Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R11_2
(870 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21 ... 582 e-165
gi|39596351|emb|CAE69989.1| Hypothetical protein CBG16392 [Caeno... 542 e-153
gi|7506603|pir||T24162 hypothetical protein R11.1 - Caenorhabdit... 387 e-106
gi|50748440|ref|XP_421247.1| PREDICTED: similar to solute carrie... 324 1e-87
gi|13449279|ref|NP_085134.1| solute carrier family 25 (mitochond... 322 9e-87
gi|26331858|dbj|BAC29659.1| unnamed protein product [Mus musculu... 318 1e-85
gi|27369824|ref|NP_766165.1| solute carrier family 25 (mitochond... 317 2e-85
gi|19424330|ref|NP_598298.1| solute carrier family 25 (mitochond... 313 2e-84
gi|31206027|ref|XP_311965.1| ENSANGP00000011014 [Anopheles gambi... 312 5e-84
gi|24638958|ref|NP_569856.2| CG5254-PA [Drosophila melanogaster]... 297 2e-79
gi|47221229|emb|CAG13165.1| unnamed protein product [Tetraodon n... 268 1e-70
gi|19920986|ref|NP_609270.1| CG9582-PA [Drosophila melanogaster]... 209 5e-53
gi|50549725|ref|XP_502333.1| hypothetical protein [Yarrowia lipo... 206 5e-52
gi|45185795|ref|NP_983511.1| ACR109Wp [Eremothecium gossypii] >g... 204 2e-51
gi|46128223|ref|XP_388665.1| hypothetical protein FG08489.1 [Gib... 197 3e-49
gi|50306801|ref|XP_453376.1| unnamed protein product [Kluyveromy... 197 3e-49
gi|6325123|ref|NP_015191.1| Mitochondrial inner membrane transpo... 194 2e-48
gi|49086846|ref|XP_405436.1| hypothetical protein AN1299.2 [Aspe... 194 2e-48
gi|49077502|ref|XP_402603.1| hypothetical protein UM04988.1 [Ust... 192 1e-47
gi|6324796|ref|NP_014865.1| Mitochondrial inner membrane transpo... 190 4e-47
gi|46431307|gb|EAK90893.1| hypothetical protein CaO19.3518 [Cand... 189 5e-47
gi|19115123|ref|NP_594211.1| mitochondrial carrier protein; yeas... 188 2e-46
gi|17944417|gb|AAL48099.1| RE73432p [Drosophila melanogaster] 173 4e-42
gi|50290903|ref|XP_447884.1| unnamed protein product [Candida gl... 172 9e-42
gi|32407213|ref|XP_324194.1| hypothetical protein [Neurospora cr... 167 2e-40
gi|50259089|gb|EAL21766.1| hypothetical protein CNBC4680 [Crypto... 163 4e-39
gi|46443782|gb|EAL03061.1| hypothetical protein CaO19.3931 [Cand... 150 3e-35
gi|32418256|ref|XP_329606.1| hypothetical protein [Neurospora cr... 148 1e-34
gi|27807191|ref|NP_777081.1| solute carrier family 25 (mitochond... 148 1e-34
gi|39979123|emb|CAE85498.1| probable succinate-fumarate transpor... 148 1e-34
gi|23943838|ref|NP_694790.1| solute carrier family 25, member 1;... 148 2e-34
gi|21389315|ref|NP_005975.1| solute carrier family 25 (mitochond... 146 5e-34
gi|8394297|ref|NP_059003.1| solute carrier family 25, member 1 p... 145 9e-34
gi|27371299|gb|AAH41303.1| Slc25a1-prov protein [Xenopus laevis] 145 1e-33
gi|47228502|emb|CAG05322.1| unnamed protein product [Tetraodon n... 145 1e-33
gi|45361631|ref|NP_989391.1| hypothetical protein MGC76218 [Xeno... 144 2e-33
gi|1785635|emb|CAA65633.1| mitochondrial citrate transport prote... 143 4e-33
gi|7512351|pir||G01789 citrate transporter protein - human >gnl|... 143 4e-33
gi|46124377|ref|XP_386742.1| conserved hypothetical protein [Gib... 142 1e-32
gi|50427569|ref|XP_462397.1| unnamed protein product [Debaryomyc... 140 3e-32
gi|50756207|ref|XP_415059.1| PREDICTED: similar to Hypothetical ... 140 4e-32
gi|49075982|ref|XP_402014.1| hypothetical protein UM04399.1 [Ust... 139 1e-31
gi|31226914|ref|XP_317791.1| ENSANGP00000018102 [Anopheles gambi... 139 1e-31
gi|50310411|ref|XP_455225.1| unnamed protein product [Kluyveromy... 138 1e-31
gi|39590729|emb|CAE65099.1| Hypothetical protein CBG09959 [Caeno... 137 2e-31
gi|47226681|emb|CAG07840.1| unnamed protein product [Tetraodon n... 136 7e-31
gi|45200786|ref|NP_986356.1| AGL311Cp [Eremothecium gossypii] >g... 135 1e-30
gi|41055086|ref|NP_956901.1| hypothetical protein MGC63578 [Dani... 135 2e-30
gi|17554166|ref|NP_499187.1| solute carrier family 25 member 1 (... 134 3e-30
gi|38107122|gb|EAA53339.1| hypothetical protein MG07616.4 [Magna... 133 4e-30
gi|21356611|ref|NP_650084.1| CG31305-PG [Drosophila melanogaster... 131 2e-29
gi|50554747|ref|XP_504782.1| hypothetical protein [Yarrowia lipo... 130 3e-29
gi|28828299|gb|AAO50963.1| similar to Mus musculus (Mouse). Calc... 130 4e-29
gi|6322555|ref|NP_012629.1| Mitochondrial succinate-fumarate tra... 129 6e-29
gi|48106631|ref|XP_396134.1| similar to ENSANGP00000018102 [Apis... 128 1e-28
gi|396595|emb|CAA80973.1| ACR1-protein [Saccharomyces cerevisiae] 128 2e-28
gi|50258204|gb|EAL20898.1| hypothetical protein CNBE2590 [Crypto... 128 2e-28
gi|31236871|ref|XP_319491.1| ENSANGP00000020204 [Anopheles gambi... 127 3e-28
gi|24645975|ref|NP_731587.1| CG31305-PB [Drosophila melanogaster... 127 4e-28
gi|47086479|ref|NP_997947.1| solute carrier family 25 (mitochond... 127 4e-28
gi|15240954|ref|NP_195754.1| mitochondrial substrate carrier fam... 126 5e-28
gi|49079746|ref|XP_403484.1| hypothetical protein UM05869.1 [Ust... 125 9e-28
gi|21361103|ref|NP_003696.2| solute carrier family 25 (mitochond... 125 1e-27
