Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= T01B7_7
         (1047 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ...   296   5e-79
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno...   294   2e-78
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...   168   2e-40
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...   168   2e-40
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...   100   7e-20
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    99   1e-19
gi|687634|gb|AAA62504.1| collagen                                      89   2e-16
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    87   5e-16
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno...    83   9e-15
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             79   1e-13
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    78   4e-13
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno...    78   4e-13
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    77   9e-13
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [...    77   9e-13
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    75   2e-12
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  74   4e-12
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    71   5e-11
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    70   8e-11
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 68   3e-10
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno...    68   3e-10
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    67   5e-10
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s...    67   5e-10
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi...    67   5e-10
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    65   2e-09
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    64   4e-09
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    63   1e-08
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [...    62   2e-08
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    62   2e-08
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    62   2e-08
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|...    62   3e-08
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    61   4e-08
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,...    61   4e-08
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    61   5e-08
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    60   6e-08
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    59   1e-07
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno...    59   2e-07
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno...    58   3e-07
gi|1513206|gb|AAC48704.1| involucrin                                   58   4e-07
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    58   4e-07
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    57   5e-07
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR...    57   5e-07
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis...    57   7e-07
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    57   9e-07
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib...    57   9e-07
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (...    56   1e-06
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD...    56   1e-06
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    56   1e-06
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    56   2e-06
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    56   2e-06
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [...    55   2e-06
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697...    55   2e-06
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    55   3e-06
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ...    55   3e-06
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    54   6e-06
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    54   6e-06
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ...    54   6e-06
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    54   8e-06
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ...    54   8e-06
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    54   8e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    53   1e-05
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ...    53   1e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    53   1e-05
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det...    52   2e-05
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    52   2e-05
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    52   2e-05
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib...    52   2e-05
gi|1513204|gb|AAC48703.1| involucrin                                   51   4e-05
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi...    51   4e-05
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa...    51   5e-05
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    51   5e-05
