Rattus norvegi... 111 3e-23
gi|2145076|gb|AAB58415.1| paired-box transcription factor protei... 111 3e-23
gi|11496267|ref|NP_068745.1| aristaless-like homeobox 4; homeodo... 111 3e-23
gi|46309511|ref|NP_996953.1| hypothetical protein zgc:77364 [Dan... 110 4e-23
gi|38425325|gb|AAR19764.1| homeodomain protein [Xenopus laevis] 110 4e-23
gi|45383598|ref|NP_989600.1| paired box gene 3 (Waardenburg synd... 110 4e-23
gi|47551253|ref|NP_999809.1| aristaless-like homeobox protein [S... 110 4e-23
gi|6679401|ref|NP_032914.1| paired-like homeobox 2b; paired meso... 110 4e-23
gi|8134644|sp|Q99453|PMXB_HUMAN Paired mesoderm homeobox protein... 110 4e-23
gi|30841697|gb|AAP34699.1| aristaless-like homeobox protein [Lyt... 110 4e-23
gi|47227513|emb|CAG04661.1| unnamed protein product [Tetraodon n... 110 4e-23
gi|47209983|emb|CAF94204.1| unnamed protein product [Tetraodon n... 110 4e-23
gi|38425329|gb|AAR19766.1| homeodomain protein [Xenopus laevis] 110 4e-23
gi|602343|emb|CAA84513.1| PAX7 paired box containing transcripti... 110 6e-23
gi|4505619|ref|NP_002575.1| paired box gene 7 isoform 1; paired ... 110 6e-23
gi|7524359|ref|NP_039236.1| paired box gene 7 isoform 2; paired ... 110 6e-23
gi|46249382|ref|NP_005160.2| paired-like homeobox 2a; aristaless... 110 7e-23
gi|8134640|sp|O14813|PMXA_HUMAN Paired mesoderm homeobox protein... 110 7e-23
gi|31563346|ref|NP_852125.1| paired box gene 3 isoform PAX3h; pa... 110 7e-23
gi|30142098|gb|AAP13873.1| paired box 3 splice variant PAX3H [Ho... 110 7e-23
gi|47228761|emb|CAG07493.1| unnamed protein product [Tetraodon n... 110 7e-23
gi|30142096|gb|AAP13872.1| paired box 3 splice variant PAX3G [Ho... 110 7e-23
gi|31563348|ref|NP_852126.1| paired box gene 3 isoform PAX3g; pa... 110 7e-23
gi|31563342|ref|NP_852123.1| paired box gene 3 isoform PAX3d; pa... 110 7e-23
gi|26336973|dbj|BAC32170.1| unnamed protein product [Mus musculu... 110 7e-23
gi|431254|gb|AAC50053.1| PAX3 protein-forkhead transcription fac... 110 7e-23
gi|6679399|ref|NP_032913.1| paired-like homeobox 2a; paired meso... 110 7e-23
gi|48928118|gb|AAT47737.1| PAX3/NCOA1 fusion protein [Homo sapiens] 110 7e-23
gi|31563340|ref|NP_852122.1| paired box gene 3 isoform PAX3; pai... 110 7e-23
gi|31563344|ref|NP_852124.1| paired box gene 3 isoform PAX3e; pa... 110 7e-23
gi|31982139|ref|NP_032807.2| paired box gene 3 [Mus musculus] >g... 110 7e-23
gi|129650|sp|P24610|PAX3_MOUSE Paired box protein Pax-3 >gnl|BL_... 110 7e-23
gi|12852118|dbj|BAB29280.1| unnamed protein product [Mus musculus] 110 7e-23
gi|29436845|gb|AAH49786.1| Alx4 protein [Mus musculus] 109 1e-22
gi|6671541|ref|NP_031468.1| aristaless 4; Aristaless-like 4; Str... 109 1e-22
gi|17861402|gb|AAL39178.1| GH01528p [Drosophila melanogaster] 109 1e-22
gi|17137502|ref|NP_477330.1| CG2819-PA [Drosophila melanogaster]... 109 1e-22
gi|45384216|ref|NP_990396.1| PAX7 protein [Gallus gallus] >gnl|B... 109 1e-22
gi|14017793|dbj|BAB47417.1| KIAA1788 protein [Homo sapiens] 109 1e-22
gi|13774326|gb|AAK38835.1| aristaless-like homeobox 4 [Homo sapi... 109 1e-22
gi|13626112|sp|Q9H161|ALX4_HUMAN Homeobox protein aristaless-lik... 109 1e-22
gi|34328055|ref|NP_035169.1| paired box gene 7; paired box trans... 109 1e-22
gi|11125719|emb|CAC15120.1| homeodomain transcription factor ALX... 109 1e-22
gi|31219719|ref|XP_316829.1| ENSANGP00000010396 [Anopheles gambi... 109 1e-22
gi|47224832|emb|CAG06402.1| unnamed protein product [Tetraodon n... 108 2e-22
gi|9621907|gb|AAF89581.1| paired-box transcription factor [Branc... 108 2e-22
gi|560583|gb|AAB30807.1| PAX7-FKHR=chimeric transcription factor... 108 2e-22
gi|24158480|ref|NP_571401.1| paired box gene 7 isoform 3; paired... 108 2e-22
gi|1840411|dbj|BAA12289.1| Pax-37 [Halocynthia roretzi] 108 2e-22
gi|24158435|ref|NP_571400.1| paired box gene 7 isoform 1; paired... 108 2e-22
gi|48098121|ref|XP_393978.1| similar to Segmentation protein pai... 108 2e-22
gi|24158437|ref|NP_571407.1| paired box gene 7 isoform 2; paired... 108 2e-22
gi|17380303|sp|Q9I9A2|RX2_ORYLA Retinal homeobox protein Rx2 >gn... 108 2e-22
gi|48094329|ref|XP_394144.1| similar to Retinal homeobox protein... 108 3e-22
gi|41615361|gb|AAS09957.1| Pax7 transcription factor [Ambystoma ... 108 3e-22
gi|50751055|ref|XP_422237.1| PREDICTED: similar to homeodomain p... 108 3e-22
gi|34857386|ref|XP_231005.2| similar to paired-type homeodomain ... 108 3e-22
gi|18308154|gb|AAL67846.1| paired-related homeobox [Gallus gallus] 108 3e-22
gi|222851|dbj|BAA02695.1| paired-related homeotic gene product [... 107 4e-22
gi|41056029|ref|NP_956344.1| Unknown (protein for MGC:64199); wu... 107 5e-22
gi|26377023|dbj|BAB28278.2| unnamed protein product [Mus musculus] 107 5e-22
gi|15625548|gb|AAL04156.1| transcription factor Pax7 [Petromyzon... 107 5e-22
