Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T01C3_7
(435 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563670|ref|NP_506690.1| ribosomal Protein, Small subunit (1... 284 2e-76
gi|39583364|emb|CAE66338.1| Hypothetical protein CBG11589 [Caeno... 282 9e-76
gi|50728374|ref|XP_416113.1| PREDICTED: similar to 40S ribosomal... 226 1e-58
gi|39850096|gb|AAH64030.1| Unknown (protein for IMAGE:6887619) [... 224 2e-58
gi|4506691|ref|NP_001011.1| ribosomal protein S16; 40S ribosomal... 224 2e-58
gi|13124861|gb|AAK11731.1| ribosomal protein S16 [Heteropneustes... 224 4e-58
gi|31227430|ref|XP_317881.1| ENSANGP00000023979 [Anopheles gambi... 223 6e-58
gi|15294045|gb|AAK95199.1| 40S ribosomal protein S16 [Ictalurus ... 223 8e-58
gi|19922746|ref|NP_611685.1| CG4046-PA [Drosophila melanogaster]... 223 8e-58
gi|47218305|emb|CAG04137.1| unnamed protein product [Tetraodon n... 220 4e-57
gi|45934559|gb|AAS79339.1| 40S ribosomal protein S16 [Aedes aegy... 219 9e-57
gi|34851933|ref|XP_344769.1| similar to 40S ribosomal protein S1... 218 3e-56
gi|16566734|gb|AAL26583.1| ribosomal protein S16 [Spodoptera fru... 217 5e-56
gi|24266984|gb|AAN52388.1| ribosomal protein S16 [Branchiostoma ... 216 8e-56
gi|7305445|ref|NP_038675.1| ribosomal protein S16; EST AI317031 ... 216 8e-56
gi|21436589|emb|CAD32467.1| ribosomal protein S16 [Pachymedusa d... 216 8e-56
gi|70920|pir||R3MS16 ribosomal protein S16 - mouse 212 1e-54
gi|34853936|ref|XP_345347.1| similar to 40S ribosomal protein S1... 210 6e-54
gi|1173209|sp|P46293|RS16_GOSHI 40S RIBOSOMAL PROTEIN S16 >gnl|B... 209 1e-53
gi|10720257|sp|O94017|RS16_CANAL 40S ribosomal protein S16 >gnl|... 207 4e-53
gi|6984222|gb|AAF34799.1| 40S ribosomal protein S16 [Euphorbia e... 207 5e-53
gi|37724565|gb|AAO20337.1| ribosomal protein S16 [Hydra vulgaris] 207 5e-53
gi|50289713|ref|XP_447288.1| unnamed protein product [Candida gl... 207 5e-53
gi|27721735|ref|XP_236683.1| similar to 40S ribosomal protein S1... 206 1e-52
gi|15226676|ref|NP_178826.1| 40S ribosomal protein S16 (RPS16A) ... 206 1e-52
gi|49258828|pdb|1S1H|I Chain I, Structure Of The Ribosomal 80s-E... 206 1e-52
gi|6320120|ref|NP_010200.1| Protein component of the small (40S)... 206 1e-52
gi|50546695|ref|XP_500817.1| hypothetical protein [Yarrowia lipo... 206 1e-52
gi|15238809|ref|NP_197339.1| 40S ribosomal protein S16 (RPS16C) ... 205 1e-52
gi|15229252|ref|NP_187073.1| 40S ribosomal protein S16 (RPS16B) ... 205 1e-52
gi|50420593|ref|XP_458833.1| unnamed protein product [Debaryomyc... 205 1e-52
gi|28564990|gb|AAO32578.1| RPS16 [Saccharomyces kluyveri] 204 2e-52
gi|45188131|ref|NP_984354.1| ADR258Wp [Eremothecium gossypii] >g... 203 5e-52
gi|50309865|ref|XP_454946.1| unnamed protein product [Kluyveromy... 203 7e-52
gi|46116588|ref|XP_384312.1| hypothetical protein FG04136.1 [Gib... 202 1e-51
gi|3122800|sp|O22647|RS16_FRIAG 40S ribosomal protein S16 >gnl|B... 201 3e-51
gi|34582396|sp|Q876B4|RS16_SACEX 40S ribosomal protein S16 >gnl|... 201 3e-51
gi|2500428|sp|Q29201|RS16_PIG 40S ribosomal protein S16 200 6e-51
gi|19112530|ref|NP_595738.1| 40s ribosomal protein s16. [Schizos... 199 1e-50
gi|28564081|gb|AAO32419.1| RPS16 [Saccharomyces bayanus] 198 2e-50
gi|34866310|ref|XP_232669.2| similar to 40S ribosomal protein S1... 198 2e-50
gi|28564079|gb|AAO32418.1| RPS16 [Saccharomyces bayanus] 198 2e-50
gi|1172818|sp|P46294|RS16_ORYSA 40S ribosomal protein S16 >gnl|B... 197 4e-50
gi|11276570|pir||T43419 ribosomal protein S16 - fission yeast (S... 197 5e-50
gi|28564868|gb|AAO32518.1| RPS16 [Saccharomyces castellii] 196 8e-50
