Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R10H10_3
(669 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17541876|ref|NP_501917.1| HIRA interacting protein like, LiPi... 413 e-114
gi|39579502|emb|CAE56867.1| Hypothetical protein CBG24700 [Caeno... 389 e-107
gi|6554171|gb|AAF16622.1| TO42 [Drosophila melanogaster] >gnl|BL... 227 2e-58
gi|24643765|ref|NP_728443.1| CG32857-PA [Drosophila melanogaster... 227 2e-58
gi|50759494|ref|XP_417664.1| PREDICTED: similar to iron-sulfur c... 224 9e-58
gi|31203061|ref|XP_310479.1| ENSANGP00000019230 [Anopheles gambi... 220 2e-56
gi|50593021|ref|NP_001002755.1| HIRA interacting protein 5 isofo... 217 1e-55
gi|34500319|gb|AAQ73784.1| NifU-like protein HIRIP5 [Homo sapiens] 217 1e-55
gi|50593025|ref|NP_056515.2| HIRA interacting protein 5 isoform ... 217 1e-55
gi|22256812|sp|Q9UMS0|HIR5_HUMAN HIRA-interacting protein 5 (CGI... 214 2e-54
gi|45387881|ref|NP_991300.1| HIRA interacting protein 5 [Danio r... 213 2e-54
gi|31874276|emb|CAD98142.1| hypothetical protein [Homo sapiens] 212 5e-54
gi|34856373|ref|XP_216202.2| similar to HIRA-interacting protein... 212 6e-54
gi|12834577|dbj|BAB22965.1| unnamed protein product [Mus musculus] 210 2e-53
gi|34500321|gb|AAQ73785.1| NifU-like protein HIRIP5 [Mus musculus] 210 2e-53
gi|26324295|dbj|BAC24985.1| unnamed protein product [Mus musculus] 209 5e-53
gi|9910264|ref|NP_064429.1| histone cell cycle regulation defect... 209 5e-53
gi|4680705|gb|AAD27742.1| CGI-33 protein [Homo sapiens] 208 7e-53
gi|47212055|emb|CAF90173.1| unnamed protein product [Tetraodon n... 202 4e-51
gi|38077551|ref|XP_128150.2| similar to HIRA-interacting protein... 196 5e-49
gi|34897632|ref|NP_910162.1| hypothetical protein [Oryza sativa]... 194 1e-48
gi|41351250|gb|AAH65889.1| LOC402946 protein [Danio rerio] 193 2e-48
gi|46397296|sp|Q9UUB8|YH9J_SCHPO NifU-like protein C1709.19c >gn... 191 9e-48
gi|18402817|ref|NP_566673.1| nitrogen fixation NifU-like family ... 191 1e-47
gi|50256943|gb|EAL19661.1| hypothetical protein CNBG2890 [Crypto... 190 3e-47
gi|32415477|ref|XP_328218.1| hypothetical protein [Neurospora cr... 189 6e-47
gi|42562675|ref|NP_175550.2| nitrogen fixation NifU-like family ... 189 6e-47
gi|50419691|ref|XP_458373.1| unnamed protein product [Debaryomyc... 186 4e-46
gi|46201919|ref|ZP_00054106.2| COG0694: Thioredoxin-like protein... 184 1e-45
gi|50545601|ref|XP_500339.1| hypothetical protein [Yarrowia lipo... 183 3e-45
gi|49077460|ref|XP_402587.1| hypothetical protein UM04972.1 [Ust... 180 2e-44
gi|22959398|ref|ZP_00007051.1| COG0694: Thioredoxin-like protein... 176 5e-43
gi|49084834|ref|XP_404584.1| hypothetical protein AN0447.2 [Aspe... 174 1e-42
gi|4836948|gb|AAD30650.1| Similar to human CGI-33 protein [Arabi... 173 2e-42
gi|46107542|ref|XP_380830.1| hypothetical protein FG00654.1 [Gib... 171 1e-41
gi|48763870|ref|ZP_00268423.1| COG0694: Thioredoxin-like protein... 171 1e-41