gi|2136302|pir||A45452 transcription factor PAX3 - human (fragme... 107 6e-22
gi|47228289|emb|CAG07684.1| unnamed protein product [Tetraodon n... 107 6e-22
gi|2137387|pir||I48902 homeobox protein Pmx - mouse >gnl|BL_ORD_... 106 8e-22
gi|5902024|ref|NP_008833.1| paired mesoderm homeobox 1 isoform p... 106 8e-22
gi|47229844|emb|CAG07040.1| unnamed protein product [Tetraodon n... 106 8e-22
gi|6755116|ref|NP_035257.1| paired related homeobox 1; paired me... 106 8e-22
gi|12707577|ref|NP_073207.1| paired mesoderm homeobox 1 isoform ... 106 8e-22
gi|45383792|ref|NP_989493.1| aristaless-like homeobox 4 [Gallus ... 106 8e-22
gi|189947|gb|AAA60085.1| homeobox protein 106 8e-22
gi|50728454|ref|XP_425445.1| PREDICTED: similar to Cartilage pai... 106 1e-21
gi|18859339|ref|NP_571302.1| retinal homeobox gene 3 [Danio reri... 106 1e-21
gi|47224480|emb|CAG08730.1| unnamed protein product [Tetraodon n... 106 1e-21
gi|3021452|emb|CAA75669.1| prdl-b protein [Hydra vulgaris] 105 1e-21
gi|435419|gb|AAA03627.1| PAX-3-FKHR gene fusion 105 1e-21
gi|47550757|ref|NP_999899.1| zgc:64055 [Danio rerio] >gnl|BL_ORD... 105 1e-21
gi|435421|gb|AAA03628.1| PAX-3 105 1e-21
gi|34876940|ref|XP_343602.1| paired box gene 3 [Rattus norvegicus] 105 2e-21
gi|38075905|ref|XP_138962.3| paired homeodomain protein DRG11 [M... 105 2e-21
gi|17986113|ref|NP_523834.1| CG11182-PA [Drosophila melanogaster... 105 2e-21
gi|21955176|ref|NP_665710.1| paired-like homeodomain trancriptio... 105 2e-21
gi|15012050|gb|AAH10923.1| Cartilage paired-class homeoprotein 1... 105 2e-21
gi|32307771|gb|AAP79282.1| retinal homeobox [Saccoglossus kowale... 105 2e-21
gi|3550811|dbj|BAA32684.1| homeodomain protein [Drosophila melan... 105 2e-21
gi|21396471|gb|AAM49062.1| transcription factor DRG11 [Mus muscu... 105 2e-21
gi|1633405|pdb|1FJL|A Chain A, Homeodomain From The Drosophila P... 105 2e-21
gi|18859207|ref|NP_571352.1| paired box gene 3; paired box homeo... 105 2e-21
gi|555819|gb|AAA80574.1| paired box homeotic protein 105 2e-21
gi|47230477|emb|CAF99670.1| unnamed protein product [Tetraodon n... 105 2e-21
gi|5901918|ref|NP_008913.1| cartilage paired-class homeoprotein ... 105 2e-21
gi|7706659|ref|NP_057391.1| paired related homeobox 2; paired me... 105 2e-21
gi|2137087|pir||I48185 gene alx3 protein - golden hamster >gnl|B... 104 3e-21
gi|17737409|ref|NP_523556.1| CG6716-PA [Drosophila melanogaster]... 104 3e-21
gi|39589496|emb|CAE74525.1| Hypothetical protein CBG22279 [Caeno... 104 3e-21
gi|1352721|sp|P47239|PAX7_MOUSE Paired box protein Pax-7 >gnl|BL... 104 3e-21
gi|24583824|ref|NP_723721.1| CG6716-PB [Drosophila melanogaster]... 104 3e-21
gi|40018990|gb|AAR37014.1| aristaless-related ALX3 [Rattus norve... 104 3e-21
gi|7106250|ref|NP_031467.1| aristaless 3 [Mus musculus] >gnl|BL_... 104 3e-21
gi|5729728|ref|NP_006483.1| aristaless-like homeobox 3 [Homo sap... 104 3e-21
gi|17506283|ref|NP_491393.1| C.Elegans Homeobox (26.7 kD) (ceh-1... 103 5e-21
gi|34853512|ref|XP_238327.2| paired related homeobox 2 [Rattus n... 103 5e-21
gi|6094305|sp|Q26602|SMX3_SCHMA Homeobox protein SMOX-3 >gnl|BL_... 103 7e-21
gi|24659086|ref|NP_611756.1| CG9876-PA [Drosophila melanogaster]... 103 7e-21
gi|33589354|gb|AAQ22444.1| RE60081p [Drosophila melanogaster] 103 7e-21
gi|48131043|ref|XP_396677.1| similar to ENSANGP00000013902 [Apis... 103 9e-21
gi|12842605|dbj|BAB25663.1| unnamed protein product [Mus musculus] 103 9e-21
gi|49903856|gb|AAH76069.1| Unknown (protein for MGC:92547) [Dani... 103 9e-21
gi|6978601|ref|NP_037053.1| cartilage homeo protein 1 [Rattus no... 102 1e-20
gi|18859337|ref|NP_571301.1| retinal homeobox gene 2 [Danio reri... 102 1e-20
gi|48098973|ref|XP_394848.1| similar to CG2692-PA [Apis mellifera] 102 1e-20
gi|3023596|sp|Q91574|CRT1_XENLA Cartilage homeoprotein 1 (CART-1... 102 2e-20
gi|27369774|ref|NP_766141.1| cartilage homeo protein 1 [Mus musc... 102 2e-20
gi|48118521|ref|XP_396431.1| similar to Paired mesoderm homeobox... 102 2e-20
gi|26352187|dbj|BAC39730.1| unnamed protein product [Mus musculus] 102 2e-20
gi|6677841|ref|NP_033142.1| paired related homeobox 2; surface a... 102 2e-20
gi|31237435|ref|XP_319607.1| ENSANGP00000013902 [Anopheles gambi... 102 2e-20
gi|2950355|emb|CAA11241.1| homebox protein DRx [Drosophila melan... 102 2e-20
gi|28573580|ref|NP_726006.2| CG10052-PA [Drosophila melanogaster... 102 2e-20
gi|18203379|sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 (cR... 102 2e-20
gi|45383902|ref|NP_989435.1| retina and anterior neural fold hom... 102 2e-20
gi|90640|pir||S18038 homeotic protein S8 - mouse (fragment) 101 3e-20
gi|15667414|emb|CAC69975.1| Rx3 protein [Oryzias latipes] 101 3e-20
gi|34853047|ref|XP_215445.2| similar to Orthopedia [Rattus norve... 101 3e-20