gi|28564870|gb|AAO32519.1| RPS16 [Saccharomyces castellii] 195 2e-49
gi|32418532|ref|XP_329744.1| hypothetical protein [Neurospora cr... 193 5e-49
gi|28564171|gb|AAO32464.1| RPS16 [Saccharomyces exiguus] 193 7e-49
gi|46227794|gb|EAK88714.1| 40S ribosomal protein S16 [Cryptospor... 189 1e-47
gi|34881035|ref|XP_344180.1| similar to 40S ribosomal protein S1... 188 2e-47
gi|17369864|sp|Q9XEK7|RS16_TORRU 40S ribosomal protein S16 >gnl|... 187 5e-47
gi|23612877|ref|NP_704416.1| 40S ribosomal protein S16, putative... 182 1e-45
gi|41114518|ref|XP_371223.1| similar to 40S ribosomal protein S1... 182 1e-45
gi|50259746|gb|EAL22414.1| hypothetical protein CNBB2930 [Crypto... 182 2e-45
gi|41151130|ref|XP_371151.1| similar to 40S ribosomal protein S1... 181 2e-45
gi|23482813|gb|EAA18686.1| ribosomal protein S9 [Plasmodium yoel... 177 5e-44
gi|38083915|ref|XP_283518.2| similar to 40S ribosomal protein S1... 176 1e-43
gi|27706948|ref|XP_231169.1| similar to 40S ribosomal protein S1... 175 2e-43
gi|40556671|gb|AAR87752.1| small subunit ribosomal protein S16 [... 174 3e-43
gi|133808|sp|P16149|RS16_LUPPO 40S RIBOSOMAL PROTEIN S16 >gnl|BL... 174 4e-43
gi|27732985|ref|XP_214247.1| similar to 40S ribosomal protein S1... 171 3e-42
gi|34878848|ref|XP_226020.2| similar to 40S ribosomal protein S1... 165 2e-40
gi|47937586|gb|AAH72146.1| MGC80065 protein [Xenopus laevis] 162 1e-39
gi|13812089|ref|NP_113194.1| 40S ribosomal protein S16 [Guillard... 160 7e-39
gi|49140242|ref|XP_413605.1| hypothetical protein AN9468.2 [Aspe... 142 1e-33
gi|29250686|gb|EAA42176.1| GLP_480_84573_84097 [Giardia lamblia ... 141 3e-33
gi|38075349|ref|XP_357238.1| similar to 40S ribosomal protein S1... 135 2e-31
gi|16554485|ref|NP_444209.1| 30S ribosomal protein S9 [Halobacte... 129 2e-29
gi|47940482|gb|AAH71674.1| Unknown (protein for MGC:87876) [Homo... 126 1e-28
gi|20069093|gb|AAM09676.1| 40S ribosomal protein S16 [Aplysia ca... 126 1e-28
gi|20094913|ref|NP_614760.1| Ribosomal protein S9 [Methanopyrus ... 124 3e-28
gi|20089486|ref|NP_615561.1| ribosomal protein S9p [Methanosarci... 122 1e-27
gi|21227859|ref|NP_633781.1| SSU ribosomal protein S9P [Methanos... 122 2e-27
gi|48840234|ref|ZP_00297161.1| COG0103: Ribosomal protein S9 [Me... 122 2e-27
gi|19172992|ref|NP_597543.1| 40S RIBOSOMAL PROTEIN S16 [Encephal... 122 2e-27
gi|38106267|gb|EAA52597.1| hypothetical protein MG05289.4 [Magna... 119 2e-26
gi|15678069|ref|NP_275183.1| ribosomal protein S16 (E.coli S9) [... 117 4e-26
gi|41718462|ref|ZP_00147463.1| COG0103: Ribosomal protein S9 [Me... 117 6e-26
gi|134032|sp|P05763|RS9_HALMA 30S ribosomal protein S9P (HmaS9) ... 115 2e-25
gi|49067522|ref|XP_398051.1| hypothetical protein UM00436.1 [Ust... 114 3e-25
gi|18978016|ref|NP_579373.1| SSU ribosomal protein S9P [Pyrococc... 112 2e-24
gi|16081554|ref|NP_393910.1| probable 30S ribosomal protein S9 [... 111 4e-24
gi|45269027|gb|AAS55926.1| 40S ribosomal protein S16 [Sus scrofa] 111 4e-24
gi|14591405|ref|NP_143485.1| 30S ribosomal protein S9 [Pyrococcu... 111 4e-24
gi|14520749|ref|NP_126224.1| SSU ribosomal protein S9P [Pyrococc... 110 5e-24
gi|48852951|ref|ZP_00307133.1| COG0103: Ribosomal protein S9 [Fe... 110 8e-24
gi|224156|prf||1011219A protein HS3 109 1e-23
gi|18312094|ref|NP_558761.1| ribosomal protein S9 [Pyrobaculum a... 108 2e-23
gi|21263974|sp|Q8ZYQ0|RS9_PYRAE 30S ribosomal protein S9P 108 2e-23
gi|11498729|ref|NP_069958.1| SSU ribosomal protein S9P (rps9P) [... 108 2e-23
gi|45358888|ref|NP_988445.1| SSU ribosomal protein S9P [Methanoc... 108 3e-23
gi|31227426|ref|XP_317880.1| ENSANGP00000020023 [Anopheles gambi... 107 7e-23