gi|18381035|gb|AAH22156.1| AW491445 protein [Mus musculus] 125 2e-27
gi|23956272|ref|NP_598915.1| expressed sequence AW491445 [Mus mu... 125 2e-27
gi|21593290|gb|AAM65239.1| unknown [Arabidopsis thaliana] 124 3e-27
gi|6319768|ref|NP_009850.1| Mitochondrial inner membrane citrate... 123 5e-27
gi|27369581|ref|NP_766024.1| solute carrier family 25 (mitochond... 123 5e-27
gi|13124050|sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial c... 123 6e-27
gi|38648731|gb|AAH63272.1| MGC68968 protein [Xenopus laevis] 122 1e-26
gi|2506875|sp|P38152|TXTP_YEAST Tricarboxylate transport protein... 121 2e-26
gi|34861237|ref|XP_219484.2| similar to RIKEN cDNA 1300006L01 [R... 121 2e-26
gi|50254564|gb|EAL17313.1| hypothetical protein CNBN1400 [Crypto... 120 3e-26
gi|21311845|ref|NP_080922.1| solute carrier family 25 (mitochond... 120 3e-26
gi|24646146|ref|NP_650134.1| CG18347-PA [Drosophila melanogaster... 120 3e-26
gi|28571665|ref|NP_731657.2| CG12201-PB [Drosophila melanogaster... 120 3e-26
gi|50370021|gb|AAH75893.1| Unknown (protein for MGC:92113) [Dani... 120 4e-26
gi|20140239|sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier... 120 4e-26
gi|12849571|dbj|BAB28397.1| unnamed protein product [Mus musculu... 120 5e-26
gi|7657583|ref|NP_056644.1| solute carrier family 25 (mitochondr... 120 5e-26
gi|16741519|gb|AAH16571.1| Slc25a13 protein [Mus musculus] 120 5e-26
gi|49115574|gb|AAH73476.1| Unknown (protein for MGC:80993) [Xeno... 120 5e-26
gi|39585532|emb|CAE65292.1| Hypothetical protein CBG10209 [Caeno... 119 7e-26
gi|28527696|ref|XP_207112.2| similar to Mitochondrial glutamate ... 119 7e-26
gi|47224526|emb|CAG08776.1| unnamed protein product [Tetraodon n... 119 9e-26
gi|48734648|gb|AAH72270.1| Unknown (protein for IMAGE:4408521) [... 119 1e-25
gi|12833101|dbj|BAB22390.1| unnamed protein product [Mus musculus] 119 1e-25
gi|45187824|ref|NP_984047.1| ADL049Wp [Eremothecium gossypii] >g... 118 2e-25
gi|50259074|gb|EAL21751.1| hypothetical protein CNBC4530 [Crypto... 118 2e-25
gi|50730839|ref|XP_417040.1| PREDICTED: hypothetical protein XP_... 117 3e-25
gi|50294652|ref|XP_449737.1| unnamed protein product [Candida gl... 117 3e-25
gi|37748220|gb|AAH59349.1| MGC69168 protein [Xenopus laevis] 117 3e-25
gi|27694786|gb|AAH43827.1| Slc25a20-prov protein [Xenopus laevis] 117 4e-25
gi|7657581|ref|NP_055066.1| solute carrier family 25, member 13 ... 117 4e-25
gi|22002963|emb|CAD43091.1| mitochondrial aspartate-glutamate ca... 117 4e-25
gi|6523256|emb|CAB62206.1| aralar2 [Homo sapiens] 116 7e-25
gi|45360847|ref|NP_989099.1| carnitine/acylcarnitine translocase... 116 7e-25
gi|49250879|gb|AAH74507.1| Unknown (protein for MGC:69342) [Xeno... 116 7e-25
gi|47220738|emb|CAG11807.1| unnamed protein product [Tetraodon n... 116 7e-25
gi|13375983|ref|NP_078974.1| mitochondrial glutamate carrier 1 [... 116 7e-25
gi|10048462|ref|NP_065266.1| carnitine/acylcarnitine translocase... 115 1e-24
gi|24657945|ref|NP_647923.1| CG7514-PA [Drosophila melanogaster]... 115 1e-24
gi|23574792|dbj|BAC20608.1| solute carrier family 25 member 13 [... 115 1e-24
gi|23574715|dbj|BAC20586.1| mitochondrial carnitine/acylcarnitin... 115 2e-24
gi|50260692|gb|EAL23345.1| hypothetical protein CNBA4610 [Crypto... 115 2e-24
gi|4557403|ref|NP_000378.1| carnitine/acylcarnitine translocase;... 114 2e-24
gi|5851675|emb|CAB55356.1| carnitine/acylcarnitine translocase [... 114 2e-24
gi|47087357|ref|NP_998573.1| zgc:56592 [Danio rerio] >gnl|BL_ORD... 114 2e-24
gi|38111079|gb|EAA56711.1| hypothetical protein MG07066.4 [Magna... 114 2e-24
gi|50256975|gb|EAL19693.1| hypothetical protein CNBG3210 [Crypto... 114 2e-24
gi|32412508|ref|XP_326734.1| hypothetical protein ( (AL513442) p... 114 2e-24
gi|50292855|ref|XP_448860.1| unnamed protein product [Candida gl... 114 2e-24
gi|49116948|gb|AAH72926.1| Unknown (protein for MGC:80420) [Xeno... 114 4e-24
gi|6325278|ref|NP_015346.1| Mitochondrial transporter, acts both... 114 4e-24
gi|50556988|ref|XP_505902.1| hypothetical protein [Yarrowia lipo... 113 5e-24
gi|16758854|ref|NP_446417.1| solute carrier family 25 (carnitine... 113 5e-24
gi|17554998|ref|NP_498094.1| solute carrier family 25 member 15 ... 113 5e-24
gi|13899342|ref|NP_113669.1| solute carrier; mitochondrial gluta... 113 6e-24
gi|49079674|ref|XP_403456.1| hypothetical protein UM05841.1 [Ust... 113 6e-24
gi|50732673|ref|XP_425987.1| PREDICTED: similar to Calcium-bindi... 112 8e-24
gi|38101933|gb|EAA48831.1| hypothetical protein MG00489.4 [Magna... 112 1e-23
gi|46125507|ref|XP_387307.1| hypothetical protein FG07131.1 [Gib... 111 2e-23
gi|50291791|ref|XP_448328.1| unnamed protein product [Candida gl... 111 2e-23
gi|31127297|gb|AAH52871.1| Carnitine/acylcarnitine translocase [... 111 2e-23
gi|49129632|ref|XP_412922.1| hypothetical protein AN8785.2 [Aspe... 111 2e-23
gi|18079273|ref|NP_511109.1| CG16944-PA [Drosophila melanogaster... 111 2e-23
gi|24641090|ref|NP_727448.1| CG16944-PC [Drosophila melanogaster... 111 2e-23
gi|31200401|ref|XP_309148.1| ENSANGP00000018542 [Anopheles gambi... 111 2e-23
