Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T04A8_9
(750 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554900|ref|NP_497962.1| DNaJ domain (prokaryotic heat shock... 501 e-141
gi|39591577|emb|CAE71153.1| Hypothetical protein CBG18009 [Caeno... 443 e-123
gi|47211102|emb|CAF90061.1| unnamed protein product [Tetraodon n... 94 3e-18
gi|47226293|emb|CAG09261.1| unnamed protein product [Tetraodon n... 86 8e-16
gi|15604058|ref|NP_220573.1| DNAJ PROTEIN (dnaJ) [Rickettsia pro... 86 1e-15
gi|47219032|emb|CAG00171.1| unnamed protein product [Tetraodon n... 83 5e-15
gi|50306857|ref|XP_453404.1| unnamed protein product [Kluyveromy... 83 7e-15
gi|47223452|emb|CAG04313.1| unnamed protein product [Tetraodon n... 83 7e-15
gi|21553335|ref|NP_660157.1| DnaJ (Hsp40) homolog, subfamily B, ... 82 1e-14
gi|6572224|emb|CAB63052.1| dJ408N23.4 (novel DnaJ domain protein... 82 1e-14
gi|9910416|ref|NP_064348.1| DnaJ homolog, subfamily B, member 8;... 81 2e-14
gi|41053503|ref|NP_956599.1| hypothetical protein MGC56709 [Dani... 81 3e-14
gi|47222088|emb|CAG12114.1| unnamed protein product [Tetraodon n... 81 3e-14
gi|34924888|sp|Q24331|TID_DROVI Tumorous imaginal discs protein,... 81 3e-14
gi|41152000|ref|NP_958470.1| DnaJ (Hsp40) homolog, subfamily A, ... 81 3e-14
gi|41152223|ref|NP_958499.1| DnaJ (Hsp40) homolog, subfamily A, ... 80 5e-14
gi|31560085|ref|NP_076135.2| DnaJ (Hsp40) homolog, subfamily A, ... 80 6e-14
gi|30913111|sp|Q99M87|DJA3_MOUSE DnaJ homolog subfamily A member... 80 6e-14
gi|12836451|dbj|BAB23661.1| unnamed protein product [Mus musculus] 80 6e-14
gi|34868661|ref|XP_340756.1| similar to tumorous imaginal discs ... 80 6e-14
gi|12963344|gb|AAK11222.1| tumorous imaginal discs protein Tid56... 80 6e-14
gi|26327155|dbj|BAC27321.1| unnamed protein product [Mus musculus] 80 6e-14
gi|13278151|gb|AAH03920.1| Dnaja3 protein [Mus musculus] 80 6e-14
gi|12963346|gb|AAK11223.1| tumorous imaginal discs protein Tid56... 80 6e-14
gi|4885495|ref|NP_005485.1| DnaJ (Hsp40) homolog, subfamily B, m... 79 8e-14
gi|17388799|ref|NP_490647.1| DnaJ (Hsp40) homolog, subfamily B, ... 79 8e-14
gi|41471290|gb|AAS07393.1| unknown [Homo sapiens] 79 8e-14
gi|4322315|gb|AAD16010.1| DnaJ-like 2 protein [Homo sapiens] 79 8e-14
gi|27806965|ref|NP_776957.1| DnaJ (Hsp40) homolog, subfamily B, ... 79 8e-14
gi|32395918|gb|AAP41819.1| P58IPK [Nicotiana benthamiana] 79 8e-14
gi|47940223|gb|AAH72042.1| MGC78895 protein [Xenopus laevis] 79 8e-14
gi|3372677|gb|AAC29066.1| tumorous imaginal discs protein Tid56 ... 79 1e-13
gi|31542539|ref|NP_005138.2| DnaJ (Hsp40) homolog, subfamily A, ... 79 1e-13
gi|17066575|gb|AAL35323.1| DnaJ protein Tid-1 [Homo sapiens] >gn... 79 1e-13
gi|13938209|gb|AAH07225.1| Unknown (protein for IMAGE:3161441) [... 79 1e-13
gi|13541318|ref|NP_111006.1| Molecular chaperone (DnaJ-related) ... 79 1e-13
gi|40225932|gb|AAH14062.1| DNAJA3 protein [Homo sapiens] >gnl|BL... 79 1e-13