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal...    51   5e-05
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    51   5e-05
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    51   5e-05
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa...    50   7e-05
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    50   7e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    50   7e-05
gi|13539605|emb|CAC35733.1| cyclophilin-RNA interacting protein ...    50   9e-05
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    50   1e-04
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n...    50   1e-04
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485...    50   1e-04
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g...    49   1e-04
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ...    49   2e-04
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    49   2e-04
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165...    49   3e-04
gi|47085799|ref|NP_998238.1| zgc:55839 [Danio rerio] >gnl|BL_ORD...    49   3e-04
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f...    49   3e-04
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    49   3e-04
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor...    48   3e-04
gi|50744526|ref|XP_419763.1| PREDICTED: similar to chromosome 6 ...    48   3e-04
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ...    48   3e-04
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR...    48   3e-04
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp...    48   3e-04
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi...    48   3e-04
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster...    48   3e-04
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [...    48   3e-04
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp...    48   3e-04
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain                    48   3e-04
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    48   3e-04
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa...    48   3e-04
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (...    48   4e-04
gi|50752502|ref|XP_422807.1| PREDICTED: similar to golgi phospho...    48   4e-04
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens]     48   4e-04
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno...    48   4e-04
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit...    47   6e-04
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu...    47   6e-04
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat...    47   7e-04
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina]                    47   7e-04
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043...    47   7e-04
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi...    47   7e-04
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    47   7e-04
gi|42660655|ref|XP_370881.2| similar to FLJ40113 protein [Homo s...    47   7e-04
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi...    47   7e-04
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch...    47   7e-04
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    47   0.001
gi|9910376|ref|NP_064623.1| inner centromere protein antigens 13...    47   0.001
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat...    47   0.001
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand...    47   0.001
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    47   0.001
gi|11493973|gb|AAG35726.1| lipase precursor GehM [Staphylococcus...    47   0.001
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    46   0.001
gi|49117079|gb|AAH73018.1| Unknown (protein for IMAGE:5048167) [...    46   0.001
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl...    46   0.001
gi|23486300|gb|EAA20765.1| hypothetical protein [Plasmodium yoel...    46   0.001
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P...    46   0.001
gi|46437473|gb|EAK96819.1| hypothetical protein CaO19.10369 [Can...    46   0.001
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis]          46   0.001
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur...    46   0.002
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w...    46   0.002
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    46   0.002
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    46   0.002
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy...    46   0.002
gi|32413022|ref|XP_326991.1| hypothetical protein [Neurospora cr...    46   0.002
gi|28949944|emb|CAD70930.1| related to wound-responsive protein ...    46   0.002
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra...    46   0.002
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d...    46   0.002
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass...    45   0.002
gi|50414818|gb|AAH77321.1| Unknown (protein for MGC:80275) [Xeno...    45   0.002
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    45   0.002