gi|38109466|gb|EAA55336.1| hypothetical protein MG06993.4 [Magna... 169 4e-41
gi|45915105|ref|ZP_00193647.2| COG0694: Thioredoxin-like protein... 169 5e-41
gi|34581359|ref|ZP_00142839.1| hypothetical protein [Rickettsia ... 168 8e-41
gi|15892941|ref|NP_360655.1| unknown [Rickettsia conorii str. Ma... 167 1e-40
gi|15887702|ref|NP_353383.1| AGR_C_616p [Agrobacterium tumefacie... 167 1e-40
gi|23501052|ref|NP_697179.1| NifU-related protein [Brucella suis... 167 2e-40
gi|46431364|gb|EAK90941.1| hypothetical protein CaO19.3485 [Cand... 167 2e-40
gi|46432400|gb|EAK91883.1| hypothetical protein CaO19.13662 [Can... 167 2e-40
gi|17988091|ref|NP_540725.1| NIFU PROTEIN [Brucella melitensis 1... 167 2e-40
gi|15604511|ref|NP_221029.1| unknown [Rickettsia prowazekii str.... 166 5e-40
gi|42454089|ref|ZP_00153996.1| hypothetical protein Rick097101 [... 165 7e-40
gi|13474434|ref|NP_106002.1| hypothetical protein mll5315 [Mesor... 165 7e-40
gi|39933530|ref|NP_945806.1| possible NifU-like domain (residues... 165 9e-40
gi|50426637|ref|XP_461916.1| unnamed protein product [Debaryomyc... 164 1e-39
gi|49476032|ref|YP_034073.1| hypothetical protein BH13490 [Barto... 164 1e-39
gi|27375911|ref|NP_767440.1| bll0800 [Bradyrhizobium japonicum U... 161 1e-38
gi|42520881|ref|NP_966796.1| NifU domain protein [Wolbachia endo... 159 4e-38
gi|46441335|gb|EAL00633.1| hypothetical protein CaO19.2067 [Cand... 159 5e-38
gi|49474596|ref|YP_032638.1| hypothetical protein BQ10720 [Barto... 157 2e-37
gi|15964154|ref|NP_384507.1| CONSERVED HYPOTHETICAL PROTEIN [Sin... 156 3e-37
gi|48851117|ref|ZP_00305359.1| COG0694: Thioredoxin-like protein... 154 1e-36
gi|23006361|ref|ZP_00048716.1| COG0694: Thioredoxin-like protein... 154 2e-36
gi|46308926|ref|ZP_00211118.1| COG0694: Thioredoxin-like protein... 153 3e-36
gi|16124317|ref|NP_418881.1| NifU-like domain protein [Caulobact... 153 3e-36
gi|48855808|ref|ZP_00309966.1| COG0694: Thioredoxin-like protein... 141 1e-32
gi|17946069|gb|AAL49077.1| RE53788p [Drosophila melanogaster] 132 5e-30
gi|48104665|ref|XP_395826.1| similar to ENSANGP00000019230 [Apis... 131 1e-29
gi|21430120|gb|AAM50738.1| GM32035p [Drosophila melanogaster] 129 5e-29
gi|6322811|ref|NP_012884.1| Nifu-like protein; Nfu1p [Saccharomy... 123 3e-27
gi|50292835|ref|XP_448850.1| unnamed protein product [Candida gl... 122 5e-27
gi|45185274|ref|NP_982991.1| ABR045Wp [Eremothecium gossypii] >g... 120 2e-26
gi|42523787|ref|NP_969167.1| nifU related protein [Bdellovibrio ... 119 5e-26
gi|50593019|ref|NP_001002757.1| HIRA interacting protein 5 isofo... 117 2e-25
gi|4790|emb|CAA49299.1| YKL253 [Saccharomyces cerevisiae] 117 2e-25
gi|50312363|ref|XP_456215.1| unnamed protein product [Kluyveromy... 116 4e-25
gi|19112244|ref|NP_595452.1| conserved hypothetical protein [Sch... 96 6e-19
gi|8118105|gb|AAF72894.1| NU1 [Trypanosoma cruzi] 87 3e-16