gi|48098825|ref|XP_394833.1| similar to CG5504-PC [Apis mellifera] 79 1e-13
gi|34906106|ref|NP_914400.1| P0020E09.13 [Oryza sativa (japonica... 78 2e-13
gi|32395916|gb|AAP41818.1| P58IPK [Lycopersicon esculentum] 78 2e-13
gi|41149466|ref|XP_370665.1| similar to DnaJ (Hsp40) homolog, su... 78 2e-13
gi|44889077|sp|Q9QYI8|DJB7_MOUSE DnaJ homolog subfamily B member... 77 3e-13
gi|9910322|ref|NP_064474.1| dnaj-like protein [Rattus norvegicus... 77 3e-13
gi|50732259|ref|XP_418551.1| PREDICTED: similar to DnaJ (Hsp40) ... 77 3e-13
gi|34861860|ref|XP_344988.1| similar to mDj4 [Rattus norvegicus] 77 3e-13
gi|11496245|ref|NP_067292.1| DnaJ (Hsp40) homolog, subfamily B, ... 77 3e-13
gi|30690263|ref|NP_849719.1| DNAJ heat shock protein, putative [... 77 4e-13
gi|15217871|ref|NP_174142.1| DNAJ heat shock protein, putative [... 77 4e-13
gi|21674304|ref|NP_662369.1| DnaJ protein [Chlorobium tepidum TL... 77 4e-13
gi|48477913|ref|YP_023619.1| chaperone protein DnaJ [Picrophilus... 77 4e-13
gi|31198721|ref|XP_308308.1| ENSANGP00000010875 [Anopheles gambi... 77 4e-13
gi|19855061|sp|O54946|DJB6_MOUSE DnaJ homolog subfamily B member... 77 4e-13
gi|34853488|ref|XP_342608.1| similar to mDj4 [Rattus norvegicus] 77 4e-13
gi|6754736|ref|NP_035977.1| DnaJ (Hsp40) homolog, subfamily B, m... 77 4e-13
gi|13277586|gb|AAH03702.1| DnaJ (Hsp40) homolog, subfamily B, me... 77 4e-13
gi|50539774|ref|NP_001002353.1| zgc:92148 [Danio rerio] >gnl|BL_... 77 4e-13
gi|12838381|dbj|BAB24183.1| unnamed protein product [Mus musculus] 77 4e-13
gi|23503241|ref|NP_699161.1| DnaJ homolog, subfamily B, member 8... 77 5e-13
gi|26451496|dbj|BAC42846.1| putative AtJ1 [Arabidopsis thaliana] 77 5e-13
gi|15242650|ref|NP_195936.1| DNAJ heat shock N-terminal domain-c... 77 5e-13
gi|2129539|pir||S71190 heat shock protein dnaJ homolog - Arabido... 77 5e-13
gi|48850382|ref|ZP_00304624.1| COG2214: DnaJ-class molecular cha... 76 7e-13
gi|50555850|ref|XP_505333.1| hypothetical protein [Yarrowia lipo... 76 7e-13
gi|21312894|ref|NP_083420.1| RIKEN cDNA 4930503B20 [Mus musculus... 76 7e-13
gi|28913731|gb|AAH48658.1| 4930503B20Rik protein [Mus musculus] 76 7e-13
gi|50287405|ref|XP_446132.1| unnamed protein product [Candida gl... 76 7e-13
gi|1487966|emb|CAA64531.1| Tid56 protein [Drosophila melanogaste... 76 9e-13
gi|542596|pir||S42091 Tid(56) protein - fruit fly (Drosophila me... 76 9e-13
gi|50290913|ref|XP_447889.1| unnamed protein product [Candida gl... 76 9e-13
gi|45549272|ref|NP_524932.2| CG5504-PA [Drosophila melanogaster]... 76 9e-13
gi|17863042|gb|AAL39998.1| SD10289p [Drosophila melanogaster] 76 9e-13
gi|15892155|ref|NP_359869.1| dnaJ protein [Rickettsia conorii st... 76 9e-13
gi|45552811|ref|NP_995931.1| CG5504-PC [Drosophila melanogaster]... 76 9e-13
gi|16082112|ref|NP_394547.1| heat shock protein DnaJ related pro... 76 9e-13
gi|45552813|ref|NP_995932.1| CG5504-PB [Drosophila melanogaster]... 76 9e-13
gi|34924896|sp|Q27237|TID_DROME Tumorous imaginal discs protein,... 76 9e-13