gi|24651387|ref|NP_733364.1| CG2139-PC [Drosophila melanogaster]... 110 3e-23
gi|48096652|ref|XP_392496.1| similar to ENSANGP00000018542 [Apis... 110 3e-23
gi|24651389|ref|NP_651795.2| CG2139-PA [Drosophila melanogaster]... 110 3e-23
gi|50748698|ref|XP_421367.1| PREDICTED: similar to AI132487 prot... 110 3e-23
gi|45552009|ref|NP_733366.2| CG2139-PB [Drosophila melanogaster]... 110 3e-23
gi|50754473|ref|XP_414400.1| PREDICTED: similar to Slc25a20-prov... 110 4e-23
gi|27482410|ref|XP_170736.2| similar to hypothetical protein [Ho... 110 5e-23
gi|39582673|emb|CAE73777.1| Hypothetical protein CBG21322 [Caeno... 110 5e-23
gi|37537070|ref|NP_922837.1| putative carnitine/acylcarnitine tr... 110 5e-23
gi|49109931|ref|XP_411706.1| hypothetical protein AN7569.2 [Aspe... 110 5e-23
gi|41053632|ref|NP_957153.1| hypothetical protein MGC77760 [Dani... 109 7e-23
gi|6942136|gb|AAF32322.1| ADP/ATP translocase [Lucilia cuprina] 109 7e-23
gi|19114613|ref|NP_593701.1| putative mitochondrial carrier prot... 109 7e-23
gi|49522572|gb|AAH75377.1| Unknown (protein for MGC:89095) [Xeno... 109 7e-23
gi|50547439|ref|XP_501189.1| hypothetical protein [Yarrowia lipo... 109 7e-23
gi|38969885|gb|AAH63207.1| LOC394840 protein [Xenopus tropicalis] 109 9e-23
gi|50419543|ref|XP_458298.1| unnamed protein product [Debaryomyc... 109 9e-23
gi|32421511|ref|XP_331199.1| hypothetical protein [Neurospora cr... 109 9e-23
gi|28830044|gb|AAO52534.1| similar to Plasmodium falciparum (iso... 109 9e-23
gi|3378495|emb|CAA07568.1| Mitochondrial carrier protein [Ribes ... 109 9e-23
gi|49077738|ref|XP_402694.1| hypothetical protein UM05079.1 [Ust... 108 1e-22
gi|31207265|ref|XP_312599.1| ENSANGP00000024030 [Anopheles gambi... 108 1e-22
gi|6523177|emb|CAB62169.1| ARALAR 1 protein [Drosophila melanoga... 108 1e-22
gi|6754952|ref|NP_035147.1| solute carrier family 25 (mitochondr... 108 1e-22
gi|31207267|ref|XP_312600.1| ENSANGP00000024716 [Anopheles gambi... 108 1e-22
gi|13385736|ref|NP_080508.1| solute carrier family 25, member 30... 108 2e-22
gi|47218080|emb|CAG09952.1| unnamed protein product [Tetraodon n... 108 2e-22
gi|45201032|ref|NP_986602.1| AGL064Wp [Eremothecium gossypii] >g... 108 2e-22
gi|50427443|ref|XP_462334.1| unnamed protein product [Debaryomyc... 108 2e-22
gi|50413055|ref|XP_457200.1| unnamed protein product [Debaryomyc... 108 2e-22
gi|19920862|ref|NP_609093.1| CG3476-PA [Drosophila melanogaster]... 108 2e-22
gi|27803005|emb|CAD60708.1| unnamed protein product [Podospora a... 107 3e-22
gi|49096066|ref|XP_409493.1| hypothetical protein AN5356.2 [Aspe... 107 3e-22
gi|48110095|ref|XP_393120.1| ADP/ATP translocase [Apis mellifera... 107 3e-22
gi|27673563|ref|XP_224969.1| similar to ornithine transporter [R... 107 3e-22
gi|50414715|gb|AAH77266.1| Unknown (protein for MGC:80014) [Xeno... 107 3e-22
gi|49080904|ref|XP_403918.1| hypothetical protein UM06303.1 [Ust... 107 3e-22
gi|30687297|ref|NP_181325.2| mitochondrial substrate carrier fam... 107 3e-22
gi|49071382|ref|XP_399980.1| hypothetical protein UM02365.1 [Ust... 107 3e-22
gi|24059753|dbj|BAC21621.1| hypothetical protein [Macaca fascicu... 107 3e-22
gi|50547779|ref|XP_501359.1| hypothetical protein [Yarrowia lipo... 107 3e-22
gi|47222529|emb|CAG02894.1| unnamed protein product [Tetraodon n... 107 3e-22
gi|38105554|gb|EAA51969.1| hypothetical protein MG03564.4 [Magna... 107 3e-22
gi|15341990|gb|AAH13194.1| Hypothetical protein FLJ20551 [Homo s... 107 3e-22
gi|50309099|ref|XP_454555.1| unnamed protein product [Kluyveromy... 107 4e-22
gi|32822820|gb|AAH55027.1| AI132487 protein [Mus musculus] 107 4e-22
gi|16769102|gb|AAL28770.1| LD16544p [Drosophila melanogaster] 107 4e-22
gi|41055825|ref|NP_956458.1| similar to solute carrier family 25... 107 4e-22
gi|39596407|emb|CAE63025.1| Hypothetical protein CBG07280 [Caeno... 107 4e-22
gi|7657585|ref|NP_055067.1| solute carrier family 25 (mitochondr... 107 4e-22
gi|10503963|gb|AAG17977.1| unknown [Homo sapiens] >gnl|BL_ORD_ID... 107 4e-22
gi|24641052|ref|NP_572639.2| CG1628-PB [Drosophila melanogaster]... 107 4e-22
gi|38073737|ref|XP_127129.2| expressed sequence AI876593 [Mus mu... 107 4e-22
gi|47682733|gb|AAH69939.1| AI132487 protein [Mus musculus] 107 4e-22
gi|37537072|ref|NP_922838.1| putative carnitine/acylcarnitine tr... 106 6e-22
gi|19115195|ref|NP_594283.1| mitochondial carrier protein; putat... 106 8e-22
gi|23394354|gb|AAN31467.1| ADP/ATP translocase [Phytophthora inf... 106 8e-22
gi|46130654|ref|XP_389107.1| hypothetical protein FG08931.1 [Gib... 106 8e-22
gi|45829841|gb|AAH68199.1| SLC25A5 protein [Homo sapiens] 106 8e-22
gi|19115332|ref|NP_594420.1| putative tricarboxylate transport p... 106 8e-22
gi|50752052|ref|XP_422631.1| PREDICTED: similar to Hypothetical ... 106 8e-22
gi|2772564|gb|AAB96347.1| ADP/ATP carrier protein (adenine nucle... 106 8e-22
gi|38083666|ref|XP_111757.2| mutant ornithine transporter 2 [Mus... 105 1e-21
gi|24657951|ref|NP_647924.2| CG18418-PA [Drosophila melanogaster... 105 1e-21