gi|30249416|ref|NP_841486.1| Nitrogen-fixing protein NifU [Nitro... 87 3e-16
gi|42521822|ref|NP_967202.1| putative nitrogen-fixing protein Ni... 86 5e-16
gi|8571395|gb|AAF76865.1| NifU-like protein [Sinorhizobium melil... 82 7e-15
gi|15615981|ref|NP_244286.1| nitrogen fixation protein (NifU pro... 71 2e-11
gi|20808161|ref|NP_623332.1| Thioredoxin-like proteins and domai... 69 6e-11
gi|27467548|ref|NP_764185.1| nitrogen fixation protein NifU [Sta... 69 8e-11
gi|48845884|ref|ZP_00300155.1| COG0694: Thioredoxin-like protein... 69 8e-11
gi|33239869|ref|NP_874811.1| Thioredoxin family protein [Prochlo... 67 2e-10
gi|46112960|ref|ZP_00182096.2| COG0694: Thioredoxin-like protein... 67 3e-10
gi|16080275|ref|NP_391102.1| yutI [Bacillus subtilis subsp. subt... 67 3e-10
gi|30022992|ref|NP_834623.1| NifU protein [Bacillus cereus ATCC ... 67 3e-10
gi|21397433|ref|NP_653418.1| NifU-like, NifU-like domain [Bacill... 67 3e-10
gi|15923926|ref|NP_371460.1| hypothetical protein SAV0936 [Staph... 67 3e-10
gi|33862527|ref|NP_894087.1| NifU-like protein [Prochlorococcus ... 67 3e-10
gi|39995588|ref|NP_951539.1| NifU-like domain protein [Geobacter... 66 5e-10
gi|33866219|ref|NP_897778.1| NifU-like protein [Synechococcus sp... 66 7e-10
gi|48895524|ref|ZP_00328508.1| COG0694: Thioredoxin-like protein... 65 2e-09
gi|23126802|ref|ZP_00108688.1| COG0694: Thioredoxin-like protein... 64 3e-09
gi|11498240|ref|NP_069466.1| nifU protein (nifU-3) [Archaeoglobu... 64 3e-09
gi|33860975|ref|NP_892536.1| NifU-like protein [Prochlorococcus ... 64 3e-09
gi|16332125|ref|NP_442853.1| NifU protein [Synechocystis sp. PCC... 63 5e-09
gi|21554503|gb|AAM63593.1| nitrogen fixation like protein [Arabi... 63 6e-09
gi|18416645|ref|NP_567735.1| nitrogen fixation protein, putative... 63 6e-09
gi|7485833|pir||T04246 hypothetical protein F20B18.20 - Arabidop... 63 6e-09
gi|23099811|ref|NP_693277.1| nitrogen fixation protein [Oceanoba... 63 6e-09
gi|31544589|ref|NP_853167.1| conserved hypothetical [Mycoplasma ... 63 6e-09
gi|18423084|ref|NP_568715.1| nitrogen fixation NifU-like family ... 62 1e-08
gi|8777425|dbj|BAA97015.1| unnamed protein product [Arabidopsis ... 62 1e-08
gi|17228804|ref|NP_485352.1| NifU like protein [Nostoc sp. PCC 7... 62 1e-08
gi|48832037|ref|ZP_00289082.1| COG0694: Thioredoxin-like protein... 62 1e-08
gi|25407141|pir||H85024 hypothetical protein AT4g01940 [imported... 62 1e-08
gi|45527259|ref|ZP_00178460.1| COG0694: Thioredoxin-like protein... 62 1e-08
gi|46580957|ref|YP_011765.1| NifU family protein [Desulfovibrio ... 62 1e-08
gi|30698492|dbj|BAC76603.1| NifU1 [Oryza sativa (japonica cultiv... 61 2e-08
gi|18411785|ref|NP_567219.1| nitrogen fixation NifU-like family ... 61 2e-08
gi|22298836|ref|NP_682083.1| ORF_ID:tsl1293~similar to NifU prot... 61 2e-08
gi|37522446|ref|NP_925823.1| gsl2877 [Gloeobacter violaceus PCC ... 60 3e-08