gi|12860398|dbj|BAB31942.1| unnamed protein product [Mus musculus] 101 3e-20
gi|6754958|ref|NP_035151.1| orthopedia homolog; orthopedia homol... 101 3e-20
gi|47225662|emb|CAG08005.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|17380298|sp|O42356|RX1_BRARE Retinal homeobox protein Rx1 >gn... 101 3e-20
gi|41282110|ref|NP_571300.2| retinal homeobox gene 1 [Danio reri... 101 3e-20
gi|31212683|ref|XP_315326.1| ENSANGP00000020900 [Anopheles gambi... 101 3e-20
gi|50757335|ref|XP_415476.1| PREDICTED: similar to Prx-2 (S8) [G... 101 3e-20
gi|6093750|sp|Q90963|PMX2_CHICK Paired mesoderm homeobox protein... 101 3e-20
gi|48094331|ref|XP_394145.1| similar to ENSANGP00000020900 [Apis... 101 3e-20
gi|2232059|gb|AAB62322.1| retinal homeobox 1A [Xenopus laevis] 100 5e-20
gi|47219885|emb|CAF97155.1| unnamed protein product [Tetraodon n... 100 5e-20
gi|1764092|gb|AAB39864.1| paired-like homeodomain protein PRX2 [... 100 6e-20
gi|24762822|ref|NP_523862.1| CG2692-PA [Drosophila melanogaster]... 100 6e-20
gi|280601|pir||B43698 paired box transcription factor BSH4 - fru... 100 6e-20
gi|32880216|ref|NP_872594.1| Q50-type retinal homeobox [Bos taur... 100 8e-20
gi|47220562|emb|CAG05588.1| unnamed protein product [Tetraodon n... 100 8e-20
gi|48098033|ref|XP_391991.1| similar to CG6269-PA [Apis mellifera] 100 8e-20
gi|4138292|emb|CAA07775.1| Rx2 protein [Oryzias latipes] 100 1e-19
gi|34859425|ref|XP_345455.1| similar to visual system homeobox 1... 100 1e-19
gi|38325836|gb|AAR17090.1| orthopedia [Lytechinus variegatus] 99 1e-19
gi|48099441|ref|XP_394903.1| similar to CG11294-PA [Apis mellifera] 99 1e-19
gi|16905095|ref|NP_473409.1| visual system homeobox 1 homolog [M... 99 1e-19
gi|9967884|emb|CAC06429.1| homeobrain protein [Drosophila melano... 99 1e-19
gi|28573684|ref|NP_788420.1| CG33152-PA [Drosophila melanogaster... 99 1e-19
gi|48094674|ref|XP_394238.1| similar to oculorhombin [Apis melli... 99 2e-19
gi|6093634|sp|O76971|OTP_PARLI Homeobox protein orthopedia-relat... 99 2e-19
gi|18202262|sp|O97039|RX_DUGJA Retinal homeobox protein Rax (DjR... 99 2e-19
gi|41350743|gb|AAS00591.1| orthopedia; HeOtp [Heliocidaris eryth... 99 2e-19
gi|24640656|ref|NP_572500.1| CG11294-PA [Drosophila melanogaster... 99 2e-19
gi|18202037|sp|O42567|RX2_XENLA Retinal homeobox protein Rx2A >g... 99 2e-19
gi|18859191|ref|NP_571175.1| orthopedia protein [Danio rerio] >g... 99 2e-19
gi|18202033|sp|O42201|RX1_XENLA Retinal homeobox protein Rx1 (Xr... 99 2e-19
gi|32307791|gb|AAP79292.1| orthopedia [Saccoglossus kowalevskii] 99 2e-19
gi|49904617|gb|AAH76366.1| Otp protein [Danio rerio] 99 2e-19
gi|45709566|gb|AAH67706.1| LOC407678 protein [Danio rerio] 99 2e-19
gi|20975766|gb|AAM33145.1| orthopedia [Patella vulgata] 99 2e-19
gi|18203380|sp|Q9PVY0|RX1_CHICK Retinal homeobox protein Rx1 (cR... 98 3e-19
gi|13444981|emb|CAC34833.1| Prx1 protein [Ciona intestinalis] 98 3e-19
gi|45552769|ref|NP_995909.1| CG10036-PB [Drosophila melanogaster... 98 4e-19
gi|15146039|gb|AAK82936.1| pairberry 1 transcription factor [Sch... 98 4e-19
gi|17506279|ref|NP_492246.1| C.Elegans Homeobox (ceh-8) [Caenorh... 97 5e-19
gi|47223097|emb|CAG07184.1| unnamed protein product [Tetraodon n... 97 7e-19
gi|18996777|gb|AAL83210.1| paired-like homeodomain transcription... 97 7e-19
gi|18203021|sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 >gn... 97 7e-19
gi|7595811|gb|AAF64460.1| transcription factor PaxB [Acropora mi... 97 7e-19
gi|7305451|ref|NP_038463.1| retina and anterior neural fold home... 97 9e-19
gi|48098971|ref|XP_394847.1| similar to ENSANGP00000024704 [Apis... 97 9e-19
gi|2133658|pir||I45557 eyeless, long form - fruit fly (Drosophil... 97 9e-19
gi|24638702|ref|NP_524628.2| CG1464-PA [Drosophila melanogaster]... 97 9e-19
gi|17647491|ref|NP_523863.1| CG3388-PA [Drosophila melanogaster]... 97 9e-19
gi|48143219|ref|XP_393635.1| similar to CG31240-PA [Apis mellifera] 97 9e-19
gi|24638704|ref|NP_726607.1| CG1464-PB [Drosophila melanogaster]... 97 9e-19
gi|1932775|gb|AAC53129.1| paired-type homeobox gene [Mus musculu... 97 9e-19
gi|7305433|ref|NP_038861.1| retina and anterior neural fold home... 97 9e-19
gi|12643549|sp|O18381|PAX6_DROME Paired box protein Pax-6 (Eyele... 97 9e-19
gi|14249388|ref|NP_116142.1| hypothetical protein MGC15631 [Homo... 96 1e-18
gi|37748754|gb|AAH59574.1| Vsx1 protein [Danio rerio] 96 1e-18
gi|18859553|ref|NP_571408.1| visual system homeobox 1 protein; p... 96 1e-18
gi|47221758|emb|CAG08812.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|11056038|ref|NP_055403.2| visual system homeobox 1 protein is... 96 1e-18
gi|388439|gb|AAB27469.1| paired box Pax-3 gene product [chickens... 96 1e-18
gi|17569771|ref|NP_509037.1| aristaless (XG806) [Caenorhabditis ... 96 1e-18