gi|15668367|ref|NP_247163.1| SSU ribosomal protein S9P (rpsI) [M... 103 6e-22
gi|14601601|ref|NP_148141.1| 30S ribosomal protein S9 [Aeropyrum... 103 7e-22
gi|20141652|sp|Q9YB48|RS9_AERPE 30S ribosomal protein S9P 103 7e-22
gi|13541967|ref|NP_111655.1| 30S ribosomal protein S9 [Thermopla... 102 2e-21
gi|48477396|ref|YP_023102.1| small subunit ribosomal protein S9P... 101 4e-21
gi|15922385|ref|NP_378054.1| 137aa long hypothetical 30S ribosom... 100 6e-21
gi|15897035|ref|NP_341640.1| SSU ribosomal protein S9AB (rps9AB)... 97 7e-20
gi|20141646|sp|P95992|RS9_SULSO 30S ribosomal protein S9P 97 7e-20
gi|25294632|pir||G84269 30S ribosomal protein S9P [imported] - H... 96 2e-19
gi|34494886|dbj|BAC85106.1| unnamed protein product [Homo sapiens] 92 2e-19
gi|28787567|gb|AAO46792.1| ribosomal protein S16 [Leishmania enr... 94 6e-19
gi|730675|sp|P39468|RS9_SULAC 30S ribosomal protein S9P >gnl|BL_... 87 7e-17
gi|41615231|ref|NP_963729.1| NEQ446 [Nanoarchaeum equitans Kin4-... 81 4e-15
gi|46580923|ref|YP_011731.1| ribosomal protein S9 [Desulfovibrio... 77 1e-13
gi|15618170|ref|NP_224455.1| S9 Ribosomal Protein [Chlamydophila... 74 6e-13
gi|23474050|ref|ZP_00129345.1| COG0103: Ribosomal protein S9 [De... 74 8e-13
gi|15835021|ref|NP_296780.1| ribosomal protein S9 [Chlamydia mur... 74 8e-13
gi|46447390|ref|YP_008755.1| probable small subunit ribosomal [P... 74 8e-13
gi|29840292|ref|NP_829398.1| ribosomal protein S9 [Chlamydophila... 71 4e-12
gi|15604845|ref|NP_219629.1| S9 Ribosomal Protein [Chlamydia tra... 70 7e-12
gi|38106268|gb|EAA52598.1| hypothetical protein MG05290.4 [Magna... 70 9e-12
gi|28198657|ref|NP_778971.1| 30S ribosomal protein S9 [Xylella f... 69 3e-11
gi|21674596|ref|NP_662661.1| ribosomal protein S9 [Chlorobium te... 67 8e-11
gi|33603330|ref|NP_890890.1| 30s ribosomal protein S9 [Bordetell... 66 1e-10
gi|42561238|ref|NP_975689.1| 30S RIBOSOMAL PROTEIN S9 [Mycoplasm... 66 1e-10
gi|33593896|ref|NP_881540.1| 30s ribosomal protein S9 [Bordetell... 66 2e-10
gi|21229954|ref|NP_635871.1| 30S ribosomal protein S9 [Xanthomon... 65 2e-10
gi|21241261|ref|NP_640843.1| 30S ribosomal protein S9 [Xanthomon... 65 2e-10
gi|22994715|ref|ZP_00039209.1| COG0103: Ribosomal protein S9 [Xy... 65 2e-10
gi|50365309|ref|YP_053734.1| 30S ribosomal protein S9 [Mesoplasm... 65 3e-10
gi|33598392|ref|NP_886035.1| 30s ribosomal protein S9 [Bordetell... 65 4e-10
gi|41722877|ref|ZP_00149843.1| COG0103: Ribosomal protein S9 [De... 65 4e-10
gi|42522100|ref|NP_967480.1| 30S ribosomal subunit protein S9 [B... 65 4e-10
gi|29349284|ref|NP_812787.1| 30S ribosomal protein S9 [Bacteroid... 64 5e-10
gi|48853632|ref|ZP_00307800.1| COG0103: Ribosomal protein S9 [Cy... 64 5e-10
gi|34872264|ref|XP_233593.2| similar to 40S RIBOSOMAL PROTEIN S1... 63 1e-09
gi|34540205|ref|NP_904684.1| ribosomal protein S9 [Porphyromonas... 62 2e-09
gi|15838137|ref|NP_298825.1| 30S ribosomal protein S9 [Xylella f... 62 2e-09
gi|15612732|ref|NP_241035.1| 30S ribosomal protein S9; ribosomal... 62 2e-09
gi|20808625|ref|NP_623796.1| Ribosomal protein S9 [Thermoanaerob... 62 3e-09
gi|23103623|ref|ZP_00090101.1| COG0103: Ribosomal protein S9 [Az... 61 4e-09
gi|45520122|ref|ZP_00171673.1| COG0103: Ribosomal protein S9 [Ra... 61 5e-09
gi|21398102|ref|NP_654087.1| Ribosomal_S9, Ribosomal protein S9/... 61 5e-09
gi|42526365|ref|NP_971463.1| ribosomal protein S9 [Treponema den... 60 7e-09
gi|30018413|ref|NP_830044.1| SSU ribosomal protein S9P [Bacillus... 60 7e-09
gi|16801806|ref|NP_472074.1| ribosomal protein S9 [Listeria inno... 60 7e-09
