Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R12E2_12
(1089 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508685|ref|NP_491319.1| proteasome Regulatory Particle, Non... 641 0.0
gi|39586329|emb|CAE66740.1| Hypothetical protein CBG12090 [Caeno... 622 e-177
gi|34851726|ref|XP_226439.2| similar to 26S proteasome non-ATPas... 387 e-106
gi|33875323|gb|AAH00338.1| PSMD7 protein [Homo sapiens] 385 e-106
gi|25777615|ref|NP_002802.2| proteasome 26S non-ATPase subunit 7... 385 e-106
gi|2134660|pir||S65491 26S proteasome regulatory chain 12 - huma... 385 e-106
gi|6754724|ref|NP_034947.1| proteasome (prosome, macropain) 26S ... 384 e-105
gi|26326937|dbj|BAC27212.1| unnamed protein product [Mus musculus] 384 e-105
gi|50417591|gb|AAH77668.1| Unknown (protein for IMAGE:7027546) [... 383 e-105
gi|41054245|ref|NP_956083.1| proteasome (prosome, macropain) 26S... 382 e-104
gi|24762618|ref|NP_523845.2| CG3416-PA [Drosophila melanogaster]... 381 e-104
gi|47219752|emb|CAG03379.1| unnamed protein product [Tetraodon n... 380 e-104
gi|1085272|pir||JC4154 26S proteasome regulatory chain, p40 - hu... 378 e-103
gi|31239957|ref|XP_320392.1| ENSANGP00000013949 [Anopheles gambi... 376 e-103
gi|50754041|ref|XP_414229.1| PREDICTED: similar to 26S proteasom... 366 e-100
gi|48097859|ref|XP_391960.1| similar to ENSANGP00000013949 [Apis... 352 1e-95
gi|1709802|sp|P26270|PSD7_DROME 26S proteasome non-ATPase regula... 336 6e-91
gi|29841006|gb|AAP06019.1| similar to NM_010817 26S proteasome r... 305 9e-82
gi|46138447|ref|XP_390914.1| hypothetical protein FG10738.1 [Gib... 296 4e-79
gi|49068894|ref|XP_398736.1| hypothetical protein UM01121.1 [Ust... 296 4e-79
gi|2599117|gb|AAB84057.1| proteasome regulatory subunit 12 [Hypo... 295 1e-78
gi|15239230|ref|NP_196197.1| 26S proteasome non-ATPase regulator... 291 1e-77
gi|38102580|gb|EAA49401.1| hypothetical protein MG01059.4 [Magna... 291 2e-77
gi|32415013|ref|XP_327986.1| hypothetical protein ( (AF028783) p... 291 2e-77
gi|15229710|ref|NP_187736.1| 26S proteasome non-ATPase regulator... 291 2e-77
gi|17297979|dbj|BAB78487.1| 26S proteasome regulatory particle n... 290 4e-77
gi|50551151|ref|XP_503049.1| hypothetical protein [Yarrowia lipo... 285 1e-75
gi|19075303|ref|NP_587803.1| 26S proteasome regulatory subunit 1... 275 1e-72
gi|50425129|ref|XP_461156.1| unnamed protein product [Debaryomyc... 269 1e-70
gi|45269968|gb|AAS56365.1| YOR261C [Saccharomyces cerevisiae] 266 6e-70
gi|6324835|ref|NP_014904.1| Essential, non-ATPase regulatory sub... 265 2e-69
gi|46436167|gb|EAK95534.1| hypothetical protein CaO19.3168 [Cand... 261 3e-68