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot...    45   0.002
gi|32141042|gb|AAP70486.1| histidine-rich calcium binding protei...    45   0.002
gi|50294870|ref|XP_449846.1| unnamed protein product [Candida gl...    45   0.002
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563...    45   0.002
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate...    45   0.002
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    45   0.002
gi|38564427|ref|NP_942576.1| wu:fi16e01; ORFNames=zgc:66479 [Dan...    45   0.003
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa...    45   0.003
gi|50419151|ref|XP_458098.1| unnamed protein product [Debaryomyc...    45   0.003
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr...    45   0.003
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    45   0.003
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal...    45   0.003
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro...    45   0.003
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa...    45   0.003
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel...    45   0.003
gi|50765787|ref|XP_422977.1| PREDICTED: similar to M-phase phosp...    45   0.004
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet...    45   0.004
gi|24645053|ref|NP_649795.1| CG7352-PA [Drosophila melanogaster]...    45   0.004
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738...    45   0.004
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret...    45   0.004
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba...    44   0.005
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    44   0.005
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno...    44   0.005
gi|31982906|ref|NP_116255.2| hypothetical protein FLJ14957 [Homo...    44   0.005
gi|31202189|ref|XP_310043.1| ENSANGP00000015192 [Anopheles gambi...    44   0.005
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm...    44   0.005
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi...    44   0.005
gi|27467827|ref|NP_764464.1| chromosome segregation SMC protein ...    44   0.005
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (...    44   0.005
gi|41054021|ref|NP_956195.1| myomegalin; wu:fi74c05 [Danio rerio...    44   0.005
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            44   0.005
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ...    44   0.005
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut...    44   0.005
gi|382658|prf||1819485A CENP-E protein                                 44   0.005
gi|4140323|emb|CAA20350.1| dJ283E3.3.3 (variant beta 2-1) [Homo ...    44   0.006
gi|39594956|emb|CAE70824.1| Hypothetical protein CBG17595 [Caeno...    44   0.006
gi|39597929|emb|CAE68621.1| Hypothetical protein CBG14505 [Caeno...    44   0.006
gi|17507217|ref|NP_492424.1| retinoblastoma binding protein 6 li...    44   0.006
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl...    44   0.006
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628...    44   0.006
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ...    44   0.006
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl...    44   0.006
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus]     44   0.006
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd...    44   0.006
gi|40786396|ref|NP_955370.1| FLJ35171 protein [Homo sapiens] >gn...    44   0.006
gi|47214667|emb|CAG00903.1| unnamed protein product [Tetraodon n...    44   0.008
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo...    44   0.008
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw...    44   0.008
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n...    44   0.008
gi|23508159|ref|NP_700829.1| liver stage antigen, putative [Plas...    44   0.008
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster...    44   0.008
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto...    44   0.008
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533...    44   0.008
gi|25518567|pir||E86336 hypothetical protein F14O10.11 - Arabido...    44   0.008
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr...    44   0.008
gi|4505983|ref|NP_003617.1| PTPRF interacting protein alpha 1 is...    44   0.008
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster]          44   0.008
gi|23612928|ref|NP_704467.1| erythrocyte membrane protein 1 (PfE...    44   0.008
gi|1362851|pir||S55553 LAR-interacting protein LIP1b - human           44   0.008
gi|29171753|ref|NP_803172.1| PTPRF interacting protein alpha 1 i...    44   0.008
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can...    43   0.011
gi|47230384|emb|CAF99577.1| unnamed protein product [Tetraodon n...    43   0.011
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil...    43   0.011
gi|12698147|dbj|BAB21900.1| hypothetical protein [Macaca fascicu...    43   0.011
gi|28571201|ref|NP_788907.1| CG33206-PA [Drosophila melanogaster...    43   0.011
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093...    43   0.011