gi|48763062|ref|ZP_00267618.1| COG0103: Ribosomal protein S9 [Rh... 60 9e-09
gi|30249454|ref|NP_841524.1| Ribosomal protein S9 [Nitrosomonas ... 60 9e-09
gi|26988051|ref|NP_743476.1| ribosomal protein S9 [Pseudomonas p... 60 9e-09
gi|15611147|ref|NP_222798.1| 30S RIBOSOMAL PROTEIN S9 [Helicobac... 60 9e-09
gi|15896348|ref|NP_349697.1| Ribosomal protein S9 [Clostridium a... 60 1e-08
gi|28212147|ref|NP_783091.1| SSU ribosomal protein S9P [Clostrid... 60 1e-08
gi|41688999|ref|ZP_00145534.1| COG0103: Ribosomal protein S9 [Ps... 60 1e-08
gi|49077272|gb|AAT49660.1| PA4432 [synthetic construct] 60 1e-08
gi|32265998|ref|NP_860030.1| ribosomal protein S9 [Helicobacter ... 60 1e-08
gi|24375427|ref|NP_719470.1| ribosomal protein S9 [Shewanella on... 59 2e-08
gi|48863783|ref|ZP_00317676.1| COG0103: Ribosomal protein S9 [Mi... 59 2e-08
gi|15599628|ref|NP_253122.1| 30S ribosomal protein S9 [Pseudomon... 59 2e-08
gi|34499151|ref|NP_903366.1| 30S ribosomal protein S9 [Chromobac... 59 3e-08
gi|15594683|ref|NP_212472.1| ribosomal protein S9 (rpsI) [Borrel... 59 3e-08
gi|32476449|ref|NP_869443.1| 30S ribosomal protein S9 [Pirellula... 59 3e-08
gi|15644202|ref|NP_229252.1| ribosomal protein S9 [Thermotoga ma... 58 4e-08
gi|33188463|ref|NP_872578.1| mitochondrial ribosomal protein S9;... 58 4e-08
gi|20140018|sp|P82933|RT09_HUMAN 28S ribosomal protein S9, mitoc... 58 4e-08
gi|29126836|gb|AAH47784.1| MRPS9 protein [Homo sapiens] 58 4e-08
gi|24644917|ref|NP_524270.2| CG2957-PA [Drosophila melanogaster]... 58 4e-08
gi|15792794|ref|NP_282617.1| 30S ribosomal protein S9 [Campyloba... 58 4e-08
gi|48767963|ref|ZP_00272315.1| COG0103: Ribosomal protein S9 [Ra... 58 5e-08
gi|15803764|ref|NP_289798.1| 30S ribosomal subunit protein S9 [E... 58 5e-08
gi|33152549|ref|NP_873902.1| 30S ribosomal protein S9 [Haemophil... 58 5e-08
gi|33357886|pdb|1P6G|I Chain I, Real Space Refined Coordinates O... 58 5e-08
gi|16762104|ref|NP_457721.1| 30S ribosomal subunit protein S9 [S... 57 6e-08
gi|46321135|ref|ZP_00221515.1| COG0103: Ribosomal protein S9 [Bu... 57 6e-08
gi|48730148|ref|ZP_00263896.1| COG0103: Ribosomal protein S9 [Ps... 57 6e-08
gi|23472612|ref|ZP_00127936.1| COG0103: Ribosomal protein S9 [Ps... 57 6e-08
gi|49235660|ref|ZP_00329727.1| COG0103: Ribosomal protein S9 [Mo... 57 6e-08
gi|24114517|ref|NP_709027.1| 30S ribosomal subunit protein S9 [S... 57 8e-08
gi|15677878|ref|NP_275046.1| 30S ribosomal protein S9 [Neisseria... 57 8e-08
gi|47573002|ref|ZP_00243042.1| COG0103: Ribosomal protein S9 [Ru... 57 8e-08
gi|34558417|ref|NP_908232.1| SSU RIBOSOMAL PROTEIN S9P [Wolinell... 57 8e-08
gi|30918501|sp|P07842|RS9_BACST 30S ribosomal protein S9 (BS10) 57 1e-07
gi|48785106|ref|ZP_00281411.1| COG0103: Ribosomal protein S9 [Bu... 57 1e-07
gi|37527869|ref|NP_931214.1| 30S ribosomal protein S9 [Photorhab... 57 1e-07
gi|32035250|ref|ZP_00135268.1| COG0103: Ribosomal protein S9 [Ac... 57 1e-07
gi|70924|pir||R3BS9 ribosomal protein S9 - Bacillus stearothermo... 57 1e-07
gi|15964995|ref|NP_385348.1| PROBABLE 30S RIBOSOMAL PROTEIN S9 [... 56 1e-07
gi|48859498|ref|ZP_00313431.1| COG0103: Ribosomal protein S9 [Cl... 56 1e-07
gi|45531592|ref|ZP_00182632.1| COG0103: Ribosomal protein S9 [Ex... 56 1e-07
gi|39935835|ref|NP_948111.1| ribosomal protein S9 [Rhodopseudomo... 56 1e-07
gi|29655036|ref|NP_820728.1| ribosomal protein S9 [Coxiella burn... 56 1e-07
gi|27904841|ref|NP_777967.1| ribosomal protein S9 [Buchnera aphi... 56 2e-07
gi|15610578|ref|NP_217959.1| rpsI [Mycobacterium tuberculosis H3... 56 2e-07
gi|17545210|ref|NP_518612.1| PROBABLE 30S RIBOSOMAL PROTEIN S9 [... 55 2e-07