gi|46436306|gb|EAK95670.1| hypothetical protein CaO19.10677 [Can... 261 3e-68
gi|50292347|ref|XP_448606.1| unnamed protein product [Candida gl... 260 3e-68
gi|49095594|ref|XP_409258.1| hypothetical protein AN5121.2 [Aspe... 259 1e-67
gi|45184708|ref|NP_982426.1| AAL116Wp [Eremothecium gossypii] >g... 256 8e-67
gi|50305325|ref|XP_452622.1| unnamed protein product [Kluyveromy... 251 3e-65
gi|50260734|gb|EAL23384.1| hypothetical protein CNBA0350 [Crypto... 246 5e-64
gi|46229483|gb|EAK90301.1| 26S proteasome regulatory subunit, in... 215 1e-54
gi|23613648|ref|NP_704669.1| 26S proteasome regulatory subunit, ... 209 7e-53
gi|23480463|gb|EAA17015.1| probable 26s proteasome regulatory su... 209 9e-53
gi|18463059|gb|AAL72631.1| proteasome regulatory non-ATP-ase sub... 189 7e-47
gi|19074119|ref|NP_584725.1| 26S PROTEASOME REGULATORY SUBUNIT 1... 160 5e-38
gi|38346065|emb|CAE04833.2| OSJNBa0084K01.5 [Oryza sativa (japon... 134 3e-30
gi|23491498|gb|EAA23016.1| Mov34/MPN/PAD-1 family, putative [Pla... 122 1e-26
gi|29731731|ref|XP_290345.1| similar to eukaryotic translation i... 110 7e-23
gi|30584931|gb|AAP36731.1| Homo sapiens eukaryotic translation i... 107 4e-22
gi|21754858|dbj|BAC04577.1| unnamed protein product [Homo sapiens] 107 4e-22
gi|4503519|ref|NP_003745.1| eukaryotic translation initiation fa... 107 4e-22
gi|34858904|ref|XP_215037.2| similar to eukaryotic translation i... 107 6e-22
gi|50749406|ref|XP_421624.1| PREDICTED: similar to eukaryotic tr... 107 6e-22
gi|26353564|dbj|BAC40412.1| unnamed protein product [Mus musculus] 105 2e-21
gi|21313620|ref|NP_079620.1| eukaryotic translation initiation f... 104 3e-21
gi|47213008|emb|CAF95400.1| unnamed protein product [Tetraodon n... 104 4e-21
gi|15225611|ref|NP_181528.1| eukaryotic translation initiation f... 103 7e-21
gi|17064960|gb|AAL32634.1| 26S proteasome regulatory subunit [Ar... 103 7e-21
gi|47682703|gb|AAH70473.1| Eukaryotic translation initiation fac... 100 5e-20
gi|13994333|ref|NP_114149.1| IFP38 [Homo sapiens] >gnl|BL_ORD_ID... 93 1e-17
gi|48097062|ref|XP_393678.1| similar to COP9 signalosome subunit... 90 8e-17
gi|24644059|ref|NP_649489.1| CG9769-PA [Drosophila melanogaster]... 90 8e-17
gi|46359906|gb|AAS88838.1| putative 26S proteasome regulatory su... 87 5e-16
gi|19113090|ref|NP_596298.1| putative 26s proteasome regulatory ... 86 2e-15
gi|47226158|emb|CAG08305.1| unnamed protein product [Tetraodon n... 83 1e-14
gi|49067000|ref|XP_397790.1| hypothetical protein UM00175.1 [Ust... 82 2e-14
gi|31206031|ref|XP_311967.1| ENSANGP00000011020 [Anopheles gambi... 82 3e-14
gi|48126476|ref|XP_396596.1| similar to ENSANGP00000011020 [Apis... 80 1e-13