gi|48975929|emb|CAD99040.1| putative scj1 protein [Yarrowia lipo... 76 9e-13
gi|47215594|emb|CAG11625.1| unnamed protein product [Tetraodon n... 75 1e-12
gi|3121987|sp|O34136|DNAJ_DEIPR Chaperone protein dnaJ (40 kDa h... 75 1e-12
gi|50552724|ref|XP_503772.1| hypothetical protein [Yarrowia lipo... 75 1e-12
gi|48768621|ref|ZP_00272970.1| COG0484: DnaJ-class molecular cha... 75 1e-12
gi|48096650|ref|XP_392495.1| similar to CG8448-PA [Apis mellifera] 75 2e-12
gi|45360863|ref|NP_989107.1| DnaJ homolog subfamily B member 6 [... 75 2e-12
gi|33602907|ref|NP_890467.1| molecular chaperone [Bordetella bro... 74 2e-12
gi|49388115|dbj|BAD25246.1| putative DNAJ heat shock N-terminal ... 74 2e-12
gi|33593481|ref|NP_881125.1| molecular chaperone [Bordetella per... 74 2e-12
gi|33598001|ref|NP_885644.1| molecular chaperone [Bordetella par... 74 2e-12
gi|46309065|ref|ZP_00211257.1| COG0484: DnaJ-class molecular cha... 74 3e-12
gi|7441927|pir||T09133 heat shock protein homolog DNAJ - Trypano... 74 3e-12
gi|10732861|ref|NP_036831.2| dnaJ homolog, subfamily b, member 9... 74 3e-12
gi|34904486|ref|NP_913590.1| putative heat shock protein 40 [Ory... 74 3e-12
gi|11863723|emb|CAC16088.2| DnaJ like protein [Lycopersicon escu... 74 3e-12
gi|45199025|ref|NP_986054.1| AFR507Wp [Eremothecium gossypii] >g... 74 3e-12
gi|24654066|ref|NP_725541.1| CG8448-PA [Drosophila melanogaster]... 74 4e-12
gi|18203397|sp|Q9QYI6|DJB9_MOUSE DnaJ homolog subfamily B member... 74 4e-12
gi|6680299|ref|NP_032325.1| DnaJ (Hsp40) homolog, subfamily B, m... 74 4e-12
gi|12838396|dbj|BAB24188.1| unnamed protein product [Mus musculus] 74 4e-12
gi|12838392|dbj|BAB24186.1| unnamed protein product [Mus musculus] 74 4e-12
gi|24817751|dbj|BAC23064.1| dnaJ [Mycobacterium sp. 'baby formul... 74 4e-12
gi|47777312|ref|NP_001001394.1| DnaJ-like protein [Homo sapiens]... 73 6e-12
gi|6179940|gb|AAF05720.1| DnaJ-like protein [Nicotiana tabacum] 73 6e-12
gi|15807619|ref|NP_293852.1| dnaJ protein [Deinococcus radiodura... 73 7e-12
gi|7494093|pir||T30538 heat shock protein homolog dnaJ - Trypano... 73 7e-12
gi|13346428|gb|AAK19734.1| co-chaperone protein [Trypanosoma cruzi] 73 7e-12
gi|27685061|ref|XP_217436.1| similar to DnaJ (Hsp40) homolog, su... 73 7e-12
gi|21355073|ref|NP_649763.1| CG11035-PA [Drosophila melanogaster... 73 7e-12
gi|50553969|ref|XP_504393.1| hypothetical protein [Yarrowia lipo... 73 7e-12
gi|48824061|ref|ZP_00285490.1| COG0484: DnaJ-class molecular cha... 73 7e-12
gi|30017349|ref|NP_835156.1| DnaJ (Hsp40) homolog, subfamily B, ... 73 7e-12
gi|34497100|ref|NP_901315.1| heat shock protein dnaJ; chaperone ... 72 9e-12
gi|46581645|ref|YP_012453.1| dnaJ protein [Desulfovibrio vulgari... 72 9e-12
gi|45361185|ref|NP_989180.1| hypothetical protein MGC75796 [Xeno... 72 9e-12
gi|31560495|ref|NP_038788.2| DnaJ (Hsp40) homolog, subfamily B, ... 72 9e-12
gi|46141598|ref|ZP_00146910.2| COG0484: DnaJ-class molecular cha... 72 9e-12