gi|28571203|ref|NP_788908.1| CG33206-PB [Drosophila melanogaster...    43   0.011
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens]            43   0.011
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre...    43   0.011
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR...    43   0.014
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ...    43   0.014
gi|23478233|gb|EAA15375.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [...    43   0.014
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644...    43   0.014
gi|3789905|gb|AAC67538.1| developmental protein DG1071 [Dictyost...    43   0.014
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can...    43   0.014
gi|85437|pir||PN0009 neurofilament triplet M protein - Pacific e...    43   0.014
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    43   0.014
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    43   0.014
gi|47216948|emb|CAG04890.1| unnamed protein product [Tetraodon n...    43   0.014
gi|47211793|emb|CAF93707.1| unnamed protein product [Tetraodon n...    43   0.014
gi|21956190|gb|AAM83255.1| ARC105 [Xenopus laevis]                     43   0.014
gi|47211795|emb|CAF93709.1| unnamed protein product [Tetraodon n...    43   0.014
gi|38016133|ref|NP_932345.1| FLJ40113 protein [Homo sapiens] >gn...    43   0.014
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    43   0.014
gi|7657138|ref|NP_055313.1| golgi phosphoprotein 4; type II Golg...    42   0.018
gi|23479053|gb|EAA15986.1| mature-parasite-infected erythrocyte ...    42   0.018
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            42   0.018
gi|14042847|dbj|BAB55415.1| unnamed protein product [Homo sapiens]     42   0.018
gi|29245456|gb|EAA37093.1| GLP_227_3888_5990 [Giardia lamblia AT...    42   0.018
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    42   0.018
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor...    42   0.018
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s...    42   0.018
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl...    42   0.018
gi|50555293|ref|XP_505055.1| hypothetical protein [Yarrowia lipo...    42   0.018
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.]                        42   0.018
gi|32469853|ref|NP_863325.1| unknown [Campylobacter jejuni] >gnl...    42   0.018
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera]    42   0.018
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I...    42   0.018
gi|31210519|ref|XP_314226.1| ENSANGP00000014464 [Anopheles gambi...    42   0.018
gi|20138462|sp|Q9WVE9|ITN1_RAT Intersectin 1 (EH domain and SH3 ...    42   0.023
gi|47212768|emb|CAF95225.1| unnamed protein product [Tetraodon n...    42   0.023
gi|50750157|ref|XP_421895.1| PREDICTED: similar to Disco-interac...    42   0.023
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo...    42   0.023
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    42   0.023
gi|4838526|gb|AAD31026.1| EH-domain/SH3-domain containing protei...    42   0.023
gi|41054766|ref|NP_956894.1| hypothetical protein MGC63522 [Dani...    42   0.023
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot...    42   0.023
gi|47123917|gb|AAH70536.1| ARC105 protein [Xenopus laevis]             42   0.023
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum]           42   0.023
gi|34865346|ref|XP_216723.2| similar to ninein [Rattus norvegicus]     42   0.023
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her...    42   0.023
gi|49080662|ref|XP_403824.1| hypothetical protein UM06209.1 [Ust...    42   0.023
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus]           42   0.023
gi|23307499|dbj|BAC16636.1| hypothetical protein [Gibberella fuj...    42   0.023
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n...    42   0.023
gi|21707845|gb|AAH34046.1| PPFIA1 protein [Homo sapiens]               42   0.023
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand...    42   0.023
gi|31226919|ref|XP_317793.1| ENSANGP00000018103 [Anopheles gambi...    42   0.023
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n...    42   0.023
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ...    42   0.031
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul...    42   0.031
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr...    42   0.031
gi|2351221|dbj|BAA22068.1| myosin heavy chain [Cyprinus carpio]        42   0.031
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan...    42   0.031
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso...    42   0.031
gi|28829829|gb|AAO52331.1| similar to Plasmodium falciparum. Hyp...    42   0.031
gi|806513|dbj|BAA09068.1| myosin heavy chain [Cyprinus carpio]         42   0.031
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe...    42   0.031
gi|1790878|gb|AAB41132.1| microtubule-associated protein 1a [Hom...    42   0.031
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ...    42   0.031