gi|46316074|ref|ZP_00216654.1| COG0103: Ribosomal protein S9 [Bu... 55 2e-07
gi|18311351|ref|NP_563285.1| 30S ribosomal protein S9 [Clostridi... 55 2e-07
gi|50086030|ref|YP_047540.1| 30S ribosomal protein S9 [Acinetoba... 55 2e-07
gi|15827098|ref|NP_301361.1| 30S ribosomal protein S9 [Mycobacte... 55 2e-07
gi|19551816|ref|NP_599818.1| ribosomal protein S9 [Corynebacteri... 55 2e-07
gi|31544498|ref|NP_853076.1| RpsI [Mycoplasma gallisepticum R] >... 55 2e-07
gi|42629472|ref|ZP_00155018.1| COG0103: Ribosomal protein S9 [Ha... 55 3e-07
gi|15602386|ref|NP_245458.1| RpS9 [Pasteurella multocida Pm70] >... 55 3e-07
gi|33862087|ref|NP_893648.1| 30S ribosomal protein S9 [Prochloro... 55 3e-07
gi|15640008|ref|NP_219461.1| ribosomal protein S9 (rpsI) [Trepon... 55 3e-07
gi|23466789|ref|ZP_00122376.1| COG0103: Ribosomal protein S9 [Ha... 55 4e-07
gi|285397|pir||B43310 ribosomal protein S9 - Haemophilus somnus 55 4e-07
gi|50119267|ref|YP_048434.1| 30S ribosomal protein S9 [Erwinia c... 55 4e-07
gi|16123706|ref|NP_407019.1| 30S ribosomal protein S9 [Yersinia ... 55 4e-07
gi|16804634|ref|NP_466119.1| ribosomal protein S9 [Listeria mono... 55 4e-07
gi|22124053|ref|NP_667476.1| 30S ribosomal subunit protein S9 [Y... 55 4e-07
gi|15925207|ref|NP_372741.1| 30S ribosomal protein S9 [Staphyloc... 54 5e-07
gi|46914765|emb|CAG21542.1| putative 30S ribosomal subunit prote... 54 5e-07
gi|48850484|ref|ZP_00304726.1| COG0103: Ribosomal protein S9 [No... 54 5e-07
gi|21283865|ref|NP_646953.1| 30S ribosomal protein S9 [Staphyloc... 54 5e-07
gi|39938625|ref|NP_950391.1| ribosomal protein S9 [Onion yellows... 54 7e-07
gi|16077218|ref|NP_388031.1| ribosomal protein S9 [Bacillus subt... 54 7e-07
gi|26553534|ref|NP_757468.1| ribosomal protein S9 [Mycoplasma pe... 54 7e-07
gi|16125626|ref|NP_420190.1| ribosomal protein S9 [Caulobacter c... 54 7e-07
gi|22958424|ref|ZP_00006096.1| COG0103: Ribosomal protein S9 [Rh... 54 7e-07
gi|13508355|ref|NP_110305.1| ribosomal protein S9 [Mycoplasma pn... 54 7e-07
gi|32490888|ref|NP_871142.1| rpsI [Wigglesworthia glossinidia en... 54 9e-07
gi|48835023|ref|ZP_00292025.1| COG0103: Ribosomal protein S9 [Th... 54 9e-07
gi|27380073|ref|NP_771602.1| 30S ribosomal protein S9 [Bradyrhiz... 54 9e-07
gi|28493112|ref|NP_787273.1| 30S ribosomal protein S9 [Tropherym... 54 9e-07
gi|49475551|ref|YP_033592.1| 30S ribosomal protein s9 [Bartonell... 54 9e-07
gi|49474263|ref|YP_032305.1| 30s ribosomal protein s9 [Bartonell... 54 9e-07
gi|24216107|ref|NP_713588.1| ribosomal protein S9 [Leptospira in... 54 9e-07
gi|223001|prf||0401169A protein S9 53 1e-06
gi|39997966|ref|NP_953917.1| ribosomal protein S9 [Geobacter sul... 53 1e-06
gi|21672651|ref|NP_660718.1| 30S ribosomal protein S9 [Buchnera ... 53 1e-06
gi|16273349|ref|NP_439594.1| ribosomal protein S9 [Haemophilus i... 53 1e-06
gi|25027143|ref|NP_737197.1| putative 30S ribosomal protein S9 [... 53 1e-06
gi|41410344|ref|NP_963180.1| RpsI [Mycobacterium avium subsp. pa... 53 1e-06
gi|47682630|gb|AAH69980.1| Mrps9 protein [Mus musculus] 53 1e-06
gi|48871224|ref|ZP_00323940.1| COG0103: Ribosomal protein S9 [Pe... 53 1e-06
gi|15888577|ref|NP_354258.1| AGR_C_2299p [Agrobacterium tumefaci... 53 1e-06
gi|18490431|gb|AAH22587.1| Mrps9 protein [Mus musculus] 53 1e-06
gi|30704889|gb|AAH51936.1| Mrps9 protein [Mus musculus] 53 1e-06
gi|32813441|ref|NP_076003.2| mitochondrial ribosomal protein S9;... 53 1e-06
gi|12045277|ref|NP_073088.1| ribosomal protein S9 (rpS9) [Mycopl... 53 1e-06
gi|33866626|ref|NP_898185.1| 30S ribosomal protein S9 [Synechoco... 52 2e-06