gi|23126440|ref|ZP_00108336.1| COG2214: DnaJ-class molecular cha... 72 9e-12
gi|21307598|gb|AAK59395.1| DnaJ [Myxococcus xanthus] 72 9e-12
gi|48786661|ref|ZP_00282795.1| COG0484: DnaJ-class molecular cha... 72 9e-12
gi|50305127|ref|XP_452522.1| unnamed protein product [Kluyveromy... 72 9e-12
gi|50752156|ref|XP_422682.1| PREDICTED: similar to DnaJ homolog ... 72 9e-12
gi|19075324|ref|NP_587824.1| hypothetical protein [Schizosacchar... 72 1e-11
gi|31222162|ref|XP_317136.1| ENSANGP00000018254 [Anopheles gambi... 72 1e-11
gi|15235310|ref|NP_194577.1| DNAJ heat shock family protein [Ara... 72 1e-11
gi|49523192|gb|AAH75137.1| Unknown (protein for MGC:81924) [Xeno... 72 1e-11
gi|23619246|ref|NP_705208.1| DNAJ-like protein, putative [Plasmo... 72 1e-11
gi|39587365|emb|CAE75019.1| Hypothetical protein CBG22923 [Caeno... 72 1e-11
gi|49071946|ref|XP_400262.1| hypothetical protein UM02647.1 [Ust... 72 1e-11
gi|50259142|gb|EAL21819.1| hypothetical protein CNBC5200 [Crypto... 72 2e-11
gi|50259141|gb|EAL21818.1| hypothetical protein CNBC5200 [Crypto... 72 2e-11
gi|30583809|gb|AAP36153.1| Homo sapiens DnaJ (Hsp40) homolog, su... 72 2e-11
gi|32405744|ref|XP_323485.1| hypothetical protein [Neurospora cr... 72 2e-11
gi|13476199|ref|NP_107769.1| heat shock protein DnaJ [Mesorhizob... 72 2e-11
gi|15675997|ref|NP_273124.1| dnaJ protein [Neisseria meningitidi... 72 2e-11
gi|6016273|sp|P25686|DJB2_HUMAN DnaJ homolog subfamily B member ... 72 2e-11
gi|284069|pir||S23508 dnaJ protein homolog - human >gnl|BL_ORD_I... 72 2e-11
gi|30584551|gb|AAP36528.1| Homo sapiens DnaJ (Hsp40) homolog, su... 72 2e-11
gi|34869308|ref|XP_341008.1| similar to DnaJ (Hsp40) homolog, su... 72 2e-11
gi|23508810|ref|NP_701478.1| heat shock protein DNAJ homolog Pfj... 72 2e-11
gi|50400479|sp|Q862Z4|DJB3_MACFU DnaJ homolog subfamily B member... 72 2e-11
gi|29375878|ref|NP_815032.1| dnaJ protein [Enterococcus faecalis... 72 2e-11
gi|26787996|emb|CAA44969.2| HSJ1a protien [Homo sapiens] >gnl|BL... 72 2e-11
gi|250082|gb|AAA09034.1| HSJ1a [Homo sapiens] 72 2e-11
gi|27904644|ref|NP_777770.1| chaperone protein DnaJ [Buchnera ap... 72 2e-11
gi|48146309|emb|CAG33377.1| DNAJB11 [Homo sapiens] 72 2e-11
gi|26344614|dbj|BAC35956.1| unnamed protein product [Mus musculus] 72 2e-11
gi|37361854|gb|AAQ91040.1| LRRGT00084 [Rattus norvegicus] 72 2e-11
gi|20892117|ref|XP_148071.1| RIKEN cDNA 1810031F23 [Mus musculus... 72 2e-11
gi|27754067|ref|NP_080676.2| DnaJ (Hsp40) homolog, subfamily B, ... 72 2e-11
gi|27151736|ref|NP_006727.2| DnaJ (Hsp40) homolog, subfamily B, ... 72 2e-11
gi|7706495|ref|NP_057390.1| DnaJ (Hsp40) homolog, subfamily B, m... 72 2e-11
gi|14579002|gb|AAK69110.1| PWP1-interacting protein 4 [Homo sapi... 72 2e-11
gi|17352354|gb|AAL17676.1| apobec-1 binding protein 2 [Mus muscu... 72 2e-11
gi|15924569|ref|NP_372103.1| DnaJ protein [Staphylococcus aureus... 71 2e-11
gi|49483827|ref|YP_041051.1| chaperone protein [Staphylococcus a... 71 2e-11