gi|45511902|ref|ZP_00163469.1| COG0694: Thioredoxin-like protein... 60 4e-08
gi|2688826|gb|AAB88877.1| putative NifU protein [Prunus armeniaca] 60 5e-08
gi|45525774|ref|ZP_00176996.1| COG1104: Cysteine sulfinate desul... 59 7e-08
gi|32267366|ref|NP_861398.1| conserved hypothetical protein [Hel... 59 7e-08
gi|26989102|ref|NP_744527.1| yhgI protein [Pseudomonas putida KT... 58 1e-07
gi|42525980|ref|NP_971078.1| NifU domain protein [Treponema dent... 58 1e-07
gi|47223308|emb|CAF98692.1| unnamed protein product [Tetraodon n... 57 3e-07
gi|23473738|ref|ZP_00129033.1| COG0822: NifU homolog involved in... 57 3e-07
gi|46579079|ref|YP_009887.1| nitrogen fixation protein nifU [Des... 57 3e-07
gi|34558002|ref|NP_907817.1| conserved hypothetical protein-Thio... 57 4e-07
gi|46908571|ref|YP_014960.1| NifU family protein [Listeria monoc... 56 7e-07
gi|417363|sp|P33179|NIFU_ANASL NIFU PROTEIN >gnl|BL_ORD_ID|82746... 56 7e-07
gi|16801558|ref|NP_471826.1| similar to NifU protein [Listeria i... 55 1e-06
gi|15792944|ref|NP_282767.1| nifU protein homolog [Campylobacter... 55 1e-06
gi|16804435|ref|NP_465920.1| similar to NifU protein [Listeria m... 55 1e-06
gi|48854865|ref|ZP_00309026.1| COG0694: Thioredoxin-like protein... 55 1e-06
gi|48733340|ref|ZP_00267083.1| COG0316: Uncharacterized conserve... 55 2e-06
gi|48895569|ref|ZP_00328553.1| COG0694: Thioredoxin-like protein... 55 2e-06
gi|22974151|ref|ZP_00020502.1| hypothetical protein [Chloroflexu... 54 3e-06
gi|45508671|ref|ZP_00161008.1| COG0822: NifU homolog involved in... 53 6e-06
gi|17228950|ref|NP_485498.1| nitrogen fixation protein [Nostoc s... 53 6e-06
gi|1084185|pir||S50134 nitrogen fixation protein nifU - Nostoc s... 53 6e-06
gi|2183204|gb|AAC33371.1| NifU [Cyanothece sp. PCC 8801] 53 6e-06
gi|15597044|ref|NP_250538.1| conserved hypothetical protein [Pse... 52 8e-06
gi|49082646|gb|AAT50723.1| PA1847 [synthetic construct] 52 8e-06
gi|23102651|ref|ZP_00089153.1| COG0694: Thioredoxin-like protein... 51 2e-05
gi|23105397|ref|ZP_00091853.1| COG0316: Uncharacterized conserve... 50 3e-05
gi|4140376|gb|AAD03815.1| NifU [Trichodesmium sp. IMS101] 50 3e-05
gi|1171712|sp|Q00241|NIFU_PLEBO NITROGEN FIXATION PROTEIN NIFU >... 50 3e-05
gi|9081905|gb|AAF82636.1| NifU [Trichodesmium sp. IMS101] 50 3e-05
gi|48893823|ref|ZP_00327021.1| COG0822: NifU homolog involved in... 50 3e-05
gi|21674600|ref|NP_662665.1| NifU protein, putative [Chlorobium ... 50 3e-05
gi|46106012|ref|ZP_00186420.2| COG0694: Thioredoxin-like protein... 50 3e-05
gi|48863131|ref|ZP_00317025.1| COG0316: Uncharacterized conserve... 50 5e-05
gi|23105713|ref|ZP_00092167.1| COG0694: Thioredoxin-like protein... 50 5e-05
gi|26553528|ref|NP_757462.1| nitrogen fixation protein [Mycoplas... 50 5e-05
gi|23130504|ref|ZP_00112317.1| COG0822: NifU homolog involved in... 49 7e-05
gi|45508531|ref|ZP_00160869.1| COG0822: NifU homolog involved in... 49 9e-05