gi|23501677|ref|NP_697804.1| ribosomal protein S9 [Brucella suis... 52 2e-06
gi|17987452|ref|NP_540086.1| SSU ribosomal protein S9P [Brucella... 52 2e-06
gi|33864026|ref|NP_895586.1| 30S ribosomal protein S9 [Prochloro... 52 2e-06
gi|34811537|pdb|1PNS|I Chain I, Crystal Structure Of A Streptomy... 52 3e-06
gi|46199402|ref|YP_005069.1| SSU ribosomal protein S9P [Thermus ... 52 3e-06
gi|15640593|ref|NP_230222.1| ribosomal protein S9 [Vibrio choler... 52 3e-06
gi|22297653|ref|NP_680900.1| 30S ribosomal protein S9 [Thermosyn... 52 3e-06
gi|13358141|ref|NP_078415.1| ribosomal protein S9 [Ureaplasma pa... 52 3e-06
gi|28897213|ref|NP_796818.1| ribosomal protein S9 [Vibrio paraha... 52 3e-06
gi|27468708|ref|NP_765345.1| 30S ribosomal protein S9 [Staphyloc... 52 3e-06
gi|38233171|ref|NP_938938.1| 30S ribosomal protein S9 [Corynebac... 51 4e-06
gi|16329913|ref|NP_440641.1| 30S ribosomal protein S9 [Synechocy... 51 4e-06
gi|17231679|ref|NP_488227.1| 30S ribosomal protein S9 [Nostoc sp... 51 6e-06
gi|48831716|ref|ZP_00288770.1| COG0103: Ribosomal protein S9 [Ma... 51 6e-06
gi|404617|gb|AAD10556.1| uncertain [Mycoplasma genitalium] 51 6e-06
gi|23097607|ref|NP_691073.1| 30S ribosomal protein S9 [Oceanobac... 50 7e-06
gi|50657674|gb|AAT79659.1| 30S ribosomal protein S9 [Gracilaria ... 50 1e-05
gi|48866559|ref|ZP_00320373.1| COG0103: Ribosomal protein S9 [Ha... 50 1e-05
gi|37523988|ref|NP_927365.1| 30S ribosomal protein S9 [Gloeobact... 50 1e-05
gi|45513634|ref|ZP_00165200.1| COG0103: Ribosomal protein S9 [Sy... 50 1e-05
gi|7799378|emb|CAB90994.1| 30S ribosomal protein S9 [Buchnera ap... 50 1e-05
gi|15674235|ref|NP_268410.1| 30S ribosomal protein S9 [Lactococc... 50 1e-05
gi|50843260|ref|YP_056487.1| 30S ribosomal protein S9 [Propionib... 50 1e-05
gi|15616994|ref|NP_240207.1| 30S ribosomal protein S9 [Buchnera ... 50 1e-05
gi|24378685|ref|NP_720640.1| 30S ribosomal protein S9 [Streptoco... 50 1e-05
gi|48846474|ref|ZP_00300736.1| COG0103: Ribosomal protein S9 [Ge... 50 1e-05
gi|11465757|ref|NP_053901.1| ribosomal protein S9 [Porphyra purp... 49 2e-05
gi|46308072|ref|ZP_00210277.1| COG0103: Ribosomal protein S9 [Eh... 49 2e-05
gi|27364059|ref|NP_759587.1| Ribosomal protein S9 [Vibrio vulnif... 49 2e-05
gi|45915690|ref|ZP_00194406.2| COG0103: Ribosomal protein S9 [Me... 49 2e-05
gi|19703673|ref|NP_603235.1| SSU ribosomal protein S9P [Fusobact... 49 2e-05
gi|15902316|ref|NP_357866.1| 30S Ribosomal protein S9 [Streptoco... 49 2e-05
gi|15900229|ref|NP_344833.1| ribosomal protein S9 [Streptococcus... 49 2e-05
gi|23336644|ref|ZP_00121850.1| COG0103: Ribosomal protein S9 [Bi... 49 3e-05
gi|45547826|ref|ZP_00187867.1| COG0103: Ribosomal protein S9 [Ru... 49 3e-05
gi|48893966|ref|ZP_00327164.1| COG0103: Ribosomal protein S9 [Tr... 49 3e-05
gi|15675735|ref|NP_269909.1| ribosomal protein S9 [Streptococcus... 49 3e-05
gi|11466356|ref|NP_038359.1| ribosomal protein S9 [Mesostigma vi... 48 4e-05
gi|23016249|ref|ZP_00056007.1| COG0103: Ribosomal protein S9 [Ma... 48 4e-05
gi|11467740|ref|NP_050792.1| ribosomal protein S9 [Guillardia th... 48 4e-05
gi|33241134|ref|NP_876076.1| Ribosomal protein S9 [Prochlorococc... 48 4e-05
gi|13242064|gb|AAK16543.1| 9S ribosomal protein [Zea mays] >gnl|... 47 6e-05
gi|45525108|ref|ZP_00176356.1| COG0103: Ribosomal protein S9 [Cr... 47 6e-05
gi|22536399|ref|NP_687250.1| ribosomal protein S9 [Streptococcus... 47 6e-05
gi|48825646|ref|ZP_00286889.1| COG0103: Ribosomal protein S9 [En... 47 6e-05
gi|48374278|gb|AAT41967.1| 30S ribosomal subunit S9 [Fremyella d... 47 6e-05