gi|18056665|gb|AAL58106.1| CSN complex subunit 6A [Arabidopsis t... 80 1e-13
gi|18423847|ref|NP_568839.1| COP9 signalosome subunit 6 / CSN su... 80 1e-13
gi|18416749|ref|NP_567746.1| COP9 signalosome subunit 6 / CSN su... 80 1e-13
gi|31223431|ref|XP_317307.1| ENSANGP00000006844 [Anopheles gambi... 79 2e-13
gi|45550366|ref|NP_610210.2| CG8335-PA [Drosophila melanogaster]... 78 4e-13
gi|49522428|gb|AAH75460.1| Unknown (protein for MGC:89257) [Xeno... 77 5e-13
gi|46249850|gb|AAH68673.1| MGC81070 protein [Xenopus laevis] 76 1e-12
gi|33563284|ref|NP_036132.1| COP9 signalosome subunit 6; COP9 (c... 76 2e-12
gi|2360945|gb|AAD03469.1| 34 kDa Mov34 homolog [Homo sapiens] 75 2e-12
gi|34147637|ref|NP_006824.2| COP9 signalosome subunit 6; COP9 su... 75 2e-12
gi|17940314|gb|AAL49561.1| COP9 signalosome subunit 6 [Arabidops... 75 2e-12
gi|42407349|dbj|BAD08810.1| putative COP9 complex subunit 6 [Ory... 75 3e-12
gi|27663420|ref|XP_222002.1| similar to COP9 complex subunit 6 [... 74 6e-12
gi|17738125|ref|NP_524451.1| CG6932-PA [Drosophila melanogaster]... 74 8e-12
gi|38099534|gb|EAA46867.1| hypothetical protein MG10653.4 [Magna... 70 1e-10
gi|50257625|gb|EAL20330.1| hypothetical protein CNBF1410 [Crypto... 66 1e-09
gi|29248592|gb|EAA40122.1| GLP_80_30499_29639 [Giardia lamblia A... 66 2e-09
gi|50257519|gb|EAL20224.1| hypothetical protein CNBF0360 [Crypto... 65 4e-09
gi|9758401|dbj|BAB08872.1| transcription factor-like; similar to... 61 4e-08
gi|50554065|ref|XP_504441.1| hypothetical protein [Yarrowia lipo... 61 5e-08
gi|7486780|pir||T05061 hypothetical protein M3E9.140 - Arabidops... 60 7e-08
gi|16225442|gb|AAL15890.1| 26S proteasome regulatory subunit S12... 60 9e-08
gi|49067938|ref|XP_398258.1| hypothetical protein UM00643.1 [Ust... 58 3e-07
gi|23490332|gb|EAA22136.1| no apparent S. cerevisiae ortholog, p... 56 1e-06
gi|23613701|ref|NP_704722.1| hypothetical protein, conserved [Pl... 55 4e-06
gi|46229762|gb|EAK90580.1| eIF3-p47 with JAB/PAD domain [Cryptos... 54 6e-06
gi|13812358|ref|NP_113476.1| 26S proteasome regulatory SU [Guill... 54 8e-06
gi|19347926|gb|AAL85984.1| unknown protein [Arabidopsis thaliana] 52 2e-05
gi|28393281|gb|AAO42068.1| putative COP9 complex subunit 6 CSN6 ... 50 7e-05
gi|23490958|gb|EAA22608.1| Mov34/MPN/PAD-1 family, putative [Pla... 50 1e-04
gi|17532683|ref|NP_495988.1| eukaryotic Initiation Factor (32.9 ... 49 2e-04
gi|46107796|ref|XP_380957.1| conserved hypothetical protein [Gib... 49 2e-04
gi|49069734|ref|XP_399156.1| hypothetical protein UM01541.1 [Ust... 48 3e-04
gi|23619601|ref|NP_705563.1| proteasome regulatory subunit, puta... 48 3e-04