gi|18860107|ref|NP_573242.1| CG6269-PA [Drosophila melanogaster]... 96 1e-18
gi|45549245|ref|NP_524638.3| CG11186-PA [Drosophila melanogaster... 96 1e-18
gi|4883932|gb|AAD31712.1| transcription factor Toy [Drosophila m... 96 1e-18
gi|32816237|gb|AAP88434.1| PaxB homeobox protein [Nematostella v... 96 1e-18
gi|31206971|ref|XP_312452.1| ENSANGP00000021908 [Anopheles gambi... 96 1e-18
gi|312889|emb|CAA46108.1| unc-4 [Caenorhabditis elegans] >gnl|BL... 96 2e-18
gi|158170|gb|AAA28837.1| BSH9 encoded protein 96 2e-18
gi|28571323|ref|NP_608318.4| CG32532-PA [Drosophila melanogaster... 96 2e-18
gi|4826912|ref|NP_005020.1| paired-like homeodomain transcriptio... 96 2e-18
gi|17536615|ref|NP_496138.1| UNCoordinated locomotion UNC-4, C.E... 96 2e-18
gi|31208721|ref|XP_313327.1| ENSANGP00000011365 [Anopheles gambi... 96 2e-18
gi|47224300|emb|CAG09146.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|34419191|dbj|BAC84954.1| homeobox protein Chx10-1 [Cynops pyr... 96 2e-18
gi|7335704|gb|AAC15711.2| PaxC transcription factor [Acropora mi... 95 2e-18
gi|12858413|dbj|BAB31309.1| unnamed protein product [Mus musculus] 95 2e-18
gi|20885162|ref|XP_134330.1| RIKEN cDNA 9130012O13 [Mus musculus] 95 2e-18
gi|3024855|sp|Q90277|VSX1_CARAU Visual system homeobox 1 (Transc... 95 2e-18
gi|4519625|dbj|BAA75672.1| DjPax-6 [Dugesia japonica] 95 2e-18
gi|31242417|ref|XP_321639.1| ENSANGP00000011701 [Anopheles gambi... 95 3e-18
gi|39584971|emb|CAE64395.1| Hypothetical protein CBG09085 [Caeno... 95 3e-18
gi|15741042|gb|AAK26167.1| Pax6A [Girardia tigrina] 95 3e-18
gi|49522632|gb|AAH75551.1| Unknown (protein for MGC:89492) [Xeno... 95 3e-18
gi|16758430|ref|NP_446130.1| retina and anterior neural fold hom... 95 3e-18
gi|17552732|ref|NP_498251.1| abnormal cell MIGration MIG-11, C.E... 95 3e-18
gi|12746271|gb|AAK07422.1| retinal homeobox transcription factor... 95 3e-18
gi|27807477|ref|NP_777192.1| visual system homeobox 1 protein [B... 94 4e-18
gi|14530406|emb|CAC42287.1| C. elegans MAB-18 protein (correspon... 94 4e-18
gi|28573686|ref|NP_523799.3| CG10036-PA [Drosophila melanogaster... 94 4e-18
gi|1778017|gb|AAB40616.1| Pax-6 [Loligo opalescens] 94 4e-18
gi|2959596|gb|AAC05613.1| Medaka OG-12; homeodomain protein [Ory... 94 4e-18
gi|2133777|pir||A57374 paired box transcription factor Pax-6 - s... 94 6e-18
gi|9507015|ref|NP_062120.1| paired-like homeodomain transcriptio... 94 6e-18
gi|6679341|ref|NP_032878.1| paired-like homeodomain transcriptio... 94 6e-18
gi|47230236|emb|CAG10650.1| unnamed protein product [Tetraodon n... 94 6e-18
gi|25754728|pir||S60252 paired box transcription factor vab-3 - ... 94 7e-18
gi|2995252|emb|CAA05341.1| homeobox protein SHOTa [Homo sapiens] 94 7e-18
gi|45767814|gb|AAH67664.1| Vsx2 protein [Danio rerio] 94 7e-18
gi|33416571|gb|AAH55588.1| Vsx2 protein [Danio rerio] 94 7e-18
gi|42662464|ref|XP_376008.1| similar to retina and anterior neur... 94 7e-18
gi|3204112|emb|CAA11365.1| Pax6 [Branchiostoma floridae] 94 7e-18
gi|25147947|ref|NP_509758.2| paired transcription factor, Variab... 94 7e-18
gi|3204114|emb|CAA11366.1| Pax6 [Branchiostoma floridae] 94 7e-18
gi|25147955|ref|NP_509759.2| homeobox, Variable ABnormal morphol... 94 7e-18
gi|47218913|emb|CAF98111.1| unnamed protein product [Tetraodon n... 94 7e-18
gi|7305489|ref|NP_038693.1| short stature homeobox 2 [Mus muscul... 94 7e-18
gi|6031200|ref|NP_006875.1| short stature homeobox 2 isoform a; ... 94 7e-18
gi|32307795|gb|AAP79294.1| pax6 [Saccoglossus kowalevskii] 94 7e-18
gi|48095999|ref|XP_394583.1| similar to Medaka OG-12; homeodomai... 94 7e-18
gi|965067|gb|AAA82992.1| male abnormal-18 >gnl|BL_ORD_ID|338021 ... 94 7e-18
gi|3204110|emb|CAA11364.1| Pax6 [Branchiostoma floridae] 94 7e-18
gi|25009574|sp|Q9I9A3|VSX2_ORYLA Visual system homeobox 2 (Trans... 94 7e-18
gi|15146041|gb|AAK82937.1| pairberry 2 transcription factor [Sch... 94 7e-18
gi|25147959|ref|NP_741890.1| pax-6 like homeobox protein, varian... 94 7e-18
gi|965066|gb|AAA82991.1| variable abnormal-3 >gnl|BL_ORD_ID|1922... 94 7e-18
gi|3204118|emb|CAA11368.1| Pax6 [Branchiostoma floridae] 94 7e-18
gi|9945022|gb|AAG03082.1| aristaless-like protein [Hydra vulgaris] 93 9e-18
gi|50730360|ref|XP_416865.1| PREDICTED: similar to short stature... 93 1e-17
gi|4506943|ref|NP_000442.1| short stature homeobox isoform a; gr... 93 1e-17
gi|45382113|ref|NP_990099.1| homeobox protein Chx10 [Gallus gall... 93 1e-17
gi|39598196|emb|CAE68888.1| Hypothetical protein CBG14858 [Caeno... 93 1e-17
gi|31205267|ref|XP_311582.1| ENSANGP00000024704 [Anopheles gambi... 93 1e-17
gi|6031203|ref|NP_006874.1| short stature homeobox isoform b; gr... 93 1e-17
gi|18858269|ref|NP_571537.1| visual system homeobox 2 protein; C... 92 2e-17