gi|49092278|ref|XP_407600.1| hypothetical protein AN3463.2 [Aspe... 71 2e-11
gi|49097694|ref|XP_410307.1| hypothetical protein AN6170.2 [Aspe... 71 2e-11
gi|27468184|ref|NP_764821.1| DnaJ protein [Staphylococcus epider... 71 2e-11
gi|49235988|ref|ZP_00330051.1| COG0484: DnaJ-class molecular cha... 71 2e-11
gi|46133570|ref|ZP_00157396.2| COG0484: DnaJ-class molecular cha... 71 2e-11
gi|14318504|ref|NP_116638.1| involved in protection against heat... 71 2e-11
gi|48867977|ref|ZP_00321382.1| COG0484: DnaJ-class molecular cha... 71 2e-11
gi|15218515|ref|NP_172506.1| DNAJ heat shock protein, putative [... 71 2e-11
gi|15829204|ref|NP_326564.1| HEAT SHOCK PROTEIN DNAJ (activation... 71 2e-11
gi|15643612|ref|NP_228658.1| dnaJ protein [Thermotoga maritima M... 71 3e-11
gi|42542970|gb|AAH66411.1| Dnajb11 protein [Danio rerio] 71 3e-11
gi|38488745|ref|NP_942116.1| DnaJ (Hsp40) homolog, subfamily B, ... 71 3e-11
gi|42742432|gb|AAS45274.1| microvascular endothelial differentia... 71 3e-11
gi|12044869|ref|NP_072679.1| heat shock protein (dnaJ) [Mycoplas... 71 3e-11
gi|21593202|gb|AAM65151.1| putative heat-shock protein [Arabidop... 71 3e-11
gi|15225377|ref|NP_179646.1| DNAJ heat shock family protein [Ara... 71 3e-11
gi|31544354|ref|NP_852932.1| DnaJ [Mycoplasma gallisepticum R] >... 71 3e-11
gi|17547353|ref|NP_520755.1| PROBABLE CHAPERONE PROTEIN [Ralston... 71 3e-11
gi|23612369|ref|NP_703949.1| DNAJ domain protein, putative [Plas... 71 3e-11
gi|23479075|gb|EAA16004.1| DNAj homolog subfamily b member 9 [Pl... 71 3e-11
gi|498993|emb|CAA84049.1| HRC558 [Saccharomyces cerevisiae] 70 4e-11
gi|9558755|ref|NP_036460.1| DnaJ (Hsp40) homolog, subfamily B, m... 70 4e-11
gi|1176475|sp|P40358|YJH3_YEAST Hypothetical 80.4 kDa protein in... 70 4e-11
gi|50425139|ref|XP_461161.1| unnamed protein product [Debaryomyc... 70 4e-11
gi|6322388|ref|NP_012462.1| DnaJ-like chaperone required for nuc... 70 4e-11
gi|23613035|ref|NP_703357.1| heat shock protein, putative [Plasm... 70 4e-11
gi|28422711|gb|AAH46936.1| Dnajb9-prov protein [Xenopus laevis] 70 4e-11
gi|48716890|dbj|BAD23586.1| putative DnaJ-like protein [Oryza sa... 70 4e-11
gi|15029743|gb|AAH11090.1| Dnajb10 protein [Mus musculus] 70 4e-11
gi|38106300|gb|EAA52627.1| hypothetical protein MG05319.4 [Magna... 70 5e-11
gi|6226597|sp|P77866|DNAJ_ACTAC Chaperone protein dnaJ >gnl|BL_O... 70 5e-11
gi|42522819|ref|NP_968199.1| DnaJ protein [Bdellovibrio bacterio... 70 5e-11
gi|46106508|ref|ZP_00200021.1| COG0484: DnaJ-class molecular cha... 70 5e-11
gi|46199427|ref|YP_005094.1| chaperone protein dnaJ [Thermus the... 70 5e-11
gi|3123215|sp|Q56237|DNAJ_THETH Chaperone protein dnaJ >gnl|BL_O... 70 5e-11
gi|1449142|gb|AAB04678.1| heat shock protein 70 5e-11
gi|15231987|ref|NP_187503.1| DNAJ heat shock protein, putative [... 70 5e-11
gi|21618097|gb|AAM67147.1| putative heat shock protein [Arabidop... 70 5e-11
gi|17232135|ref|NP_488683.1| chaperone DnaJ protein [Nostoc sp. ... 70 5e-11