gi|1709290|sp|Q10373|NIU2_RHOCA Nitrogen fixation protein nifU 2... 49 1e-04
gi|50123054|ref|YP_052221.1| conserved hypothetical protein [Erw... 48 2e-04
gi|37524219|ref|NP_927563.1| hypothetical protein [Photorhabdus ... 48 2e-04
gi|33520016|ref|NP_878848.1| conserved hypothetical protein [Can... 48 2e-04
gi|48763178|ref|ZP_00267734.1| COG0694: Thioredoxin-like protein... 48 2e-04
gi|50877119|emb|CAG36959.1| probable nitrogen fixation protein (... 48 2e-04
gi|48844713|ref|ZP_00299013.1| COG0822: NifU homolog involved in... 48 2e-04
gi|28869922|ref|NP_792541.1| yhgI protein [Pseudomonas syringae ... 47 3e-04
gi|23472266|ref|ZP_00127593.1| COG0316: Uncharacterized conserve... 47 3e-04
gi|39937667|ref|NP_949943.1| putative nifU protein [Rhodopseudom... 47 3e-04
gi|48866542|ref|ZP_00320363.1| COG0694: Thioredoxin-like protein... 47 3e-04
gi|16272381|ref|NP_438594.1| unknown protein [Haemophilus influe... 47 3e-04
gi|149000|gb|AAA25015.1| The predicted molecular weight and pI o... 47 3e-04
gi|34540487|ref|NP_904966.1| NifU-related protein [Porphyromonas... 47 3e-04
gi|21242852|ref|NP_642434.1| conserved hypothetical protein [Xan... 47 4e-04
gi|50084252|ref|YP_045762.1| putative membrane-bound protein in ... 47 4e-04
gi|15603422|ref|NP_246496.1| OrfG [Pasteurella multocida Pm70] >... 46 6e-04
gi|15803918|ref|NP_289954.1| orf, hypothetical protein [Escheric... 46 6e-04
gi|24376092|ref|NP_720135.1| yhgI protein [Shewanella oneidensis... 46 8e-04
gi|21672789|ref|NP_660856.1| hypothetical 21.0 kDa protein [Buch... 46 8e-04
gi|16120470|ref|NP_403783.1| conserved hypothetical protein [Yer... 46 8e-04
gi|15612450|ref|NP_224103.1| putative [Helicobacter pylori J99] ... 46 8e-04
gi|21231527|ref|NP_637444.1| conserved hypothetical protein [Xan... 45 0.001
gi|16766799|ref|NP_462414.1| putative thioredoxin-like protein [... 45 0.001
gi|16762776|ref|NP_458393.1| conserved hypothetical protein [Sal... 45 0.001
gi|27468042|ref|NP_764679.1| conserved hypothetical protein [Sta... 45 0.001
gi|23130548|ref|ZP_00112361.1| COG0694: Thioredoxin-like protein... 45 0.001
gi|16752178|ref|NP_445545.1| nifU protein, putative [Chlamydophi... 45 0.001
gi|33242221|ref|NP_877162.1| NifU-like protein [Chlamydophila pn... 45 0.001
gi|15618770|ref|NP_225056.1| NifU-related protein [Chlamydophila... 45 0.001
gi|39997110|ref|NP_953061.1| NifU family protein [Geobacter sulf... 45 0.001
gi|22959990|ref|ZP_00007634.1| COG0822: NifU homolog involved in... 45 0.001
gi|23104286|ref|ZP_00090752.1| COG0822: NifU homolog involved in... 45 0.002
gi|142396|gb|AAA22167.1| nifU protein 45 0.002
gi|32034535|ref|ZP_00134699.1| COG0316: Uncharacterized conserve... 45 0.002
gi|17228187|ref|NP_484735.1| similar to NifU protein [Nostoc sp.... 45 0.002
gi|28199845|ref|NP_780159.1| conserved hypothetical protein [Xyl... 44 0.002
gi|22995074|ref|ZP_00039557.1| COG0694: Thioredoxin-like protein... 44 0.002