gi|45382115|ref|NP_990100.1| homeobox protein Chx10-1 [Gallus ga... 92 2e-17
gi|18202099|sp|O60902|SHX2_HUMAN Short stature homeobox protein ... 92 2e-17
gi|20975764|gb|AAM33144.1| orthodenticle [Patella vulgata] 92 2e-17
gi|25009567|sp|O42477|VSX2_BRARE Visual system homeobox 2 (Trans... 92 2e-17
gi|47222353|emb|CAG05102.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|18202029|sp|O35750|SHX2_RAT Short stature homeobox protein 2 ... 92 2e-17
gi|48094327|ref|XP_394143.1| similar to MGC68542 protein [Apis m... 92 2e-17
gi|33326134|gb|AAQ08477.1| OTX5 protein [Gallus gallus] 92 2e-17
gi|47194703|emb|CAF87132.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|14250720|gb|AAH08829.1| SHOX2 protein [Homo sapiens] 92 2e-17
gi|498022|gb|AAA40109.1| oculorhombin 92 2e-17
gi|2209139|gb|AAC24601.1| paired-like homeobox protein [Carassiu... 92 2e-17
gi|31210017|ref|XP_313975.1| ENSANGP00000009907 [Anopheles gambi... 92 2e-17
gi|45383171|ref|NP_989830.1| transcription factor Crx [Gallus ga... 92 2e-17
gi|3204116|emb|CAA11367.1| Pax6 [Branchiostoma floridae] 92 2e-17
gi|47215984|emb|CAF96386.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|18859211|ref|NP_571716.1| paired box gene 6b [Danio rerio] >g... 92 2e-17
gi|1616755|gb|AAC52831.1| OG-12b homeodomain protein [Mus musculus] 92 3e-17
gi|16903551|gb|AAL30508.1| paired-like homeobox protein DMBX1 [M... 92 3e-17
gi|31982585|ref|NP_570935.2| orthodenticle homolog 3; homeobox g... 92 3e-17
gi|46393908|gb|AAS91492.1| transcription factor [Gasterosteus ac... 92 3e-17
gi|228153|prf||1717390A pax gene 92 3e-17
gi|18859209|ref|NP_571379.1| paired box gene 6a; paired box home... 92 3e-17
gi|37590469|gb|AAH58806.1| Chx10 protein [Mus musculus] 92 3e-17
gi|10242336|gb|AAG15383.1| homeodomain transcription factor Pitx... 92 3e-17
gi|17136976|ref|NP_477026.1| CG31240-PA [Drosophila melanogaster... 92 3e-17
gi|33326132|gb|AAQ08476.1| OTX5 protein [Crocodylus niloticus] 92 3e-17
gi|1079133|pir||A54282 reversed polarity protein - fruit fly (Dr... 92 3e-17
gi|27436936|ref|NP_757379.1| diencephalon/mesencephalon homeobox... 92 3e-17
gi|21623546|dbj|BAC00920.1| PaxB [Homo sapiens] 92 3e-17
gi|22218349|ref|NP_671725.1| diencephalon/mesencephalon homeobox... 92 3e-17
gi|16903553|gb|AAL30509.1| paired-like homeobox protein DMBX1 [M... 92 3e-17
gi|34365783|ref|NP_878314.1| ceh-10 homeo domain containing homo... 92 3e-17
gi|6671750|ref|NP_031727.1| C. elegans ceh-10 homeo domain conta... 92 3e-17
gi|6981534|ref|NP_037160.1| short stature homeobox 2 [Rattus nor... 92 3e-17
gi|10800447|emb|CAC12943.1| dJ1109J22.1 (novel homeobox domain p... 92 3e-17
gi|34870349|ref|XP_233404.2| similar to PaxB [Rattus norvegicus] 92 3e-17
gi|47550979|ref|NP_999663.1| goosecoid transcription factor [Str... 92 3e-17
gi|18252583|gb|AAL66343.1| paired-type homeobox Atx [Mus musculus] 92 3e-17
gi|1616756|gb|AAC52832.1| OG-12a homeodomain protein [Mus musculus] 92 3e-17
gi|18700477|dbj|BAB85207.1| Pax6 [Ciona intestinalis] 92 3e-17
gi|2632115|emb|CAA05283.1| Prx3A [Rattus norvegicus] 92 3e-17
gi|21623544|dbj|BAC00919.1| PaxB [Mus musculus] 92 3e-17
gi|34935363|ref|XP_345705.1| C. elegans ceh-10 homeo domain cont... 92 3e-17
gi|129651|sp|P26630|PAX6_BRARE Paired box protein Pax[Zf-a] (Pax... 92 3e-17
gi|2696972|dbj|BAA24025.1| PAX6 SL [Cynops pyrrhogaster] 91 4e-17
gi|1685047|gb|AAB36681.1| paired-type homeodomain Pax-6 protein ... 91 4e-17
gi|27469846|gb|AAH41712.1| MGC52531 protein [Xenopus laevis] 91 4e-17
gi|8132381|gb|AAF73270.1| paired domain transcription factor var... 91 4e-17
gi|5758941|gb|AAD50904.1| paired-box transcription factor -- iso... 91 4e-17
gi|3176391|dbj|BAA28675.1| orthodenticle-related protein [Hemice... 91 4e-17
gi|2696969|dbj|BAA24022.1| PAX6 LS [Cynops pyrrhogaster] 91 4e-17
gi|5758935|gb|AAD50901.1| paired-box transcription factor ++ iso... 91 4e-17
gi|84901|pir||A26332 homeotic protein BSH4 - fruit fly (Drosophi... 91 4e-17
gi|2495315|sp|P55864|PAX6_XENLA Paired box protein Pax-6 >gnl|BL... 91 4e-17
gi|1488322|gb|AAB05932.1| Xpax6 [Xenopus laevis] 91 4e-17
gi|8132383|gb|AAF73271.1| paired domain transcription factor var... 91 4e-17
gi|21667881|gb|AAM74161.1| Pax-6 protein [Euprymna scolopes] 91 4e-17
gi|1527205|gb|AAB07733.1| XLPAX6 [Xenopus laevis] 91 4e-17
gi|50749424|ref|XP_421631.1| PREDICTED: similar to homeodomain t... 91 4e-17
gi|3402201|emb|CAA16493.1| PAX6 [Takifugu rubripes] 91 4e-17
gi|2696970|dbj|BAA24023.1| PAX6 SS [Cynops pyrrhogaster] 91 4e-17
gi|1684800|gb|AAB36534.1| paired box homeodomain protein TPAX6 [... 91 4e-17
gi|5758937|gb|AAD50902.1| paired-box transcription factor +- iso... 91 4e-17
gi|18859197|ref|NP_571290.1| orthodenticle homolog 1 like; ortho... 91 4e-17