gi|31197369|ref|XP_307632.1| ENSANGP00000016349 [Anopheles gambi... 70 5e-11
gi|134297|sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 >gnl|BL... 70 5e-11
gi|2494151|sp|Q45552|DNAJ_BACST Chaperone protein dnaJ >gnl|BL_O... 70 5e-11
gi|32034805|ref|ZP_00134923.1| COG0484: DnaJ-class molecular cha... 70 5e-11
gi|50086568|ref|YP_048078.1| heat shock protein (Hsp40), co-chap... 70 5e-11
gi|15616772|ref|NP_239984.1| DnaJ protein [Buchnera aphidicola s... 70 5e-11
gi|37362683|ref|NP_013941.2| dnaJ homolog; Scj1p [Saccharomyces ... 70 5e-11
gi|33151439|ref|NP_872792.1| chaperone protein DnaJ [Haemophilus... 70 5e-11
gi|7441914|pir||JC5609 heat shock protein dnaJ - Buchnera sp >gn... 70 5e-11
gi|50728194|ref|XP_416026.1| PREDICTED: similar to microvascular... 70 6e-11
gi|11132092|sp|O52065|DNAJ_PASHA Chaperone protein dnaJ >gnl|BL_... 70 6e-11
gi|16273157|ref|NP_439394.1| heat shock protein [Haemophilus inf... 70 6e-11
gi|20807437|ref|NP_622608.1| Molecular chaperones (contain C-ter... 70 6e-11
gi|25028745|ref|NP_738799.1| putative chaperonin DnaJ [Corynebac... 70 6e-11
gi|1169371|sp|P43735|DNAJ_HAEIN Chaperone protein dnaJ 70 6e-11
gi|48835289|ref|ZP_00292290.1| COG0484: DnaJ-class molecular cha... 70 6e-11
gi|17553096|ref|NP_498902.1| DNaJ domain (prokaryotic heat shock... 70 6e-11
gi|17553098|ref|NP_498901.1| DNaJ domain (prokaryotic heat shock... 70 6e-11
gi|23485645|gb|EAA20515.1| heat shock protein DnaJ homologue Pfj... 70 6e-11
gi|29347222|ref|NP_810725.1| putative chaperone DnAJ [Bacteroide... 70 6e-11
gi|32408143|ref|XP_324553.1| hypothetical protein [Neurospora cr... 70 6e-11
gi|9309334|dbj|BAB03216.1| dnaJ [Geobacillus thermoglucosidasius] 70 6e-11
gi|465872|sp|P34408|YLW5_CAEEL Hypothetical protein F22B7.5 in c... 70 6e-11
gi|39581903|emb|CAE72865.1| Hypothetical protein CBG20164 [Caeno... 69 8e-11
gi|19553488|ref|NP_601490.1| molecular chaperone [Corynebacteriu... 69 8e-11
gi|46316148|ref|ZP_00216728.1| COG0484: DnaJ-class molecular cha... 69 8e-11
gi|46320203|ref|ZP_00220595.1| COG0484: DnaJ-class molecular cha... 69 8e-11
gi|46201302|ref|ZP_00055306.2| COG0484: DnaJ-class molecular cha... 69 8e-11
gi|37524584|ref|NP_927928.1| heat shock protein dnaJ (HSP40) (ch... 69 8e-11
gi|23336118|ref|ZP_00121345.1| COG2214: DnaJ-class molecular cha... 69 8e-11
gi|46137749|ref|XP_390566.1| hypothetical protein FG10390.1 [Gib... 69 8e-11
gi|47497379|dbj|BAD19417.1| putative heat shock protein dnaJ [Or... 69 8e-11
gi|15595000|ref|NP_212789.1| heat shock protein (dnaJ-2) [Borrel... 69 8e-11
gi|5020005|gb|AAD37973.1| heat shock protein DnaJ [Rhodothermus ... 69 8e-11
gi|23465107|ref|NP_695710.1| chaperone protein similar to DnaJ [... 69 8e-11
gi|48836594|ref|ZP_00293590.1| COG0484: DnaJ-class molecular cha... 69 1e-10
gi|42783440|ref|NP_980687.1| chaperone protein dnaJ [Bacillus ce... 69 1e-10
gi|30264384|ref|NP_846761.1| chaperone protein dnaJ [Bacillus an... 69 1e-10
gi|38110400|gb|EAA56123.1| hypothetical protein MG01774.4 [Magna... 69 1e-10