gi|15805211|ref|NP_293899.1| ribosomal protein S9 [Deinococcus r... 47 8e-05
gi|13476981|ref|NP_108551.1| ribosomal protein S9 [Mesorhizobium... 47 8e-05
gi|50876215|emb|CAG36055.1| probable 30S ribosomal protein S9 [D... 47 8e-05
gi|42518462|ref|NP_964392.1| 30S ribosomal protein S9 [Lactobaci... 47 1e-04
gi|46364460|ref|ZP_00227075.1| COG0103: Ribosomal protein S9 [Ki... 46 1e-04
gi|29377675|ref|NP_816829.1| ribosomal protein S9 [Enterococcus ... 46 1e-04
gi|23484085|gb|EAA19540.1| ribosomal protein S9, putative [Plasm... 46 2e-04
gi|12229990|sp|Q9P4C1|RT09_KLUMA 40S ribosomal protein S9, mitoc... 46 2e-04
gi|29831501|ref|NP_826135.1| putative ribosomal protein S9 [Stre... 45 2e-04
gi|5456938|dbj|BAA82395.1| ribosomal protein S9 [Oryza sativa (j... 45 2e-04
gi|21223114|ref|NP_628893.1| 30S ribosomal protein S9 [Streptomy... 45 2e-04
gi|12229973|sp|O94150|RT09_CANAL 40S ribosomal protein S9, mitoc... 45 3e-04
gi|50730474|ref|XP_416921.1| PREDICTED: similar to mitochondrial... 45 4e-04
gi|47459065|ref|YP_015927.1| 30S ribosomal protein s9 [Mycoplasm... 45 4e-04
gi|11465445|ref|NP_045164.1| ribosomal protein S9 [Cyanidium cal... 44 5e-04
gi|31236700|ref|XP_319461.1| ENSANGP00000014497 [Anopheles gambi... 44 5e-04
gi|15606910|ref|NP_214291.1| ribosomal protein S09 [Aquifex aeol... 44 7e-04
gi|11467765|ref|NP_050816.1| ribosomal protein S9 [Nephroselmis ... 44 0.001
gi|14787435|emb|CAC44248.1| 40S ribosomal protein [Atropa bellad... 43 0.001
gi|50311985|ref|XP_456024.1| unnamed protein product [Kluyveromy... 43 0.002
gi|32405030|ref|XP_323128.1| hypothetical protein [Neurospora cr... 42 0.002
gi|50426757|ref|XP_461976.1| unnamed protein product [Debaryomyc... 42 0.003
gi|50293315|ref|XP_449069.1| unnamed protein product [Candida gl... 41 0.006
gi|6319622|ref|NP_009704.1| Mitochondrial ribosomal protein of t... 41 0.006
gi|45520875|ref|ZP_00172400.1| COG0103: Ribosomal protein S9 [Me... 40 0.008
gi|2218028|emb|CAB09898.1| putative 30S ribosomal protein [Proch... 40 0.010
gi|33519532|ref|NP_878364.1| 30S ribosomal subunit protein S9 [C... 40 0.010
gi|48864988|ref|ZP_00318856.1| COG0103: Ribosomal protein S9 [Oe... 40 0.013
gi|15828967|ref|NP_326327.1| 30S RIBOSOMAL PROTEIN S9 [Mycoplasm... 40 0.013
gi|38109399|gb|EAA55278.1| hypothetical protein MG06935.4 [Magna... 40 0.013
gi|23003831|ref|ZP_00047472.1| COG0103: Ribosomal protein S9 [La... 39 0.017
gi|11467398|ref|NP_043255.1| ribosomal protein S9 [Cyanophora pa... 39 0.017
gi|46126049|ref|XP_387578.1| hypothetical protein FG07402.1 [Gib... 39 0.022
gi|23508572|ref|NP_701241.1| ribosomal protein S9, putative [Pla... 39 0.029
gi|49098795|ref|XP_410701.1| hypothetical protein AN6564.2 [Aspe... 39 0.029
gi|7516704|pir||H72557 hypothetical protein APE1748 - Aeropyrum ... 38 0.050
gi|27382781|ref|NP_774310.1| bll7670 [Bradyrhizobium japonicum U... 37 0.065
gi|23485635|gb|EAA20510.1| ribosomal protein S9, putative [Plasm... 37 0.065
gi|45190639|ref|NP_984893.1| AER033Wp [Eremothecium gossypii] >g... 37 0.065
gi|46164885|ref|ZP_00137920.2| COG0103: Ribosomal protein S9 [Ps... 37 0.085
gi|34765017|ref|ZP_00145325.1| SSU ribosomal protein S9P [Fusoba... 37 0.085
gi|47206571|emb|CAF90831.1| unnamed protein product [Tetraodon n... 36 0.14
gi|15679181|ref|NP_276298.1| conserved protein [Methanothermobac... 36 0.19
gi|34394764|dbj|BAC84128.1| unknown protein [Oryza sativa (japon... 35 0.25
gi|46308253|ref|ZP_00210447.1| COG0103: Ribosomal protein S9 [Eh... 35 0.25
gi|30693135|ref|NP_190477.2| ribosomal protein S9 family protein... 35 0.32