gi|47218729|emb|CAG05701.1| unnamed protein product [Tetraodon n... 91 4e-17
gi|2696971|dbj|BAA24024.1| PAX6 LL [Cynops pyrrhogaster] 91 4e-17
gi|8132377|gb|AAF73268.1| paired domain transcription factor var... 91 4e-17
gi|8132379|gb|AAF73269.1| paired domain transcription factor var... 91 4e-17
gi|5758939|gb|AAD50903.1| paired-box transcription factor -+ iso... 91 4e-17
gi|8132387|gb|AAF73273.1| paired domain transcription factor var... 91 4e-17
gi|21361183|ref|NP_000316.2| paired-like homeodomain transcripti... 91 4e-17
gi|47551141|ref|NP_999753.1| orthodenticle-related protein [Stro... 91 5e-17
gi|39582115|emb|CAE60792.1| Hypothetical protein CBG04483 [Caeno... 91 5e-17
gi|45387769|ref|NP_991238.1| paired-like homeodomain transcripti... 91 5e-17
gi|17227115|gb|AAL38015.1| PAX6 [Mus musculus] 91 5e-17
gi|4959546|gb|AAD34391.1| transcription factor Pitx2 isoform a [... 91 5e-17
gi|23094260|emb|CAD27490.1| paired superclass homeobox transcrip... 91 5e-17
gi|4580424|ref|NP_001595.2| paired box gene 6 isoform b; Paired ... 91 5e-17
gi|34364871|emb|CAE45868.1| hypothetical protein [Homo sapiens] 91 5e-17
gi|7305369|ref|NP_038655.1| paired box gene 6; small eye; Dickie... 91 5e-17
gi|42592306|emb|CAF29075.1| putative pax6 isoform 5a [Rattus nor... 91 5e-17
gi|45384210|ref|NP_990397.1| PAX6 protein [Gallus gallus] >gnl|B... 91 5e-17
gi|44922124|gb|AAS48919.1| paired box 6 isoform 5a [Rattus norve... 91 5e-17
gi|15080680|dbj|BAB62531.1| paired box transcription factor Pax6... 91 5e-17
gi|26389393|dbj|BAC25729.1| unnamed protein product [Mus musculus] 91 5e-17
gi|6981334|ref|NP_037133.1| paired box gene 6; paired box homeot... 91 5e-17
gi|383296|prf||1902328A PAX6 gene 91 5e-17
gi|189353|gb|AAA59962.1| oculorhombin >gnl|BL_ORD_ID|1352440 gi|... 91 5e-17
gi|4505615|ref|NP_000271.1| paired box gene 6 isoform a; Paired ... 91 5e-17
gi|48527939|gb|AAT46026.1| short stature homeobox transcript var... 91 5e-17
gi|18138032|emb|CAC80518.1| paired box protein [Mus musculus] 91 5e-17
gi|6252982|dbj|BAA86260.1| XOTX5 [Xenopus laevis] 91 5e-17
gi|6624755|emb|CAB63872.1| OTX5b protein [Xenopus laevis] >gnl|B... 91 5e-17
gi|18859235|ref|NP_571050.1| paired-like homeodomain transcripti... 91 5e-17
gi|48094384|ref|XP_394162.1| similar to MGC68806 protein [Apis m... 91 5e-17
gi|1352720|sp|P47238|PAX6_COTJA Paired box protein Pax-6 (Pax-QN... 91 5e-17
gi|4512220|dbj|BAA75247.1| Brx1a homeoprotein [Mus musculus] 91 5e-17
gi|3078015|gb|AAC40087.1| ALL1 responsive protein ARP1c [Mus mus... 91 5e-17
gi|2369654|emb|CAA68837.1| PAX-6 protein [Astyanax mexicanus] 91 6e-17
gi|2632119|emb|CAA05285.1| Prx3B [Rattus norvegicus] 91 6e-17
gi|480038|pir||S36166 paired box transcription factor Pax-6 - ra... 91 6e-17
gi|18138028|emb|CAC80516.1| paired box protein [Mus musculus] 91 6e-17
gi|4426551|dbj|BAA20936.1| mdkPax-6 [Oryzias sp.] 91 6e-17
gi|47219179|emb|CAG01842.1| unnamed protein product [Tetraodon n... 91 6e-17
gi|18203019|sp|Q9I8K3|PIX3_XENLA Pituitary homeobox 3 (Homeobox ... 91 6e-17
gi|3955071|emb|CAA06697.1| XPtx2b [Xenopus laevis] 91 6e-17
gi|2369655|emb|CAA68838.1| PAX-6 protein [Astyanax mexicanus] 91 6e-17
gi|8393133|ref|NP_058875.1| Unc4.1 homeobox [Rattus norvegicus] ... 91 6e-17
gi|6110623|gb|AAF03901.1| bicoid type transcription factor Pitx ... 91 6e-17
gi|15004982|dbj|BAB62172.1| transcriptional factor [Leucopsarion... 91 6e-17
gi|4506941|ref|NP_003021.1| short stature homeobox 2 isoform b; ... 91 6e-17
gi|1519542|gb|AAC52834.1| OG12b homeodomain protein [Mus musculu... 91 6e-17
gi|2369653|emb|CAA68836.1| PAX-6 protein [Astyanax mexicanus] 91 6e-17
gi|14141686|dbj|BAB55640.1| late type orthodenticle-related prot... 91 6e-17
gi|17380159|sp|Q9R0W1|PIX2_RAT Pituitary homeobox 2 (rPtx2) >gnl... 91 6e-17
gi|3914281|sp|O73917|PAX6_ORYLA Paired box protein Pax-6 >gnl|BL... 91 6e-17
gi|2369651|emb|CAA68835.1| PAX-6 protein [Astyanax mexicanus] >g... 91 6e-17
gi|7305613|ref|NP_038730.1| Unc4.1 homeobox [Mus musculus] >gnl|... 90 8e-17
gi|47220084|emb|CAG12232.1| unnamed protein product [Tetraodon n... 90 8e-17
gi|1669589|dbj|BAA13681.1| Xenopus Pax-6 short [Xenopus laevis] 90 8e-17
gi|1669587|dbj|BAA13680.1| Xenopus Pax-6 long [Xenopus laevis] 90 8e-17
gi|41055202|ref|NP_957490.1| similar to short stature homeobox 2... 90 8e-17
gi|10798738|emb|CAC12834.1| Pitx1 protein [Xenopus laevis] 90 8e-17
gi|6683066|dbj|BAA89013.1| Pf-Otx [Ptychodera flava] 90 8e-17
gi|50363053|gb|AAT75269.1| pituitary homeobox transcription fact... 90 8e-17
gi|2190464|emb|CAB09537.1| Uncx4.1 [Mus musculus] 90 8e-17
gi|28571942|ref|NP_733410.2| CG1447-PA [Drosophila melanogaster]... 90 1e-16
gi|49115583|gb|AAH73479.1| Unknown (protein for MGC:80997) [Xeno... 90 1e-16