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ...    42   0.031
gi|50730125|ref|XP_416780.1| PREDICTED: similar to retinitis pig...    42   0.031
gi|42734255|emb|CAF31492.1| Hypothetical protein T05A10.1e [Caen...    41   0.040
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl...    41   0.040
gi|4007435|gb|AAC95299.1| PITSLRE protein kinase beta SV1 isofor...    41   0.040
gi|42660685|ref|XP_375272.1| similar to hypothetical protein FLJ...    41   0.040
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa...    41   0.040
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can...    41   0.040
gi|42734257|emb|CAA92133.3| C. elegans SMA-9 protein (correspond...    41   0.040
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    41   0.040
gi|42734252|emb|CAF31489.1| Hypothetical protein T05A10.1i [Caen...    41   0.040
gi|42734256|emb|CAF31493.1| Hypothetical protein T05A10.1f [Caen...    41   0.040
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto...    41   0.040
gi|42734253|emb|CAF31490.1| Hypothetical protein T05A10.1g [Caen...    41   0.040
gi|16332364|ref|NP_277024.1| cell division cycle 2-like 1 (PITSL...    41   0.040
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl...    41   0.040
gi|3978440|gb|AAC83663.1| PITSLRE protein kinase alpha SV5 isofo...    41   0.040
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum]                     41   0.040
gi|16357498|ref|NP_076916.1| cell division cycle 2-like 2 isofor...    41   0.040
gi|42660674|ref|XP_377369.1| similar to hypothetical protein FLJ...    41   0.040
gi|50745035|ref|XP_419954.1| PREDICTED: similar to Rho-associate...    41   0.040
gi|50765313|ref|XP_422967.1| PREDICTED: similar to mitotic kines...    41   0.040
gi|16332362|ref|NP_277023.1| cell division cycle 2-like 1 (PITSL...    41   0.040
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi]             41   0.040
gi|42734251|emb|CAF31488.1| Hypothetical protein T05A10.1j [Caen...    41   0.040
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass...    41   0.040
gi|16332358|ref|NP_277021.1| cell division cycle 2-like 1 (PITSL...    41   0.040
gi|42734254|emb|CAF31491.1| Hypothetical protein T05A10.1d [Caen...    41   0.040
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster...    41   0.040
gi|38074111|ref|XP_355284.1| nasopharyngeal epithelium specific ...    41   0.040
gi|39578575|gb|AAR28681.1| zinc finger transcription factor SMA-...    41   0.040
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida...    41   0.040
gi|33284886|emb|CAE17632.1| SI:bZ1G18.6.4 (novel protein similar...    41   0.040
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa...    41   0.040
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...    41   0.040
gi|34932634|ref|XP_344711.1| similar to ring-infested erythrocyt...    41   0.040
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand...    41   0.040
gi|16332372|ref|NP_277028.1| cell division cycle 2-like 1 (PITSL...    41   0.040
gi|42569025|ref|NP_179030.2| hypothetical protein [Arabidopsis t...    41   0.040
gi|7507124|pir||T24490 hypothetical protein T05A10.1 - Caenorhab...    41   0.040
gi|50307819|ref|XP_453903.1| unnamed protein product [Kluyveromy...    41   0.052
gi|10047287|dbj|BAB13432.1| KIAA1606 protein [Homo sapiens]            41   0.052
gi|47125165|gb|AAH70659.1| LOC431812 protein [Xenopus laevis]          41   0.052
gi|1082285|pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related...    41   0.052
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno...    41   0.052
gi|28574245|ref|NP_724047.2| CG5020-PB [Drosophila melanogaster]...    41   0.052
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus]                   41   0.052
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens]        41   0.052
gi|45552035|ref|NP_788072.2| CG5020-PD [Drosophila melanogaster]...    41   0.052
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand...    41   0.052
gi|3021600|emb|CAA71376.1| nuclear protein SDK2 [Xenopus laevis]       41   0.052
gi|50749502|ref|XP_421665.1| PREDICTED: similar to hypothetical ...    41   0.052
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster...    41   0.052
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant...    41   0.052
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me...    41   0.052
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            41   0.052
gi|24584806|ref|NP_609835.2| CG5020-PA [Drosophila melanogaster]...    41   0.052
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ...    41   0.052
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    41   0.052
gi|30722358|emb|CAD91152.1| hypothetical protein [Homo sapiens]        41   0.052
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD...    41   0.052
gi|15238640|ref|NP_197870.1| expressed protein [Arabidopsis thal...    41   0.052
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno...    41   0.052
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D...    41   0.052