gi|15642714|ref|NP_232347.1| conserved hypothetical protein [Vib... 44 0.002
gi|128317|sp|P23121|NIFU_AZOCH NITROGEN FIXATION PROTEIN NIFU >g... 44 0.002
gi|33151606|ref|NP_872959.1| transformation locus protein OrfG h... 44 0.003
gi|15614281|ref|NP_242584.1| BH1718~unknown conserved protein [B... 44 0.003
gi|23467378|ref|ZP_00122960.1| COG0694: Thioredoxin-like protein... 44 0.003
gi|32491050|ref|NP_871304.1| yhgI [Wigglesworthia glossinidia en... 44 0.003
gi|34763076|ref|ZP_00144048.1| NifU-like protein [Fusobacterium ... 43 0.005
gi|15839192|ref|NP_299880.1| conserved hypothetical protein [Xyl... 43 0.005
gi|46911818|emb|CAG18616.1| conserved hypothetical protein [Phot... 43 0.006
gi|15617137|ref|NP_240350.1| hypothetical protein BU544 [Buchner... 43 0.006
gi|7387939|sp|Q43909|NIFU_AZOBR NITROGEN FIXATION PROTEIN NIFU >... 42 0.014
gi|27904960|ref|NP_778086.1| YhgI [Buchnera aphidicola (Baizongi... 42 0.014
gi|11034776|gb|AAG27073.1| NifU [Gluconacetobacter diazotrophicus] 42 0.014
gi|508310|gb|AAA22184.1| nitrogen fixation protein 41 0.019
gi|28188323|gb|AAL91100.1| NifU [Entamoeba histolytica] 41 0.019
gi|21654852|gb|AAK85709.1| iron-sulfur cluster NifU-like protein... 41 0.019
gi|23613732|ref|NP_704753.1| hypothetical protein [Plasmodium fa... 41 0.025
gi|45531545|ref|ZP_00182586.1| COG0694: Thioredoxin-like protein... 41 0.025
gi|28896920|ref|NP_796525.1| conserved hypothetical protein [Vib... 40 0.032
gi|1480126|emb|CAA68019.1| nifU [Pantoea agglomerans] 40 0.032
gi|50121870|ref|YP_051037.1| nitrogen fixation protein [Erwinia ... 40 0.042
gi|4325122|gb|AAD17270.1| NifV [Frankia sp. EuIK1] 39 0.071
gi|15791138|ref|NP_280962.1| Vng2337c [Halobacterium sp. NRC-1] ... 39 0.093
gi|16079247|ref|NP_390071.1| ypgR [Bacillus subtilis subsp. subt... 39 0.093
gi|41724015|ref|ZP_00150905.1| COG0822: NifU homolog involved in... 39 0.12
gi|128319|sp|P05343|NIFU_KLEPN NITROGEN FIXATION PROTEIN NIFU >g... 38 0.16
gi|149343|gb|AAA25155.1| nifU encoded protein 38 0.16
gi|29247239|gb|EAA38809.1| GLP_231_38952_38359 [Giardia lamblia ... 38 0.16
gi|29840661|ref|NP_829767.1| nifU protein, putative [Chlamydophi... 38 0.16
gi|37678411|ref|NP_933020.1| thioredoxin-like protein [Vibrio vu... 38 0.16
gi|27364312|ref|NP_759840.1| Thioredoxin-like protein [Vibrio vu... 38 0.16
gi|15791611|ref|NP_281434.1| nifU protein homolog [Campylobacter... 38 0.16
gi|15605453|ref|NP_220239.1| NifU-related protein [Chlamydia tra... 38 0.16
gi|46908330|ref|YP_014719.1| carbohydrate kinase, PfkB family [L... 38 0.21
gi|32266062|ref|NP_860094.1| NifU-like protein [Helicobacter hep... 38 0.21
gi|31194265|ref|XP_306080.1| ENSANGP00000000191 [Anopheles gambi... 37 0.27
gi|1709289|sp|Q07178|NIU1_RHOCA Nitrogen fixation protein nifU 1... 37 0.27
gi|39934444|ref|NP_946720.1| Nitrogen-fixing NifU, C-terminal [R... 37 0.27