gi|3659897|gb|AAC78330.1| Eyegone [Drosophila melanogaster] 90 1e-16
gi|1352719|sp|P47237|PAX6_CHICK Paired box protein Pax-6 >gnl|BL... 90 1e-16
gi|15004980|dbj|BAB62171.1| transcriptional factor [Leucopsarion... 90 1e-16
gi|45553794|ref|NP_996314.1| CG1447-PC [Drosophila melanogaster]... 90 1e-16
gi|7595813|gb|AAF64461.1| transcription factor PaxD [Acropora mi... 90 1e-16
gi|18252581|gb|AAL66342.1| paired-type homeobox Atx [Gallus gallus] 90 1e-16
gi|24663292|ref|NP_524042.2| CG10488-PA [Drosophila melanogaster... 90 1e-16
gi|21260588|gb|AAM43805.1| eyegone [Drosophila melanogaster] 90 1e-16
gi|50751552|ref|XP_422451.1| PREDICTED: similar to paired-type h... 90 1e-16
gi|42558891|sp|Q8SQ03|CRX_CANFA Cone-rod homeobox protein >gnl|B... 90 1e-16
gi|15823607|dbj|BAB69053.1| pitx2 [Paralichthys olivaceus] 90 1e-16
gi|9739171|gb|AAF97935.1| homeodomain protein goosecoid [Branchi... 90 1e-16
gi|28571944|ref|NP_788770.1| CG1447-PB [Drosophila melanogaster]... 90 1e-16
gi|47224717|emb|CAG00311.1| unnamed protein product [Tetraodon n... 90 1e-16
gi|18032022|gb|AAL40860.1| Pax6 paired-less isoform [Mus musculu... 90 1e-16
gi|45433526|ref|NP_851848.2| orthodenticle homolog 5 [Danio reri... 89 1e-16
gi|17978546|gb|AAK62029.1| orthodenticle-related homeobox 5 [Dan... 89 1e-16
gi|47206453|emb|CAF89478.1| unnamed protein product [Tetraodon n... 89 1e-16
gi|7494639|pir||T37297 homeobox protein ceh-10 - Caenorhabditis ... 89 1e-16
gi|31201113|ref|XP_309504.1| ENSANGP00000022692 [Anopheles gambi... 89 1e-16
gi|22531353|emb|CAD30206.1| paired superclass homeobox transcrip... 89 1e-16
gi|17380175|sp|Q9W751|PIX1_XENLA Pituitary homeobox 1 (X-PITX-1)... 89 1e-16
gi|6851371|gb|AAF29531.1| pituitary homeobox gene 1 paired-like ... 89 1e-16
gi|18091718|gb|AAK85128.1| homeobox protein Otx5 [Scyliorhinus c... 89 1e-16
gi|10567179|dbj|BAB16104.1| orthodenticle [Stichopus japonicus] 89 1e-16
gi|20070107|ref|NP_055377.1| orthodenticle 1; homeobox protein O... 89 1e-16
gi|23308743|ref|NP_694419.1| cone-rod homeobox [Danio rerio] >gn... 89 1e-16
gi|47213896|emb|CAF95838.1| unnamed protein product [Tetraodon n... 89 2e-16
gi|40254714|ref|NP_571325.2| orthodenticle homolog 1 [Danio reri... 89 2e-16
gi|30348975|ref|NP_835457.2| orthodenticle homolog 3 isoform Mbx... 89 2e-16
gi|3024322|sp|Q91994|OTX1_BRARE Homeobox protein OTX1 (ZOTX1) >g... 89 2e-16
gi|23307644|gb|AAN17797.1| transcription factor Otx5 [Pleurodele... 89 2e-16
gi|3406613|gb|AAC29426.1| homeodomain transcription factor Pitx2... 89 2e-16
gi|17380174|sp|Q9PWR3|PIX2_XENLA Pituitary homeobox 2 (xPtx2) >g... 89 2e-16
gi|1835186|emb|CAA71094.1| Pax-6 [Phallusia mammilata] 89 2e-16
gi|27475514|gb|AAL58533.1| paired homeobox protein [Takifugu rub... 89 2e-16
gi|33326136|gb|AAQ08478.1| OTX5 protein [Emys orbicularis] 89 2e-16
gi|33326138|gb|AAQ08479.1| OTX5 protein [Gallotia stehlini] 89 2e-16
gi|25168269|ref|NP_035153.1| orthodenticle homolog 1; Jackson wa... 89 2e-16
gi|6981314|ref|NP_037241.1| orthodenticle homolog 1; Orthodentic... 89 2e-16
gi|23308671|ref|NP_694509.1| orthodenticle homolog 3 isoform Mbx... 89 2e-16
gi|6681029|ref|NP_031796.1| cone-rod homeobox containing gene [M... 89 2e-16
gi|11177896|ref|NP_068627.1| cone-rod homeobox protein [Rattus n... 89 2e-16
gi|4587213|dbj|BAA76666.1| cone-rod homeobox protein [Rattus nor... 89 2e-16
gi|24234708|ref|NP_700475.1| paired-like homeodomain transcripti... 89 2e-16
gi|11932960|emb|CAC19336.1| homeobox transcription factor [Platy... 89 2e-16
gi|2828716|gb|AAC00193.1| amphioxus Otx transcription factor [Br... 89 2e-16
gi|50728814|ref|XP_416296.1| PREDICTED: similar to Cartilage hom... 89 2e-16
gi|32307793|gb|AAP79293.1| orthodenticle [Saccoglossus kowalevskii] 89 2e-16
gi|13183093|gb|AAK15048.1| paired-like homeodomain transcription... 89 2e-16
gi|24234711|ref|NP_700476.1| paired-like homeodomain transcripti... 89 2e-16
gi|47211374|emb|CAF89827.1| unnamed protein product [Tetraodon n... 89 2e-16
gi|4557489|ref|NP_000545.1| cone-rod homeobox protein [Homo sapi... 89 2e-16
gi|39587714|emb|CAE58652.1| Hypothetical protein CBG01820 [Caeno... 89 2e-16
gi|8101705|gb|AAF72622.1| Odysseus [Drosophila simulans] 89 2e-16
gi|33391193|gb|AAQ17211.1| paired and homeobox transcription fac... 89 2e-16
gi|4512222|dbj|BAA75248.1| Brx1b homeoprotein [Mus musculus] 89 2e-16
gi|30841039|ref|NP_035228.2| paired-like homeodomain transcripti... 89 2e-16
gi|47221846|emb|CAF98858.1| unnamed protein product [Tetraodon n... 88 3e-16
gi|45581379|dbj|BAD12775.1| Pitx homologue [Lethenteron japonicum] 88 3e-16
gi|37788279|gb|AAP04271.1| homeodomain transcription factor ScOt... 88 3e-16
gi|48094894|ref|XP_394294.1| similar to ENSANGP00000004934 [Apis... 88 3e-16