gi|50730921|ref|XP_417080.1| PREDICTED: similar to Mitochondrial... 105 1e-21
gi|50424539|ref|XP_460858.1| unnamed protein product [Debaryomyc... 105 1e-21
gi|50309571|ref|XP_454797.1| unnamed protein product [Kluyveromy... 105 1e-21
gi|20151395|gb|AAM11057.1| GH11346p [Drosophila melanogaster] 105 1e-21
gi|50554181|ref|XP_504499.1| hypothetical protein [Yarrowia lipo... 105 1e-21
gi|34856875|ref|XP_215549.2| similar to osmotic stress protein [... 105 2e-21
gi|50420127|ref|XP_458596.1| unnamed protein product [Debaryomyc... 105 2e-21
gi|13775208|ref|NP_112581.1| hypothetical protein DKFZp434N1235 ... 105 2e-21
gi|37964368|gb|AAR06239.1| dicarboxylate/tricarboxylate carrier ... 105 2e-21
gi|4502099|ref|NP_001143.1| solute carrier family 25, member 5; ... 105 2e-21
gi|902008|gb|AAC52837.1| adenine nucleotide translocase-1 105 2e-21
gi|27764863|ref|NP_001627.1| solute carrier family 25, member A6... 105 2e-21
gi|8923520|ref|NP_060345.1| hypothetical protein FLJ20551 [Homo ... 104 2e-21
gi|30686563|ref|NP_850252.1| mitochondrial substrate carrier fam... 104 3e-21
gi|1944534|emb|CAA73099.1| colt [Drosophila melanogaster] 104 3e-21
gi|47550717|ref|NP_999867.1| Unknown (protein for MGC:77591); wu... 104 3e-21
gi|20863388|ref|XP_134169.1| solute carrier family 25 (mitochond... 104 3e-21
gi|26346937|dbj|BAC37117.1| unnamed protein product [Mus musculus] 104 3e-21
gi|15241167|ref|NP_197477.1| dicarboxylate/tricarboxylate carrie... 104 3e-21
gi|47523888|ref|NP_999583.1| mitochondrial solute carrier family... 104 3e-21
gi|38372886|sp|Q9BXI2|ORT2_HUMAN Mitochondrial ornithine transpo... 103 4e-21
gi|29824085|dbj|BAC75537.1| ADP/ATP translocase [Rana rugosa] 103 4e-21
gi|29824087|dbj|BAC75538.1| ADP/ATP translocase [Rana rugosa] >g... 103 4e-21
gi|50551655|ref|XP_503302.1| hypothetical protein [Yarrowia lipo... 103 4e-21
gi|15559050|gb|AAL02100.1| ADP-ATP translocator [Ethmostigmus ru... 103 4e-21
gi|4115754|dbj|BAA36508.1| ADP/ATP translocase [Rana rugosa] >gn... 103 4e-21
gi|32189334|ref|NP_777084.1| solute carrier family 25 member 5; ... 103 4e-21
gi|31203391|ref|XP_310644.1| ENSANGP00000007451 [Anopheles gambi... 103 4e-21
gi|4115752|dbj|BAA36507.1| ADP/ATP translocase [Rana rugosa] 103 4e-21
gi|22266728|gb|AAM94902.1| ornithine transporter 2 [Homo sapiens] 103 5e-21
gi|34872487|ref|XP_216577.2| similar to 5730438N18Rik protein [R... 103 5e-21
gi|47939698|gb|AAH72091.1| MGC79005 protein [Xenopus laevis] 103 5e-21
gi|50540402|ref|NP_001002667.1| zgc:92447 [Danio rerio] >gnl|BL_... 103 6e-21
gi|46440024|gb|EAK99335.1| hypothetical protein CaO19.2599 [Cand... 103 6e-21
gi|46435410|gb|EAK94792.1| hypothetical protein CaO19.4447 [Cand... 103 6e-21
gi|45360477|ref|NP_988909.1| hypothetical protein MGC75662 [Xeno... 103 6e-21
gi|38014819|gb|AAH60533.1| Solute carrier family 25, member 4 [R... 103 6e-21
gi|22094075|ref|NP_031477.1| solute carrier family 25, member 5;... 103 6e-21
gi|47229664|emb|CAG06860.1| unnamed protein product [Tetraodon n... 102 8e-21
gi|29824083|dbj|BAC75536.1| ADP/ATP translocase [Rana rugosa] 102 8e-21
gi|48040456|ref|NP_001001509.1| mitochondrial hepatocellular car... 102 8e-21
gi|3885438|gb|AAC77879.1| ADP/ATP translocase [Dictyostelium dis... 102 8e-21
gi|46444645|gb|EAL03918.1| hypothetical protein CaO19.4583 [Cand... 102 8e-21
gi|9758516|dbj|BAB08924.1| carnitine/acylcarnitine translocase-l... 102 8e-21
gi|7493804|pir||T18253 probable mitochondrial carrier protein - ... 102 8e-21
gi|30409998|ref|NP_848473.1| RIKEN cDNA 1700034J06 [Mus musculus... 102 8e-21
gi|18422718|ref|NP_568670.1| mitochondrial carnitine/acyl carrie... 102 8e-21
gi|113463|sp|P12236|ADT3_HUMAN ADP,ATP carrier protein, liver is... 102 8e-21
gi|32189350|ref|NP_476443.1| solute carrier family 25, member 5;... 102 8e-21
gi|4115750|dbj|BAA36506.1| ADP/ATP translocase [Rana rugosa] >gn... 102 8e-21
gi|34857479|ref|XP_215796.2| similar to adenine nucleotide trans... 102 8e-21
gi|32189355|ref|NP_445967.1| solute carrier family 25, member 4;... 102 8e-21
gi|27682801|ref|XP_226032.1| similar to mutant ornithine transpo... 102 1e-20
gi|50746461|ref|XP_420508.1| PREDICTED: similar to ADP/ATP trans... 102 1e-20
gi|2130090|pir||S65040 2-oxoglutarate/malate translocator (clone... 102 1e-20
gi|50545549|ref|XP_500312.1| hypothetical protein [Yarrowia lipo... 102 1e-20
gi|46444126|gb|EAL03403.1| hypothetical protein CaO19.4966 [Cand... 102 1e-20
gi|31216089|ref|XP_316164.1| ENSANGP00000020391 [Anopheles gambi... 102 1e-20
gi|32189336|ref|NP_777085.1| solute carrier family 25 member 6; ... 102 1e-20
gi|2668412|dbj|BAA23777.1| ADP/ATP translocase [Oryctolagus cuni... 102 1e-20
gi|17554004|ref|NP_497274.1| solute carrier family 25 member 13 ... 102 1e-20
gi|17137310|ref|NP_477221.1| CG3057-PA [Drosophila melanogaster]... 102 1e-20
gi|31200033|ref|XP_308964.1| ENSANGP00000020278 [Anopheles gambi... 102 1e-20
gi|28261391|gb|AAO32817.1| ADP/ATP translocase [Bombyx mori] 102 1e-20
gi|45360469|ref|NP_988913.1| adenine nucleotide translocase [Xen... 102 1e-20