gi|49094336|ref|XP_408629.1| conserved hypothetical protein [Asp... 47 6e-04
gi|19114926|ref|NP_594014.1| pad1 protein; 26S proteasome subuni... 47 0.001
gi|18463065|gb|AAL72634.1| proteasome regulatory non-ATP-ase sub... 47 0.001
gi|38106424|gb|EAA52730.1| hypothetical protein MG05858.4 [Magna... 45 0.002
gi|34395065|dbj|BAC84727.1| putative 26S proteasome non-ATPase r... 45 0.003
gi|39587687|emb|CAE58625.1| Hypothetical protein CBG01793 [Caeno... 45 0.003
gi|32398904|emb|CAD98369.1| Mov34/MPN/PAD-1 family proteasome re... 45 0.003
gi|34903124|ref|NP_912909.1| unnamed protein product [Oryza sati... 45 0.004
gi|17553290|ref|NP_498470.1| proteasome regulatory (3H799) [Caen... 44 0.005
gi|50260903|gb|EAL23553.1| hypothetical protein CNBA2000 [Crypto... 44 0.005
gi|19074857|ref|NP_586363.1| PROTEASOME REGULATORY SUBUNIT 11 (R... 44 0.007
gi|11281515|pir||T44427 hypothetical protein - fission yeast (Sc... 44 0.007
gi|39594009|emb|CAE70119.1| Hypothetical protein CBG16572 [Caeno... 44 0.009
gi|13812378|ref|NP_113496.1| 26S proteasome regulatory subunit [... 43 0.011
gi|32409045|ref|XP_325003.1| hypothetical protein [Neurospora cr... 43 0.011
gi|17543986|ref|NP_502557.1| constitutive photomorphogenic COP9 ... 42 0.019
gi|39579429|emb|CAE56296.1| Hypothetical protein CBG23950 [Caeno... 42 0.025
gi|2104757|gb|AAB57823.1| sks1 multidrug resistance protein homo... 42 0.025
gi|28829583|gb|AAO52100.1| similar to Dictyostelium discoideum (... 42 0.025
gi|17535703|ref|NP_494712.1| proteasome Regulatory Particle, Non... 42 0.025
gi|14041710|emb|CAC38781.1| putative multidrug resistance protei... 42 0.033
gi|19920728|ref|NP_608905.1| CG18174-PA [Drosophila melanogaster... 42 0.033
gi|14034117|emb|CAC38736.1| potential multidrug resistance prote... 42 0.033
gi|31211487|ref|XP_314713.1| ENSANGP00000013055 [Anopheles gambi... 42 0.033
gi|21592398|gb|AAM64349.1| 26S proteasome non-ATPase regulatory ... 41 0.043
gi|15237785|ref|NP_197745.1| 26S proteasome regulatory subunit, ... 41 0.043
gi|48141588|ref|XP_393559.1| similar to ENSANGP00000013055 [Apis... 41 0.043
gi|34854852|ref|XP_215745.2| similar to 26S proteasome-associate... 41 0.043
gi|46136165|ref|XP_389774.1| hypothetical protein FG09598.1 [Gib... 41 0.043
gi|50425673|ref|XP_461433.1| unnamed protein product [Debaryomyc... 41 0.043
gi|10946952|ref|NP_067501.1| proteasome (prosome, macropain) 26S... 41 0.043
gi|12848428|dbj|BAB27949.1| unnamed protein product [Mus musculus] 41 0.043
gi|50750529|ref|XP_422035.1| PREDICTED: similar to Psmd14-prov p... 41 0.043
gi|5031981|ref|NP_005796.1| 26S proteasome-associated pad1 homol... 41 0.043