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens]        41   0.052
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster...    41   0.052
gi|24584810|ref|NP_724048.1| CG5020-PC [Drosophila melanogaster]...    41   0.052
gi|49085954|ref|XP_405060.1| hypothetical protein AN0923.2 [Aspe...    41   0.052
gi|50405156|ref|YP_054248.1| Fork head domain protein, putative ...    41   0.052
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu...    41   0.052
gi|15223730|ref|NP_177804.1| expressed protein [Arabidopsis thal...    41   0.052
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster...    41   0.052
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus]     40   0.068
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu...    40   0.068
gi|4007436|gb|AAC95300.1| PITSLRE protein kinase beta SV3 isofor...    40   0.068
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    40   0.068
gi|25150782|ref|NP_741831.1| UNCoordinated locomotion UNC-10, Ra...    40   0.068
gi|7505198|pir||T34318 hypothetical protein K03A1.3 - Caenorhabd...    40   0.068
gi|50540534|ref|NP_001002732.1| zgc:100799 [Danio rerio] >gnl|BL...    40   0.068
gi|50658071|ref|NP_001002811.1| phosphodiesterase 4D interacting...    40   0.068
gi|7512997|pir||T00259 hypothetical protein KIAA0477 - human           40   0.068
gi|21629460|gb|AAM69088.1| Uncoordinated protein 10, isoform b [...    40   0.068
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo...    40   0.068
gi|24660935|ref|NP_648226.2| CG7015-PA [Drosophila melanogaster]...    40   0.068
gi|47550965|ref|NP_999656.1| kinesin-like protein KRP180 [Strong...    40   0.068
gi|13161382|dbj|BAB32977.1| lamin B3 [Carassius auratus]               40   0.068
gi|21732272|emb|CAD38529.1| hypothetical protein [Homo sapiens]        40   0.068
gi|50658069|ref|NP_001002812.1| phosphodiesterase 4D interacting...    40   0.068
gi|16357492|ref|NP_284922.1| cell division cycle 2-like 2 isofor...    40   0.068
gi|507427|gb|AAA19594.1| PITSLRE isoform PBETA21                       40   0.068
gi|20521057|dbj|BAA32299.2| KIAA0454 protein [Homo sapiens]            40   0.068
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr...    40   0.068
gi|30268245|emb|CAD89923.1| hypothetical protein [Homo sapiens]        40   0.068
gi|37360452|dbj|BAC98204.1| mKIAA1565 protein [Mus musculus]           40   0.068
gi|15212037|emb|CAC51118.1| putative bifunctional autolysin [Sta...    40   0.068
gi|28828961|gb|AAO51542.1| similar to Dictyostelium discoideum (...    40   0.068
gi|50400728|sp|Q61043|NIN_MOUSE Ninein                                 40   0.068
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n...    40   0.068
gi|47026413|gb|AAT08469.1| RE66582p [Drosophila melanogaster]          40   0.068
gi|40788275|dbj|BAA32322.2| KIAA0477 protein [Homo sapiens]            40   0.068
gi|6678399|ref|NP_033434.1| topoisomerase (DNA) I [Mus musculus]...    40   0.068
gi|50658073|ref|NP_055459.3| phosphodiesterase 4D interacting pr...    40   0.068
gi|16357484|ref|NP_277071.1| cell division cycle 2-like 2 isofor...    40   0.068
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    40   0.068
gi|42655857|ref|XP_378185.1| hypothetical protein XP_378185 [Hom...    40   0.068
gi|23510226|ref|NP_702892.1| Plasmodium falciparum trophozoite a...    40   0.068
gi|510184|emb|CAA82975.1| liver stage antigen-1 [Plasmodium falc...    40   0.089
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens]     40   0.089
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens]                 40   0.089
gi|507162|gb|AAA19583.1| PITSLRE alpha 2-3                             40   0.089
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans     40   0.089
gi|29747039|ref|XP_049037.7| trinucleotide repeat containing 9 [...    40   0.089
gi|50291189|ref|XP_448027.1| unnamed protein product [Candida gl...    40   0.089
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ...    40   0.089
gi|50405018|ref|YP_054110.1| hypothetical protein with coiled-co...    40   0.089
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis]            40   0.089
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    40   0.089
gi|47218036|emb|CAG11441.1| unnamed protein product [Tetraodon n...    40   0.089
gi|28316334|dbj|BAC56950.1| hair follicle protein AHF [Mus muscu...    40   0.089
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy...    40   0.089
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl...    40   0.089
gi|1082288|pir||F54024 protein kinase (EC 2.7.1.37) cdc2-related...    40   0.089
gi|6746586|gb|AAF27636.1| Sec12 [Pichia pastoris]                      40   0.089
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p...    40   0.089
gi|41393115|ref|NP_958887.1| nucleobindin 2b [Danio rerio] >gnl|...    40   0.089
gi|2565048|gb|AAB91435.1| CAGF9 [Homo sapiens]                         40   0.089
gi|21751403|dbj|BAC03960.1| unnamed protein product [Homo sapiens]     40   0.089
gi|14150056|ref|NP_115676.1| hypothetical protein MGC10854 [Homo...    40   0.089