gi|15887808|ref|NP_353489.1| AGR_C_812p [Agrobacterium tumefacie... 35 0.42
gi|49080914|ref|XP_403922.1| hypothetical protein UM06307.1 [Ust... 34 0.55
gi|41179039|ref|NP_958395.1| ribosomal protein S9 [Chlamydomonas... 34 0.55
gi|30249740|ref|NP_841810.1| Phosphoglycerate mutase family [Nit... 34 0.55
gi|2497222|sp|Q04949|YM8X_YEAST Hypothetical 36.8 kDa protein in... 33 0.94
gi|6323957|ref|NP_014028.1| Protein of unknown function; green f... 33 0.94
gi|15963788|ref|NP_384141.1| HYPOTHETICAL PROTEIN SMc02759 [Sino... 33 0.94
gi|798941|emb|CAA89132.1| unknown [Saccharomyces cerevisiae] 33 0.94
gi|49482864|ref|YP_040088.1| teichoic acid biosynthesis protein ... 33 0.94
gi|7521980|pir||T30183 hypothetical protein 5 - Shewanella sp >g... 32 2.1
gi|46132829|ref|ZP_00171551.2| COG1493: Serine kinase of the HPr... 32 2.7
gi|49091378|ref|XP_407150.1| hypothetical protein AN3013.2 [Aspe... 32 2.7
gi|29539342|dbj|BAC67672.1| DNA-directed RNA polymerase II large... 32 2.7
gi|17545124|ref|NP_518526.1| PUTATIVE HPR KINASE AND PHOSPHATASE... 32 2.7
gi|22972601|ref|ZP_00019470.1| hypothetical protein [Chloroflexu... 32 3.6
gi|48770305|ref|ZP_00274648.1| COG1493: Serine kinase of the HPr... 32 3.6
gi|22208504|gb|AAM94319.1| putative stripe rust resistance prote... 32 3.6
gi|46143734|ref|ZP_00134586.2| COG0433: Predicted ATPase [Actino... 32 3.6
gi|22208468|gb|AAM94297.1| putative stripe rust resistance prote... 32 3.6
gi|47205389|emb|CAG14058.1| unnamed protein product [Tetraodon n... 32 3.6
gi|32892237|gb|AAP50783.1| recombination-activating gene 1 [Phas... 31 4.6
gi|47229698|emb|CAG06894.1| unnamed protein product [Tetraodon n... 31 4.6
gi|34873031|ref|XP_222254.2| similar to autism susceptibility ca... 31 4.6
gi|26546928|gb|AAN05771.1| unknown [Mycobacterium avium] 31 6.1
gi|50747075|ref|XP_426338.1| PREDICTED: similar to solute carrie... 31 6.1
gi|38636694|dbj|BAD03115.1| hypothetical protein [Oryza sativa (... 31 6.1
gi|50553212|ref|XP_504016.1| hypothetical protein [Yarrowia lipo... 30 7.9
gi|48865615|ref|ZP_00319474.1| COG1028: Dehydrogenases with diff... 30 7.9
gi|26338824|dbj|BAC33083.1| unnamed protein product [Mus musculus] 30 7.9
gi|28901212|ref|NP_800867.1| hypothetical protein VPA1357 [Vibri... 30 7.9
gi|29567095|ref|NP_818657.1| P47 [Adoxophyes honmai nucleopolyhe... 30 7.9
gi|32477835|ref|NP_870829.1| hypothetical protein-transmembrane ... 30 7.9
gi|2506502|sp|P55160|MEM1_HUMAN Membrane-associated protein HEM-... 30 7.9
gi|34485727|ref|NP_005328.2| hematopoietic protein 1; membrane-a... 30 7.9
gi|50838968|gb|AAT81729.1| putative nucleotide-binding leucine-r... 30 7.9
>gi|17563670|ref|NP_506690.1| ribosomal Protein, Small subunit (16.3
kD) (rps-16) [Caenorhabditis elegans]
gi|2500429|sp|Q22054|RS16_CAEEL 40S ribosomal protein S16
gi|7506839|pir||T24280 hypothetical protein T01C3.6 -
Caenorhabditis elegans
gi|3879245|emb|CAB01658.1| Hypothetical protein T01C3.6
[Caenorhabditis elegans]
Length = 144
Score = 284 bits (727), Expect = 2e-76
Identities = 144/144 (100%), Positives = 144/144 (100%)
Frame = -1
Query: 435 MTSTVQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKER 256
MTSTVQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKER
Sbjct: 1 MTSTVQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKER 60
Query: 255 FQDVDIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVA 76
FQDVDIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVA
Sbjct: 61 FQDVDIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVA 120
Query: 75 DPRRRESKKFGGPGARARYQKSYR 4
DPRRRESKKFGGPGARARYQKSYR
Sbjct: 121 DPRRRESKKFGGPGARARYQKSYR 144