gi|1930008|gb|AAC53120.1| pituitary homeobox 2 isoform a [Mus mu... 88 3e-16
gi|6118056|gb|AAF04002.1| homeodomain protein Otx [Podocoryne ca... 88 3e-16
gi|9506975|ref|NP_062207.1| paired-like homeodomain transcriptio... 88 3e-16
gi|1616751|gb|AAC52830.1| homeodomain protein Uncx-4.1 [Mus musc... 88 3e-16
gi|7271777|gb|AAF44618.1| paired-like homeodomain transcription ... 88 3e-16
gi|45384358|ref|NP_990341.1| transcription factor Pitx2 [Gallus ... 88 3e-16
gi|1737173|gb|AAB38864.1| solurshin [Mus musculus] 88 3e-16
gi|47227473|emb|CAG04621.1| unnamed protein product [Tetraodon n... 88 3e-16
gi|31203991|ref|XP_310944.1| ENSANGP00000019330 [Anopheles gambi... 88 3e-16
gi|3650206|dbj|BAA33409.1| LjOtxA [Lethenteron japonicum] 88 4e-16
gi|44921621|gb|AAS49168.1| transcription factor Otx2 [Eleutherod... 88 4e-16
gi|4249677|gb|AAD13765.1| paired-type homeobox protein [Drosophi... 88 4e-16
gi|31239353|ref|XP_320090.1| ENSANGP00000018404 [Anopheles gambi... 88 4e-16
gi|5668951|gb|AAD46097.1| pituitary homeobox protein 2 [Gallus g... 88 4e-16
gi|45549140|ref|NP_523389.3| CG6352-PA [Drosophila melanogaster]... 88 4e-16
gi|24158433|ref|NP_571399.1| paired box gene 7 isoform 4; paired... 88 4e-16
gi|47216832|emb|CAG02723.1| unnamed protein product [Tetraodon n... 88 4e-16
gi|13641479|gb|AAK31735.1| transcription factor Otx1 [Xenopus la... 88 4e-16
gi|2209231|gb|AAB61443.1| Lox22-otx [Helobdella triserialis] 88 4e-16
gi|47230174|emb|CAG10588.1| unnamed protein product [Tetraodon n... 87 5e-16
gi|27436933|ref|NP_758840.1| orthodenticle 2 isoform b; homeobox... 87 5e-16
gi|21536266|ref|NP_659090.1| orthodenticle homolog 2 [Mus muscul... 87 5e-16
gi|48479262|gb|AAT44902.1| homeodomain transcription factor [Gal... 87 5e-16
gi|18859195|ref|NP_571326.1| orthodenticle homolog 2 [Danio reri... 87 5e-16
gi|417428|sp|P80206|OTX2_MOUSE Homeobox protein OTX2 >gnl|BL_ORD... 87 5e-16
gi|45383129|ref|NP_989851.1| homeobox protein OTX2 [Gallus gallu... 87 5e-16
gi|27372178|dbj|BAC53612.1| OTX2 [Cynops pyrrhogaster] 87 5e-16
gi|15987509|gb|AAL12001.1| homeodomain protein TTX-1 [Caenorhabd... 87 5e-16
gi|6679481|ref|NP_032962.1| paired like homeodomain factor 1; pr... 87 5e-16
gi|53541|emb|CAA48754.1| Otx1 [Mus musculus] 87 5e-16
gi|53543|emb|CAA48755.1| Otx2 [Mus musculus] 87 5e-16
gi|2815307|emb|CAA11490.1| orthodenticle-2 protein [Tribolium ca... 87 5e-16
gi|20073338|gb|AAH27104.1| Otx2 protein [Mus musculus] >gnl|BL_O... 87 5e-16
gi|11119420|ref|NP_068374.1| orthodenticle 2 isoform a; homeobox... 87 5e-16
gi|21671137|dbj|BAC02578.1| Otx2 [Labidochromis caeruleus] >gnl|... 87 5e-16
gi|3115326|emb|CAA04396.1| Otx2 [Oryzias latipes] 87 5e-16
gi|7446266|pir||JC6130 paired box transcription factor Pax-6 - R... 87 5e-16
gi|1737167|gb|AAC16257.1| solurshin [Homo sapiens] 87 5e-16
gi|45361277|ref|NP_989216.1| hypothetical protein MGC75643 [Xeno... 87 5e-16
gi|23306483|gb|AAM09955.1| transcription factor Otx2 [Pleurodele... 87 5e-16
gi|27806903|ref|NP_776329.1| cone-rod homeobox [Bos taurus] >gnl... 87 5e-16
gi|33637779|gb|AAQ24027.1| homeobox protein Otx [Holopneustes pu... 87 5e-16
>gi|17569327|ref|NP_509860.1| aristaless (XL742) [Caenorhabditis
elegans]
gi|7506460|pir||T24046 hypothetical protein R08B4.2 - Caenorhabditis
elegans
gi|3878964|emb|CAA92001.1| Hypothetical protein R08B4.2
[Caenorhabditis elegans]
Length = 362
Score = 571 bits (1472), Expect = e-162
Identities = 294/345 (85%), Positives = 294/345 (85%)
Frame = -1
Query: 1038 MNCPPLHRPNGADLNQYSKSLMEQLQAQLFANPALQFPSFPPAFSIAALTNNQHELKEDD 859
MNCPPLHRPNGADLNQYSKSLMEQLQAQLFANPALQFPSFPPAFSIAALTNNQHELKEDD
Sbjct: 18 MNCPPLHRPNGADLNQYSKSLMEQLQAQLFANPALQFPSFPPAFSIAALTNNQHELKEDD 77
Query: 858 GKKTPTGDNILEAASVLDNRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQLDELEKVFA 679
GKKTPTGDNILEAASVLDNRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQLDELEKVFA
Sbjct: 78 GKKTPTGDNILEAASVLDNRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQLDELEKVFA 137
Query: 678 RTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDN 499
RTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDN
Sbjct: 138 RTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDN 197
Query: 498 PYQMMLSQEXXXXXXXXXXXAHLLNEQVRIATSDRRSQXXXXXXXXXXXXXXXXXXXTFQ 319
PYQMMLSQE AHLLNEQVRIATSDRRSQ TFQ
Sbjct: 198 PYQMMLSQEAIFAAINQQAAAHLLNEQVRIATSDRRSQSPSVPVTTSSPILPTSVTPTFQ 257
Query: 318 NADALNMLFGGITPVTQQLLYVQQFSRAMDAFRTQLLGSVPAGATAEVTDVVALKTEDSK 139
NADALNMLFGGITPVTQQLLYVQQFSRAMDAFRTQLLGSVPAGATAEVTDVVALKTEDSK
Sbjct: 258 NADALNMLFGGITPVTQQLLYVQQFSRAMDAFRTQLLGSVPAGATAEVTDVVALKTEDSK 317
Query: 138 SNSRXXXXXXXXXXXXXXXXXXXXXTNFADMNSLISDVKPKEESS 4
SNSR TNFADMNSLISDVKPKEESS
Sbjct: 318 SNSRAGSSSPTPTESSGAAATSTSPTNFADMNSLISDVKPKEESS 362