gi|86755|pir||A29132 ADP,ATP carrier protein T2 - human >gnl|BL_... 102 1e-20
gi|46136699|ref|XP_390041.1| conserved hypothetical protein [Gib... 101 2e-20
gi|50732900|ref|XP_418818.1| PREDICTED: similar to Hypothetical ... 101 2e-20
gi|39596651|emb|CAE63270.1| Hypothetical protein CBG07647 [Caeno... 101 2e-20
gi|28207648|gb|AAO32325.1| ADP/ATP translocase [Manduca sexta] 101 2e-20
gi|31208625|ref|XP_313279.1| ENSANGP00000011068 [Anopheles gambi... 100 3e-20
gi|15220023|ref|NP_178108.1| mitochondrial substrate carrier fam... 100 3e-20
gi|47777469|gb|AAT38102.1| putative mitochondrial carrier protei... 100 3e-20
gi|24637838|gb|AAN63886.1| brain mitochondrial carrier protein l... 100 4e-20
gi|25295875|pir||D84798 probable mitochondrial carrier protein [... 100 4e-20
gi|17562272|ref|NP_505414.1| uncoupling protein (5J815) [Caenorh... 100 4e-20
gi|24637836|gb|AAN63885.1| brain mitochondrial carrier protein s... 100 4e-20
gi|32417256|ref|XP_329106.1| hypothetical protein [Neurospora cr... 100 4e-20
gi|39654366|pdb|1OKC|A Chain A, Structure Of Mitochondrial AdpAT... 100 4e-20
gi|20141977|sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier pro... 100 4e-20
gi|2130089|pir||S65042 2-oxoglutarate/malate translocator (clone... 100 4e-20
gi|50539802|ref|NP_001002367.1| zgc:92090 [Danio rerio] >gnl|BL_... 100 4e-20
gi|6755544|ref|NP_035528.1| solute carrier family 25 (mitochondr... 100 4e-20
gi|49106417|ref|XP_411424.1| hypothetical protein AN7287.2 [Aspe... 100 4e-20
gi|47227215|emb|CAG00577.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|19913109|emb|CAC84547.1| dicarboxylate/tricarboxylate carrier... 100 4e-20
gi|32189340|ref|NP_777083.1| solute carrier family 25 member 4; ... 100 4e-20
gi|13994341|ref|NP_114153.1| solute carrier family 25 member 2; ... 100 5e-20
gi|28269709|gb|AAO32818.2| ADP/ATP translocase [Anopheles gambiae] 100 5e-20
gi|4507009|ref|NP_003942.1| solute carrier family 25, member 14 ... 100 5e-20
gi|32564064|ref|NP_493694.2| carrier (33.3 kD) (2A577) [Caenorha... 100 5e-20
gi|50285421|ref|XP_445139.1| unnamed protein product [Candida gl... 100 5e-20
gi|7494946|pir||T25459 hypothetical protein B0432.4 - Caenorhabd... 100 5e-20
gi|13259543|ref|NP_073721.1| solute carrier family 25, member 14... 100 5e-20
gi|46123845|ref|XP_386476.1| hypothetical protein FG06300.1 [Gib... 100 5e-20
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam... 100 5e-20
gi|34784032|gb|AAH56716.1| Zgc:65787 protein [Danio rerio] >gnl|... 100 7e-20
gi|15559393|gb|AAH14064.1| Hypothetical protein FLJ10618 [Homo s... 100 7e-20
gi|10716672|dbj|BAB16384.1| uncoupling protein [Triticum aestivum] 100 7e-20
gi|20270293|ref|NP_620095.1| RIKEN cDNA C330005L02 [Mus musculus... 100 7e-20
gi|28207869|emb|CAD62588.1| unnamed protein product [Homo sapiens] 100 7e-20
gi|19913105|emb|CAC84545.1| dicarboxylate/tricarboxylate carrier... 100 7e-20
gi|34935485|ref|XP_234551.2| similar to expressed sequence AW491... 100 7e-20
gi|50550059|ref|XP_502502.1| hypothetical protein [Yarrowia lipo... 100 7e-20
gi|37546000|ref|XP_208731.2| similar to expressed sequence AW491... 100 7e-20
gi|15030091|gb|AAH11293.1| 5730438N18Rik protein [Mus musculus] 100 7e-20
gi|46397377|ref|NP_997000.2| chromosome 14 open reading frame 68... 100 7e-20
gi|6319669|ref|NP_009751.1| Protein of the mitochondrial carrier... 100 7e-20
gi|113455|sp|P12235|ADT1_HUMAN ADP,ATP carrier protein, heart/sk... 100 7e-20
gi|2833329|sp|Q27238|ADT_ANOGA ADP,ATP carrier protein (ADP/ATP ... 99 9e-20
gi|42569598|ref|NP_180938.2| mitochondrial substrate carrier fam... 99 9e-20
gi|17865339|ref|NP_445953.1| solute carrier family 25 (mitochond... 99 9e-20
gi|339721|gb|AAA36749.1| ADP.ATP translocase 99 9e-20
gi|7768837|dbj|BAA95593.1| brain mitochondrial carrier protein-1... 99 9e-20
gi|31240035|ref|XP_320431.1| ENSANGP00000016898 [Anopheles gambi... 99 9e-20
gi|32407871|ref|XP_324432.1| hypothetical protein [Neurospora cr... 99 9e-20
gi|17567217|ref|NP_510493.1| solute carrier (XP620) [Caenorhabdi... 99 9e-20
gi|423368|pir||S31814 ADP,ATP carrier protein T2 - mouse 99 9e-20
gi|50305677|ref|XP_452799.1| unnamed protein product [Kluyveromy... 99 1e-19
gi|46136919|ref|XP_390151.1| hypothetical protein FG09975.1 [Gib... 99 1e-19
gi|17540658|ref|NP_501198.1| solute carrier (4I239) [Caenorhabdi... 99 1e-19
gi|39593597|emb|CAE61889.1| Hypothetical protein CBG05880 [Caeno... 99 1e-19
gi|49111364|ref|XP_411808.1| hypothetical protein AN7671.2 [Aspe... 99 1e-19
gi|27545251|ref|NP_775354.1| solute carrier family 25 alpha, mem... 99 1e-19
gi|7542476|gb|AAF63471.1| adenine nucleotide translocase [Xenopu... 99 1e-19
gi|46445003|gb|EAL04274.1| hypothetical protein CaO19.13347 [Can... 99 2e-19
gi|10716674|dbj|BAB16385.1| uncoupling protein [Triticum aestivum] 99 2e-19
gi|50427043|ref|XP_462126.1| unnamed protein product [Debaryomyc... 99 2e-19
gi|47207195|emb|CAF90256.1| unnamed protein product [Tetraodon n... 99 2e-19
gi|50289063|ref|XP_446961.1| unnamed protein product [Candida gl... 98 2e-19