gi|45501169|gb|AAH67334.1| Nucb2b protein [Danio rerio]                40   0.089
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL...    40   0.089
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr...    40   0.089
gi|39584611|emb|CAE72364.1| Hypothetical protein CBG19514 [Caeno...    40   0.089
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    40   0.089
gi|17543780|ref|NP_502799.1| putative nuclear protein, with 2 co...    40   0.089
gi|507168|gb|AAA19586.1| PITSLRE alpha 2-1                             40   0.089
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ...    40   0.089
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn...    40   0.089
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte...    40   0.089
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot...    40   0.089
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    40   0.089
gi|50742710|ref|XP_419726.1| PREDICTED: similar to Mtap7 protein...    40   0.089
gi|38503303|sp|Q7YR26|TOP1_CERAE DNA topoisomerase I >gnl|BL_ORD...    40   0.089
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt...    40   0.089
gi|37619798|emb|CAA88471.2| Hypothetical protein F54B3.3 [Caenor...    40   0.12
gi|39583246|emb|CAE60038.1| Hypothetical protein CBG03549 [Caeno...    40   0.12
gi|28830303|gb|AAO52657.1| similar to Dictyostelium discoideum (...    40   0.12
gi|17534325|ref|NP_496210.1| TOB3 (2K539) [Caenorhabditis elegan...    40   0.12
gi|9626029|ref|NP_040275.1| ORF 73~ECLF1 [Saimiriine herpesvirus...    40   0.12
gi|228477|prf||1804350B ECLF2 upstream ORF                             40   0.12
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster...    40   0.12
gi|28829349|gb|AAO51891.1| similar to C33G8.2.p [Caenorhabditis ...    40   0.12
gi|39585456|emb|CAE70539.1| Hypothetical protein CBG17177 [Caeno...    40   0.12
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d...    40   0.12
gi|42767031|gb|AAS45545.1| ankyrin repeat-containing cofactor-2 ...    40   0.12
gi|50405252|ref|YP_054344.1| hypothetical protein PTMB.416 [Para...    40   0.12
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m...    40   0.12
gi|50749030|ref|XP_426454.1| PREDICTED: similar to RIKEN cDNA 54...    40   0.12
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [...    40   0.12
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo...    40   0.12
gi|1082283|pir||E54024 protein kinase (EC 2.7.1.37) cdc2-related...    40   0.12
gi|40556372|ref|NP_056023.2| ankyrin repeat domain 12 [Homo sapi...    40   0.12
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi...    40   0.12
gi|39584348|emb|CAE65512.1| Hypothetical protein CBG10486 [Caeno...    40   0.12
gi|11596412|gb|AAG38609.1| GAC-1 [Homo sapiens]                        40   0.12
gi|21686769|ref|NP_663269.1| desmoplakin [Phthorimaea operculell...    40   0.12
gi|32266451|ref|NP_860483.1| conserved hypothetical protein [Hel...    40   0.12
gi|12018294|ref|NP_072137.1| DNA topoisomerase I [Rattus norvegi...    40   0.12
gi|49071338|ref|XP_399958.1| hypothetical protein UM02343.1 [Ust...    40   0.12
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    40   0.12
gi|50782507|ref|XP_423398.1| PREDICTED: similar to cingulin [Gal...    40   0.12
gi|23619471|ref|NP_705433.1| hypothetical protein [Plasmodium fa...    40   0.12
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa...    40   0.12
gi|45384130|ref|NP_990441.1| DNA topoisomerase I [Gallus gallus]...    40   0.12
gi|23508068|ref|NP_700738.1| hypothetical protein [Plasmodium fa...    40   0.12
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa...    40   0.12
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su...    39   0.15
gi|23508431|ref|NP_701100.1| dynein heavy chain, putative [Plasm...    39   0.15
gi|47213412|emb|CAF96072.1| unnamed protein product [Tetraodon n...    39   0.15
gi|47213413|emb|CAF96073.1| unnamed protein product [Tetraodon n...    39   0.15
gi|8698685|gb|AAF78476.1| fast skeletal muscle myosin heavy poly...    39   0.15
gi|34903276|ref|NP_912985.1| unnamed protein product [Oryza sati...    39   0.15
gi|2134385|pir||I50463 protein kinase - chicken >gnl|BL_ORD_ID|1...    39   0.15
gi|4102980|gb|AAD09328.1| virulent strain associated lipoprotein...    39   0.15
gi|15242707|ref|NP_198861.1| expressed protein [Arabidopsis thal...    39   0.15
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa...    39   0.15
gi|18376049|emb|CAD21055.1| hypothetical protein [Neurospora cra...    39   0.15
gi|16903269|gb|AAL30450.1| phosphatidylinositol phosphate kinase...    39   0.15
gi|28829686|gb|AAO52202.1| similar to Dictyostelium discoideum (...    39   0.15
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,...    39   0.15
gi|47216944|emb|CAG04886.1| unnamed protein product [Tetraodon n...    39   0.15
gi|39590777|emb|CAE65150.1| Hypothetical protein CBG10016 [Caeno...    39   0.15
gi|3205211|gb|AAC19403.1| non-muscle myosin heavy chain [Bos tau...    39   0.15