gi|14041178|emb|CAC38755.1| putative multidrug resistance protei... 41 0.043
gi|46436667|gb|EAK96026.1| hypothetical protein CaO19.7264 [Cand... 41 0.043
gi|2345100|gb|AAC02298.1| Pad1 homolog [Schistosoma mansoni] 41 0.056
gi|50309165|ref|XP_454588.1| unnamed protein product [Kluyveromy... 41 0.056
gi|45201101|ref|NP_986671.1| AGR006Wp [Eremothecium gossypii] >g... 40 0.073
gi|46442466|gb|EAL01755.1| hypothetical protein CaO19.4283 [Cand... 40 0.073
gi|26280369|gb|AAN77865.1| 26S proteasome regulatory subunit [Sa... 40 0.095
gi|14318526|ref|NP_116659.1| Metalloprotease subunit of the 19S ... 40 0.095
gi|50556996|ref|XP_505906.1| hypothetical protein [Yarrowia lipo... 40 0.095
gi|4732109|gb|AAD28608.1| COP9 signalosome subunit 5 CSN5 [Droso... 40 0.095
gi|31206161|ref|XP_312032.1| ENSANGP00000018752 [Anopheles gambi... 40 0.095
gi|38048687|gb|AAR10246.1| similar to Drosophila melanogaster CS... 40 0.12
gi|50293523|ref|XP_449173.1| unnamed protein product [Candida gl... 40 0.12
gi|28317149|gb|AAD27862.2| LD14392p [Drosophila melanogaster] 40 0.12
gi|17137694|ref|NP_477442.1| CG14884-PA [Drosophila melanogaster... 40 0.12
gi|49074486|ref|XP_401374.1| hypothetical protein UM03759.1 [Ust... 39 0.21
gi|38109993|gb|EAA55781.1| hypothetical protein MG01432.4 [Magna... 38 0.47
gi|47225576|emb|CAG12059.1| unnamed protein product [Tetraodon n... 37 1.0
gi|45360867|ref|NP_989109.1| COP9 signalosome subunit 5 [Xenopus... 37 1.0
gi|49258066|gb|AAH74434.1| Unknown (protein for MGC:84682) [Xeno... 37 1.0
gi|47213973|emb|CAG00664.1| unnamed protein product [Tetraodon n... 36 1.4
gi|2360943|gb|AAD03468.1| 38 kDa Mov34 homolog [Homo sapiens] 36 1.4
gi|7304971|ref|NP_038743.1| COP9 signalosome subunit 5; Jun coac... 36 1.4
gi|38027923|ref|NP_006828.2| COP9 signalosome subunit 5; Jun act... 36 1.4
gi|29250286|gb|EAA41782.1| GLP_111_4773_5777 [Giardia lamblia AT... 36 1.4
gi|34866044|ref|XP_232615.2| similar to COP9 (constitutive photo... 36 1.4
gi|30585175|gb|AAP36860.1| Homo sapiens COP9 constitutive photom... 36 1.4
gi|9367753|emb|CAB97491.1| non ATPase subunit MPR1 of 26S protea... 36 1.4
gi|7513098|pir||S71820 JUN-activation-domain-binding protein 1 -... 36 1.8
gi|41152279|ref|NP_957019.1| hypothetical protein MGC73130 [Dani... 36 1.8
gi|21593104|gb|AAM65053.1| putative JUN kinase activator protein... 35 3.0
gi|15219970|ref|NP_173705.1| COP9 signalosome subunit 5B / CSN s... 35 3.0
gi|25349983|pir||T52180 constitutive photomorphogenic 9 complex ... 35 3.0
gi|42571599|ref|NP_973890.1| COP9 signalosome subunit 5B / CSN s... 35 3.0