gi|7505416|pir||T15253 hypothetical protein K07B1.3 - Caenorhabd... 98 2e-19
gi|17737302|ref|NP_511110.1| CG1683-PA [Drosophila melanogaster]... 98 2e-19
gi|399014|sp|P31692|ADT_CHLKE ADP,ATP carrier protein (ADP/ATP t... 98 2e-19
gi|46442822|gb|EAL02108.1| hypothetical protein CaO19.804 [Candi... 98 2e-19
gi|19115553|ref|NP_594641.1| agpet8 protein. [Schizosaccharomyce... 98 2e-19
gi|47937747|gb|AAH72308.1| MGC82600 protein [Xenopus laevis] 98 3e-19
gi|21593041|gb|AAM64990.1| putative carnitine/acylcarnitine tran... 98 3e-19
gi|15236783|ref|NP_194966.1| mitochondrial substrate carrier fam... 98 3e-19
gi|21450145|ref|NP_659042.1| cDNA sequence BC010801 [Mus musculu... 98 3e-19
gi|25408417|pir||B84773 probable mitochondrial carrier protein [... 97 4e-19
gi|10798640|emb|CAC12820.1| mitochondrial 2-oxoglutarate/malate ... 97 4e-19
gi|39589858|emb|CAE60856.1| Hypothetical protein CBG04567 [Caeno... 97 4e-19
gi|1197164|dbj|BAA11765.1| ADT/ATP translocase [Halocynthia rore... 97 4e-19
gi|22002462|dbj|BAC06495.1| mitochondrial uncoupling protein [He... 97 4e-19
gi|47219992|emb|CAG11525.1| unnamed protein product [Tetraodon n... 97 4e-19
gi|46437608|gb|EAK96951.1| hypothetical protein CaO19.9724 [Cand... 97 5e-19
gi|34865800|ref|XP_236557.2| similar to RIKEN cDNA C330005L02 [R... 97 5e-19
gi|19913107|emb|CAC84546.1| dicarboxylate/tricarboxylate carrier... 97 5e-19
gi|14150082|ref|NP_115691.1| mitochondrial carrier protein MGC43... 97 5e-19
gi|21358457|ref|NP_651703.1| CG1907-PA [Drosophila melanogaster]... 97 6e-19
gi|339723|gb|AAA36750.1| ADP.ATP translocase 97 6e-19
gi|31238945|ref|XP_319886.1| ENSANGP00000010634 [Anopheles gambi... 97 6e-19
gi|21357261|ref|NP_648501.1| CG7314-PB [Drosophila melanogaster]... 97 6e-19
gi|17539262|ref|NP_501803.1| adenine nucleotide family member (3... 97 6e-19
gi|49899706|gb|AAH76734.1| Unknown (protein for MGC:81365) [Xeno... 97 6e-19
gi|50419171|ref|XP_458108.1| unnamed protein product [Debaryomyc... 97 6e-19
gi|34903084|ref|NP_912889.1| unnamed protein product [Oryza sati... 97 6e-19
gi|39594577|emb|CAE72155.1| Hypothetical protein CBG19253 [Caeno... 96 8e-19
gi|345469|pir||S31935 ADP,ATP carrier protein - African malaria ... 96 8e-19
gi|7489246|pir||T07405 oxoglutarate/malate translocator - potato... 96 8e-19
gi|39586904|emb|CAE62839.1| Hypothetical protein CBG07018 [Caeno... 96 8e-19
gi|38110172|gb|EAA55933.1| hypothetical protein MG01584.4 [Magna... 96 8e-19
gi|38049698|ref|XP_204210.2| similar to adenine nucleotide trans... 96 8e-19
gi|47216429|emb|CAG01980.1| unnamed protein product [Tetraodon n... 96 8e-19
gi|39585747|emb|CAE59949.1| Hypothetical protein CBG03436 [Caeno... 96 8e-19
gi|13537345|dbj|BAB40657.1| uncoupling protein [Oryza sativa (ja... 96 8e-19
gi|15223820|ref|NP_172908.1| mitochondrial substrate carrier fam... 96 8e-19
gi|34394981|dbj|BAC84529.1| mitochondrial aspartate-glutamate ca... 96 8e-19
gi|4502097|ref|NP_001142.1| solute carrier family 25 (mitochondr... 96 1e-18
gi|39592165|emb|CAE75385.1| Hypothetical protein CBG23372 [Caeno... 96 1e-18
gi|18395659|ref|NP_564233.1| mitochondrial substrate carrier fam... 96 1e-18
gi|33391179|gb|AAQ17207.1| ADP/ATP translocase [Branchiostoma be... 96 1e-18
gi|47228784|emb|CAG07516.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|47224840|emb|CAG06410.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|2226436|gb|AAB61765.1| LA-MSC [Oxytricha fallax] 96 1e-18
gi|11277066|pir||T49628 probable dicarboxylate carrier protein [... 96 1e-18
gi|32414947|ref|XP_327953.1| probable dicarboxylate carrier prot... 96 1e-18
gi|45361479|ref|NP_989316.1| hypothetical protein MGC76123 [Xeno... 96 1e-18
gi|46108312|ref|XP_381214.1| hypothetical protein FG01038.1 [Gib... 96 1e-18
gi|32414381|ref|XP_327670.1| hypothetical protein [Neurospora cr... 96 1e-18
gi|46442238|gb|EAL01529.1| hypothetical protein CaO19.7082 [Cand... 95 2e-18
gi|254728|gb|AAB23114.1| ADP/ATP translocase [Drosophila melanog... 95 2e-18
gi|46434312|gb|EAK93725.1| hypothetical protein CaO19.11975 [Can... 95 2e-18
gi|34867789|ref|XP_234550.2| similar to chromosome 14 open readi... 95 2e-18
gi|38080406|ref|XP_357488.1| similar to adenine nucleotide trans... 95 2e-18
gi|18420458|ref|NP_568060.1| mitochondrial substrate carrier fam... 95 2e-18
gi|50745529|ref|XP_420143.1| PREDICTED: similar to solute carrie... 95 2e-18
gi|28571261|ref|NP_788934.1| CG33075-PA [Drosophila melanogaster... 95 2e-18
gi|34866642|ref|XP_217295.2| similar to hypothetical protein MGC... 95 2e-18
gi|41200918|ref|XP_370619.1| similar to mitochondrial carrier pr... 95 2e-18
gi|38099451|gb|EAA46798.1| hypothetical protein MG10492.4 [Magna... 95 2e-18
gi|45383666|ref|NP_989562.1| solute carrier family 25 (mitochond... 95 2e-18
gi|50260360|gb|EAL23019.1| hypothetical protein CNBA7860 [Crypto... 94 3e-18
gi|31340019|sp|Q8N8R3|CACL_HUMAN Mitchondrial carnitine/acylcarn... 94 3e-18
gi|8922551|ref|NP_060625.1| hypothetical protein FLJ10618 [Homo ... 94 3e-18