gi|28829086|gb|AAO51650.1| similar to Kaposi's sarcoma-associate...    39   0.15
gi|50555451|ref|XP_505134.1| hypothetical protein [Yarrowia lipo...    39   0.20
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor...    39   0.20
gi|27881642|gb|AAH43703.1| Myh9 protein [Mus musculus]                 39   0.20
gi|47847498|dbj|BAD21421.1| mFLJ00279 protein [Mus musculus]           39   0.20
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B...    39   0.20
gi|24583762|ref|NP_609529.2| CG6686-PB [Drosophila melanogaster]...    39   0.20
gi|6679062|ref|NP_032723.1| ninein [Mus musculus] >gnl|BL_ORD_ID...    39   0.20
gi|29840460|ref|NP_829566.1| hypothetical protein [Chlamydophila...    39   0.20
gi|25150354|ref|NP_508504.2| non-muscle myosin (nmy-1) [Caenorha...    39   0.20
gi|16648923|gb|AAL24313.1| Unknown protein [Arabidopsis thaliana]      39   0.20
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc...    39   0.20
gi|50288085|ref|XP_446471.1| unnamed protein product [Candida gl...    39   0.20
gi|482391|pir||A45555 glutamate rich protein - malaria parasite ...    39   0.20
gi|47077455|dbj|BAD18615.1| unnamed protein product [Homo sapiens]     39   0.20
gi|42761572|gb|AAS45390.1| similar to Babesia bigemina. 200 kDa ...    39   0.20
gi|48823956|ref|ZP_00285407.1| COG3595: Uncharacterized conserve...    39   0.20
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal...    39   0.20
gi|39579995|emb|CAE56311.1| Hypothetical protein CBG23974 [Caeno...    39   0.20
gi|34880946|ref|XP_222907.2| similar to Nasopharyngeal epitheliu...    39   0.20
gi|47223756|emb|CAF98526.1| unnamed protein product [Tetraodon n...    39   0.20
gi|32266205|ref|NP_860237.1| conserved hypothetical protein [Hel...    39   0.20
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa...    39   0.20
gi|20137006|ref|NP_071855.1| myosin heavy chain IX [Mus musculus...    39   0.20
gi|4504487|ref|NP_002143.1| histidine-rich calcium-binding prote...    39   0.20
gi|28277050|gb|AAH44834.1| Myh9 protein [Mus musculus]                 39   0.20
gi|34526505|dbj|BAC85130.1| FLJ00279 protein [Homo sapiens]            39   0.20
gi|13543854|gb|AAH06075.1| Myh9 protein [Mus musculus]                 39   0.20
gi|1083177|pir||A49546 DNA topoisomerase (EC 5.99.1.2) - Chinese...    39   0.20
gi|418112|sp|Q04750|TOP1_MOUSE DNA topoisomerase I >gnl|BL_ORD_I...    39   0.20
gi|586107|sp|Q07050|TOP1_CRIGR DNA topoisomerase I >gnl|BL_ORD_I...    39   0.20
gi|34393510|dbj|BAC83071.1| unknown protein [Oryza sativa (japon...    39   0.20
gi|47227271|emb|CAF96820.1| unnamed protein product [Tetraodon n...    39   0.20
gi|7441404|pir||T16416 hypothetical protein F52B10.1 - Caenorhab...    39   0.20
gi|32039484|ref|ZP_00137756.1| COG0419: ATPase involved in DNA r...    39   0.20
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   39   0.20
gi|28375561|emb|CAD66604.1| SMC protein [Synechococcus sp. PCC 7...    39   0.26
gi|6322762|ref|NP_012835.1| Protein required for cell viability;...    39   0.26
gi|7512342|pir||T08621 centrosome associated protein CEP250 - hu...    39   0.26
gi|32417560|ref|XP_329258.1| predicted protein [Neurospora crass...    39   0.26


>gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals
           roll when moving ROL-6, nematode cuticle collagen,
           N-terminal and Collagen triple helix repeat precursor
           family member (34.8 kD) (rol-6) [Caenorhabditis elegans]
 gi|115409|sp|P20784|CCR6_CAEEL Cuticle collagen rol-6
 gi|102464|pir||A34705 collagen - Caenorhabditis elegans
 gi|156432|gb|AAA28143.1| collagen (rol-6)
 gi|3879235|emb|CAA91300.1| Hypothetical protein T01B7.7
           [Caenorhabditis elegans]
          Length = 348

 Score =  296 bits (758), Expect = 5e-79
 Identities = 150/193 (77%), Positives = 150/193 (77%)
 Frame = +1

Query: 1   MTLTTATSGAIVFSGATLLVSLFAAASLYSQVSNIWNELDAEIANFRSLTEDMWVDMVKL 180
           MTLTTATSGAIVFSGATLLVSLFAAASLYSQVSNIWNELDAEIANFRSLTEDMWVDMVKL
Sbjct: 1   MTLTTATSGAIVFSGATLLVSLFAAASLYSQVSNIWNELDAEIANFRSLTEDMWVDMVKL 60

Query: 181 GAGTASNRVRRQQYGGYGATGVQPPAPTPNPYGGYGASQPAPPEKFPDGIPNGGNQXXXX 360
           GAGTASNRVRRQQYGGYGATGVQPPAPTPNPYGGYGASQPAPPEKFPDGIPNGGNQ
Sbjct: 61  GAGTASNRVRRQQYGGYGATGVQPPAPTPNPYGGYGASQPAPPEKFPDGIPNGGNQPKFP 120

Query: 361 XXXXXXXXXXXXXXXXXXNQCQCTVENSCXXXXXXXXXXXXXXXXXXXXXVPGFDGKDAE 540
                             NQCQCTVENSC                     VPGFDGKDAE
Sbjct: 121 GGGFPDGPFPNGGGPRGGNQCQCTVENSCPPGPAGPEGEEGPDGHDGQDGVPGFDGKDAE 180

Query: 541 DVQNTPPTGCFTC 579
           DVQNTPPTGCFTC
Sbjct: 181 DVQNTPPTGCFTC 193



 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/68 (54%), Positives = 37/68 (54%)
 Frame = +1

Query: 841  TGRDAYPGQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDAEYCKCPGREGDAGRSA 1020
            TGRDAYPGQS                               KDAEYCKCPGREGDAGRSA
Sbjct: 281  TGRDAYPGQSGPQGEPGLQGYGGAAGEDGPEGPPGAPGLPGKDAEYCKCPGREGDAGRSA 340

Query: 1021 RRHRKFQL 1044
            RRHRKFQL
Sbjct: 341  RRHRKFQL 348




[DB home][top]