gi|15644849|ref|NP_207019.1| nifU-like protein [Helicobacter pyl... 37 0.27
gi|30020290|ref|NP_831921.1| PBS lyase HEAT-like repeat [Bacillu... 37 0.35
gi|30262187|ref|NP_844564.1| PBS lyase HEAT-like repeat domain p... 37 0.35
gi|23490077|gb|EAA21937.1| hypothetical protein [Plasmodium yoel... 37 0.35
gi|15924420|ref|NP_371954.1| conserved hypothetical protein [Sta... 37 0.46
gi|49483621|ref|YP_040845.1| hypothetical protein SAR1443 [Staph... 37 0.46
gi|34558480|ref|NP_908295.1| NIFU-LIKE PROTEIN [Wolinella succin... 36 0.60
gi|6226659|sp|P46045|NIFU_FRAAL NITROGEN FIXATION PROTEIN NIFU >... 36 0.60
gi|45506743|ref|ZP_00159094.1| COG0694: Thioredoxin-like protein... 36 0.60
gi|47091763|ref|ZP_00229558.1| carbohydrate kinase, PfkB family ... 36 0.79
gi|16804134|ref|NP_465619.1| similar to 1-phosphofructokinase [... 36 0.79
gi|47095804|ref|ZP_00233409.1| carbohydrate kinase, PfkB family ... 36 0.79
gi|21400041|ref|NP_656026.1| EZ_HEAT, E-Z type HEAT repeats [Bac... 36 0.79
gi|46445797|ref|YP_007162.1| putative iron-sulfur cluster assemb... 36 0.79
gi|15611277|ref|NP_222928.1| putative [Helicobacter pylori J99] ... 34 2.3
gi|16801264|ref|NP_471532.1| similar to 1-phosphofructokinase [... 34 3.0
gi|50843141|ref|YP_056368.1| hypothetical protein PPA1678 [Propi... 33 3.9
gi|38229291|ref|NP_938384.1| 128L [Yaba monkey tumor virus] >gnl... 33 5.1
gi|15834718|ref|NP_296477.1| NifU-related protein [Chlamydia mur... 33 5.1
gi|32473707|ref|NP_866701.1| S-adenosylmethionine synthetase [Pi... 33 6.7
gi|19979593|dbj|BAB88752.1| polyketide synthase [Aspergillus ter... 32 8.7
gi|50251834|dbj|BAD27764.1| unknown protein [Oryza sativa (japon... 32 8.7
>gi|17541876|ref|NP_501917.1| HIRA interacting protein like, LiPid
Depleted LPD-8 (lpd-8) [Caenorhabditis elegans]
gi|7506596|pir||T24151 hypothetical protein R10H10.1 -
Caenorhabditis elegans
gi|3879150|emb|CAA94609.1| C. elegans LPD-8 protein (corresponding
sequence R10H10.1) [Caenorhabditis elegans]
Length = 222
Score = 413 bits (1061), Expect = e-114
Identities = 212/222 (95%), Positives = 212/222 (95%)
Frame = +1
Query: 1 MLTRLNRSFVQAARSMYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAI 180
MLTRLNRSFVQAARSMYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAI
Sbjct: 1 MLTRLNRSFVQAARSMYIQVQETPNPLSLKFLPGQQLLPDASKTYDFSSAATAKQSPLAI 60
Query: 181 KLLRVDGVKRVFFGEDFVTVTKSDETVDWALLRPEIFSTIADHIQTGKPVINEAATVSXX 360
KLLRVDGVKRVFFGEDFVTVTKSDETVDWALLRPEIFSTIADHIQTGKPVINEAATVS
Sbjct: 61 KLLRVDGVKRVFFGEDFVTVTKSDETVDWALLRPEIFSTIADHIQTGKPVINEAATVSDQ 120
Query: 361 XXXXXXXXMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKN 540
MMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKN
Sbjct: 121 VEEDDEVVMMIKEILETRIRPMVQEDGGDITYVGFDDGVVKLKMQGSCTGCPSSGVTLKN 180
Query: 541 GIENMLTFYVPEVKEVIEVKDESDDLVEQELKKFEQSKGIKD 666
GIENMLTFYVPEVKEVIEVKDESDDLVEQELKKFEQSKGIKD
Sbjct: 181 GIENMLTFYVPEVKEVIEVKDESDDLVEQELKKFEQSKGIKD 222