gi|31044469|ref|NP_851845.1| solute carrier family 25, member 29... 94 3e-18
gi|28193150|emb|CAD62317.1| unnamed protein product [Homo sapiens] 94 3e-18
gi|13445630|gb|AAK26321.1| mutant ornithine transporter 2 [Mus m... 94 3e-18
gi|50259254|gb|EAL21927.1| hypothetical protein CNBC0670 [Crypto... 94 4e-18
gi|50539780|ref|NP_001002360.1| zgc:92520 [Danio rerio] >gnl|BL_... 94 4e-18
gi|47216440|emb|CAG01991.1| unnamed protein product [Tetraodon n... 94 4e-18
gi|13445807|gb|AAK26384.1| ADP/ATP carrier [Toxoplasma gondii] 94 4e-18
gi|49068770|ref|XP_398674.1| hypothetical protein UM01059.1 [Ust... 94 4e-18
gi|50424283|ref|XP_460728.1| unnamed protein product [Debaryomyc... 94 4e-18
gi|45190354|ref|NP_984608.1| AEL253Wp [Eremothecium gossypii] >g... 94 4e-18
gi|50550183|ref|XP_502564.1| YlAAC1 [Yarrowia lipolytica] >gnl|B... 94 5e-18
gi|9294686|dbj|BAB03052.1| mitochondrial carrier protein-like [A... 94 5e-18
gi|24650120|ref|NP_651415.1| CG4743-PA [Drosophila melanogaster]... 94 5e-18
gi|11024984|gb|AAB31734.3| ADP/ATP translocase [Drosophila melan... 94 5e-18
gi|50308765|ref|XP_454387.1| unnamed protein product [Kluyveromy... 94 5e-18
gi|49093852|ref|XP_408387.1| hypothetical protein AN4250.2 [Aspe... 94 5e-18
gi|18402984|ref|NP_566683.1| mitochondrial substrate carrier fam... 94 5e-18
gi|32421203|ref|XP_331045.1| hypothetical protein [Neurospora cr... 94 5e-18
gi|6746567|gb|AAF27626.1| hydrogenosomal membrane protein 31 pre... 94 5e-18
gi|49084042|ref|XP_404252.1| hypothetical protein AN0115.2 [Aspe... 94 5e-18
gi|50754517|ref|XP_414419.1| PREDICTED: similar to S-adenosylmet... 94 5e-18
gi|47156872|gb|AAT12275.1| plastidial ADP-glucose transporter [H... 93 7e-18
gi|49075182|ref|XP_401675.1| hypothetical protein UM04060.1 [Ust... 93 7e-18
gi|46445453|gb|EAL04721.1| hypothetical protein CaO19.4733 [Cand... 93 7e-18
gi|13879465|gb|AAH06711.1| Solute carrier family 25 (mitochondri... 93 7e-18
gi|32414139|ref|XP_327549.1| hypothetical protein [Neurospora cr... 93 7e-18
gi|49274667|gb|AAT58694.1| putative ADP/ATP translocase [Oryza s... 93 7e-18
gi|49131161|ref|XP_413018.1| hypothetical protein AN8881.2 [Aspe... 93 7e-18
gi|11277067|pir||T45934 hypothetical protein F5K20.240 - Arabido... 93 7e-18
gi|34867863|ref|XP_221696.2| similar to solute carrier family 25... 93 9e-18
gi|47219162|emb|CAG01825.1| unnamed protein product [Tetraodon n... 93 9e-18
gi|31240529|ref|XP_320678.1| ENSANGP00000020014 [Anopheles gambi... 93 9e-18
gi|15223098|ref|NP_172866.1| mitochondrial substrate carrier fam... 92 1e-17
gi|27807211|ref|NP_777096.1| solute carrier family 25 (mitochond... 92 1e-17
gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697) [Caenorhab... 92 1e-17
gi|49250406|gb|AAH74600.1| Unknown (protein for MGC:69323) [Xeno... 92 1e-17
gi|45361183|ref|NP_989179.1| hypothetical protein MGC75881 [Xeno... 92 1e-17
gi|34907168|ref|NP_914931.1| putative mitochondrial carrier prot... 92 1e-17
gi|18407372|ref|NP_566102.1| mitochondrial substrate carrier fam... 92 1e-17
gi|29244360|ref|NP_808477.1| hypothetical protein E230025K15 [Mu... 92 1e-17
gi|31199199|ref|XP_308547.1| ENSANGP00000015935 [Anopheles gambi... 92 1e-17
gi|19921888|ref|NP_610468.1| CG8026-PB [Drosophila melanogaster]... 92 1e-17
gi|17555306|ref|NP_499782.1| ADP/ATP translocase, a member of th... 92 1e-17
gi|47522914|ref|NP_999214.1| uncoupling protein 3 [Sus scrofa] >... 92 1e-17
gi|45198664|ref|NP_985693.1| AFR146Wp [Eremothecium gossypii] >g... 92 1e-17
gi|18424178|ref|NP_568894.1| uncoupling protein (UCP2) [Arabidop... 92 1e-17
gi|50292627|ref|XP_448746.1| unnamed protein product [Candida gl... 92 1e-17
gi|4959955|gb|AAD34562.1| unknown [Aspergillus terreus] 92 1e-17
gi|47225418|emb|CAG11901.1| unnamed protein product [Tetraodon n... 92 1e-17
gi|46445255|gb|EAL04524.1| hypothetical protein CaO19.12195 [Can... 92 1e-17
gi|231654|sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast pre... 92 1e-17
gi|50344854|ref|NP_001002099.1| zgc:86898 [Danio rerio] >gnl|BL_... 92 1e-17
gi|47223331|emb|CAF98715.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|1580888|prf||2116232A 2-oxoglutarate carrier protein 92 2e-17
gi|50555253|ref|XP_505035.1| hypothetical protein [Yarrowia lipo... 92 2e-17
gi|7106157|dbj|BAA92172.1| SfUCPa [Symplocarpus foetidus] 92 2e-17
gi|2655147|gb|AAB87883.1| ADP/ATP translocase [Drosophila pseudo... 92 2e-17
gi|15232420|ref|NP_190979.1| plant uncoupling mitochondrial prot... 92 2e-17
gi|13537347|dbj|BAB40658.1| uncoupling protein [Oryza sativa (ja... 92 2e-17
gi|18399114|ref|NP_564436.1| mitochondrial substrate carrier fam... 92 2e-17
gi|32412936|ref|XP_326948.1| hypothetical protein [Neurospora cr... 91 3e-17
gi|21312994|ref|NP_077173.1| solute carrier family 25 (mitochond... 91 3e-17
gi|27754081|ref|NP_080531.2| solute carrier family 25 (mitochond... 91 3e-17
gi|47124656|gb|AAH70531.1| MGC78829 protein [Xenopus laevis] 91 3e-17
gi|18417739|ref|NP_568317.1| mitochondrial substrate carrier fam... 91 3e-17