gi|23479677|gb|EAA16439.1| hypothetical protein [Plasmodium yoel... 35 4.0
gi|15224003|ref|NP_177279.1| COP9 signalosome subunit 5A / CSN s... 34 5.2
gi|25349981|pir||T52042 constitutive photomorphogenic 9 complex ... 34 5.2
gi|17538322|ref|NP_500841.1| constitutive photomorphogenic COP9 ... 34 5.2
gi|15207967|dbj|BAB63008.1| hypothetical protein [Macaca fascicu... 34 5.2
gi|21672364|ref|NP_660431.1| flagellar hook-length control prote... 34 5.2
gi|22549483|ref|NP_689256.1| putative P87/VP80-like structural p... 34 6.8
gi|15242144|ref|NP_199980.1| expressed protein [Arabidopsis thal... 34 6.8
gi|19114043|ref|NP_593131.1| COP9/signalosome complex subunit 5 ... 34 6.8
gi|7488743|pir||T09261 JUN kinase-activation-domain-binding prot... 33 8.9
gi|39591554|emb|CAE71130.1| Hypothetical protein CBG17984 [Caeno... 33 8.9
gi|7489491|pir||T02934 JUN-activation-domain-binding protein hom... 33 8.9
>gi|17508685|ref|NP_491319.1| proteasome Regulatory Particle,
Non-ATPase-like, S12 (40.7 kD) (rpn-8) [Caenorhabditis
elegans]
gi|7506679|pir||T33096 hypothetical protein R12E2.3 - Caenorhabditis
elegans
gi|3150515|gb|AAC17024.1| Proteasome regulatory particle,
non-atpase-like protein 8 [Caenorhabditis elegans]
Length = 362
Score = 641 bits (1653), Expect = 0.0
Identities = 323/362 (89%), Positives = 323/362 (89%)
Frame = +1
Query: 1 MAPTNKDGDVATVKAVDVLKQKAGAHHCLGNVHANLPVNKVTVHPLVLLSVVDHFNRVSK 180
MAPTNKDGDVATVKAVDVLKQKAGAHHCLGNVHANLPVNKVTVHPLVLLSVVDHFNRVSK
Sbjct: 1 MAPTNKDGDVATVKAVDVLKQKAGAHHCLGNVHANLPVNKVTVHPLVLLSVVDHFNRVSK 60
Query: 181 TQSVKRVVGVLLGSMKKDKTLDIGNSFAVPFDEDDKDKSTWFLDMDYLESMYGMFYKVAA 360
TQSVKRVVGVLLGSMKKDKTLDIGNSFAVPFDEDDKDKSTWFLDMDYLESMYGMFYKVAA
Sbjct: 61 TQSVKRVVGVLLGSMKKDKTLDIGNSFAVPFDEDDKDKSTWFLDMDYLESMYGMFYKVAA 120
Query: 361 KEKIVGWYHTGPKLHKNDIAINEQLKRFCPNPVLVIIDAEPKNIGLPTEAYIEVQEVHDD 540
KEKIVGWYHTGPKLHKNDIAINEQLKRFCPNPVLVIIDAEPKNIGLPTEAYIEVQEVHDD
Sbjct: 121 KEKIVGWYHTGPKLHKNDIAINEQLKRFCPNPVLVIIDAEPKNIGLPTEAYIEVQEVHDD 180
Query: 541 GTPPIKTFEHVPSDIXXXXXXXXXXXHLLRDIKDQTAGTLSQRITDQLMGLRGLQSQLES 720
GTPPIKTFEHVPSDI HLLRDIKDQTAGTLSQRITDQLMGLRGLQSQLES
Sbjct: 181 GTPPIKTFEHVPSDIGAEEAEEVGVEHLLRDIKDQTAGTLSQRITDQLMGLRGLQSQLES 240
Query: 721 IEKYLHDIVRGTLPVNHHVIYYVQEVLNLLPDVTHPDYIVSQNVQTNDQLMCVYMGSLVR 900
IEKYLHDIVRGTLPVNHHVIYYVQEVLNLLPDVTHPDYIVSQNVQTNDQLMCVYMGSLVR
Sbjct: 241 IEKYLHDIVRGTLPVNHHVIYYVQEVLNLLPDVTHPDYIVSQNVQTNDQLMCVYMGSLVR 300
Query: 901 SVVALHNLIDNKISLQKAEKEQETGEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPNTP 1080
SVVALHNLIDNKISLQKAEKEQETGEA TPNTP
Sbjct: 301 SVVALHNLIDNKISLQKAEKEQETGEAEKKKDEKDKKDKKDEKKDEKKEKDSKSSTPNTP 360
Query: 1081 KK 1086
KK
Sbjct: 361 KK 362