gi|24582068|ref|NP_608977.1| CG18340-PA [Drosophila melanogaster... 91 3e-17
gi|21553961|gb|AAM63042.1| putative mitochondrial carrier protei... 91 3e-17
gi|1079478|pir||A56650 2-oxoglutarate carrier protein - human >g... 91 3e-17
gi|21361114|ref|NP_003553.2| solute carrier family 25 (mitochond... 91 3e-17
gi|47227813|emb|CAG08976.1| unnamed protein product [Tetraodon n... 91 3e-17
gi|27679114|ref|XP_214533.1| similar to ADP,ATP carrier protein,... 91 3e-17
gi|50405213|ref|YP_054305.1| Mitochondrial carrier protein, puta... 91 3e-17
gi|50294323|ref|XP_449573.1| unnamed protein product [Candida gl... 91 3e-17
gi|50553226|ref|XP_504023.1| hypothetical protein [Yarrowia lipo... 91 4e-17
gi|15240999|ref|NP_195770.1| mitochondrial substrate carrier fam... 91 4e-17
gi|50582710|gb|AAT78780.1| mitochondrial carrier protein-like pr... 91 4e-17
gi|21592525|gb|AAM64475.1| putative carrier protein [Arabidopsis... 91 4e-17
gi|50549063|ref|XP_502002.1| hypothetical protein [Yarrowia lipo... 91 4e-17
gi|48141294|ref|XP_393549.1| similar to CG8026-PA [Apis mellifera] 91 4e-17
gi|15222270|ref|NP_172184.1| mitochondrial substrate carrier fam... 91 4e-17
gi|21537040|gb|AAM61381.1| contains similarity to peroxisomal me... 91 4e-17
gi|50285479|ref|XP_445168.1| unnamed protein product [Candida gl... 90 6e-17
gi|20161078|dbj|BAB90009.1| putative mitochondrial carrier [Oryz... 90 6e-17
gi|41351486|emb|CAE45652.1| S-adenosylmethionine carrier protein... 90 6e-17
gi|34904170|ref|NP_913432.1| putative carnitine/acylcarnitine tr... 90 6e-17
gi|15241360|ref|NP_199918.1| mitochondrial substrate carrier fam... 90 6e-17
gi|34394749|dbj|BAC84113.1| putative mitochondrial carrier prote... 90 6e-17
gi|50759281|ref|XP_417600.1| PREDICTED: similar to mitochondrial... 90 6e-17
gi|46806315|dbj|BAD17507.1| 2-oxoglutarate carrier-like protein ... 90 6e-17
gi|15233884|ref|NP_194188.1| mitochondrial substrate carrier fam... 90 6e-17
gi|6324674|ref|NP_014743.1| Mitochondrial inner membrane carniti... 90 6e-17
gi|39586413|emb|CAE74071.1| Hypothetical protein CBG21724 [Caeno... 90 7e-17
gi|33086456|gb|AAP92540.1| Ab1-114 [Rattus norvegicus] 90 7e-17
gi|2655149|gb|AAB87884.1| ADP/ATP translocase [Drosophila subobs... 90 7e-17
gi|15234063|ref|NP_192019.1| mitochondrial substrate carrier fam... 90 7e-17
gi|47523642|ref|NP_999454.1| uncoupling protein homolog [Sus scr... 90 7e-17
gi|39586563|emb|CAE73690.1| Hypothetical protein CBG21201 [Caeno... 90 7e-17
gi|41053768|ref|NP_956550.1| hypothetical protein MGC55610 [Dani... 89 1e-16
gi|4928052|gb|AAD33396.1| uncoupling protein 3 [Sus scrofa] 89 1e-16
gi|50251364|dbj|BAD28391.1| mitochondrial substrate carrier prot... 89 1e-16
gi|17558962|ref|NP_506621.1| mitochondrial substrate carrier (34... 89 1e-16
gi|49072264|ref|XP_400421.1| hypothetical protein UM02806.1 [Ust... 89 1e-16
gi|38103669|gb|EAA50344.1| hypothetical protein MG04103.4 [Magna... 89 1e-16
gi|38102418|gb|EAA49259.1| hypothetical protein MG00917.4 [Magna... 89 1e-16
gi|6322905|ref|NP_012978.1| Mitochondrial iron transporter of th... 89 1e-16
gi|32566691|ref|NP_872134.1| mitochondrial substrate carrier (39... 89 1e-16
gi|15227225|ref|NP_179836.1| mitochondrial substrate carrier fam... 89 1e-16
gi|49069984|ref|XP_399281.1| hypothetical protein UM01666.1 [Ust... 89 1e-16
gi|27881739|gb|AAH44682.1| Ucp2-prov protein [Xenopus laevis] 89 1e-16
gi|6325315|ref|NP_015383.1| Putative mitochondrial inner membran... 89 1e-16
gi|32405390|ref|XP_323308.1| hypothetical protein [Neurospora cr... 89 1e-16
gi|45187609|ref|NP_983832.1| ADL264Cp [Eremothecium gossypii] >g... 89 1e-16
gi|38194914|gb|AAR13302.1| mitochondrial carrier protein [Phaseo... 89 1e-16
>gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21
(31.8 kD) (XQ807) [Caenorhabditis elegans]
gi|22265852|emb|CAB04651.3| Hypothetical protein R11.1
[Caenorhabditis elegans]
Length = 289
Score = 582 bits (1499), Expect = e-165
Identities = 289/289 (100%), Positives = 289/289 (100%)
Frame = +1
Query: 1 MEKLKEGGRQITAGGSAGLVEVCLMYPLDVVKTRLQLGQQDKGMMDCVVKTLKNEGIGGF 180
MEKLKEGGRQITAGGSAGLVEVCLMYPLDVVKTRLQLGQQDKGMMDCVVKTLKNEGIGGF
Sbjct: 1 MEKLKEGGRQITAGGSAGLVEVCLMYPLDVVKTRLQLGQQDKGMMDCVVKTLKNEGIGGF 60
Query: 181 YKGILPPILAETPKRATKFFTFEQYKIAFTHSEIPLPVTMSFAGLFSGLTEAIVICPFEV 360
YKGILPPILAETPKRATKFFTFEQYKIAFTHSEIPLPVTMSFAGLFSGLTEAIVICPFEV
Sbjct: 61 YKGILPPILAETPKRATKFFTFEQYKIAFTHSEIPLPVTMSFAGLFSGLTEAIVICPFEV 120
Query: 361 VKVRLQADRNSSVKEQRSTASMAREIYRNEGFGTSGLYRGLGATLGRHGAWNMVYFGLYH 540
VKVRLQADRNSSVKEQRSTASMAREIYRNEGFGTSGLYRGLGATLGRHGAWNMVYFGLYH
Sbjct: 121 VKVRLQADRNSSVKEQRSTASMAREIYRNEGFGTSGLYRGLGATLGRHGAWNMVYFGLYH 180
Query: 541 SCREVIPDAKQNPTSNLIGRIALGFTAGSLASIFNIPFDVAKSRIQGPQPDPFTRKYSGT 720
SCREVIPDAKQNPTSNLIGRIALGFTAGSLASIFNIPFDVAKSRIQGPQPDPFTRKYSGT
Sbjct: 181 SCREVIPDAKQNPTSNLIGRIALGFTAGSLASIFNIPFDVAKSRIQGPQPDPFTRKYSGT 240
Query: 721 MQTISLVYKEEGFGALYKGLLPKVMRLGPGGAVMLIVYDEVYSWLQKNT 867
MQTISLVYKEEGFGALYKGLLPKVMRLGPGGAVMLIVYDEVYSWLQKNT
Sbjct: 241 MQTISLVYKEEGFGALYKGLLPKVMRLGPGGAVMLIVYDEVYSWLQKNT 289