gi|41723704|ref|ZP_00150614.1| COG0484: DnaJ-class molecular cha... 69 1e-10
gi|15228294|ref|NP_190377.1| DNAJ heat shock protein, putative [... 69 1e-10
gi|32398844|emb|CAD98554.1| heat shock protein DNAJ homologue pf... 69 1e-10
gi|48853153|ref|ZP_00307333.1| COG0484: DnaJ-class molecular cha... 69 1e-10
gi|47221273|emb|CAG13209.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|47569309|ref|ZP_00239993.1| dnaJ protein [Bacillus cereus G92... 69 1e-10
gi|39995145|ref|NP_951096.1| chaperone protein dnaJ [Geobacter s... 69 1e-10
gi|17554644|ref|NP_497839.1| DNaJ domain (prokaryotic heat shock... 69 1e-10
gi|34811738|gb|AAQ82702.1| potyviral capsid protein interacting ... 69 1e-10
gi|37523081|ref|NP_926458.1| chaperone protein [Gloeobacter viol... 69 1e-10
gi|20521712|dbj|BAA76806.2| KIAA0962 protein [Homo sapiens] 69 1e-10
gi|37522683|ref|NP_926060.1| chaperone protein [Gloeobacter viol... 69 1e-10
gi|15240968|ref|NP_195759.1| DNAJ heat shock protein, putative [... 69 1e-10
gi|23128544|ref|ZP_00110389.1| COG2214: DnaJ-class molecular cha... 69 1e-10
gi|28704053|gb|AAH47363.1| KIAA0962 protein [Homo sapiens] 69 1e-10
gi|41724817|ref|ZP_00151627.1| COG0484: DnaJ-class molecular cha... 69 1e-10
gi|48853832|ref|ZP_00307998.1| COG0484: DnaJ-class molecular cha... 68 2e-10
gi|23099422|ref|NP_692888.1| heat shock protein [Oceanobacillus ... 68 2e-10
gi|30022392|ref|NP_834023.1| Chaperone protein dnaJ [Bacillus ce... 68 2e-10
gi|50425059|ref|XP_461121.1| unnamed protein product [Debaryomyc... 68 2e-10
gi|15606104|ref|NP_213481.1| chaperone DnaJ [Aquifex aeolicus VF... 68 2e-10
gi|2462052|emb|CAA72798.1| SIS1 protein [Cryptococcus curvatus] 68 2e-10
gi|34811740|gb|AAQ82703.1| potyviral capsid protein interacting ... 68 2e-10
gi|23484095|gb|EAA19546.1| heat shock protein DnaJ homologue Pfj... 68 2e-10
gi|29841011|gb|AAP06024.1| similar to DnaJ (Hsp40 homolog, subfa... 68 2e-10
gi|48860314|ref|ZP_00314239.1| COG0484: DnaJ-class molecular cha... 68 2e-10
gi|951451|gb|AAC18896.1| TCJ3 [Trypanosoma cruzi] 68 2e-10
gi|45682670|ref|ZP_00194105.1| COG2214: DnaJ-class molecular cha... 68 2e-10
gi|33863815|ref|NP_895375.1| DnaJ3 protein [Prochlorococcus mari... 68 2e-10
gi|1169372|sp|P45555|DNAJ_STAAU Chaperone protein dnaJ (HSP40) >... 68 2e-10
gi|21402360|ref|NP_658345.1| DnaJ_C, DnaJ C terminal region [Bac... 68 2e-10
gi|49070786|ref|XP_399682.1| hypothetical protein UM02067.1 [Ust... 68 2e-10
gi|15827255|ref|NP_301518.1| DnaJ homologue [Mycobacterium lepra... 68 2e-10
gi|50762286|ref|XP_425006.1| PREDICTED: hypothetical protein XP_... 68 2e-10
gi|28950130|emb|CAD70988.1| related to SCJ1 protein [Neurospora ... 68 2e-10
gi|46200114|ref|YP_005781.1| chaperone protein dnaJ [Thermus the... 68 2e-10
gi|32403876|ref|XP_322551.1| hypothetical protein [Neurospora cr... 68 2e-10
gi|22972332|ref|ZP_00019216.1| hypothetical protein [Chloroflexu... 68 2e-10
gi|47213197|emb|CAF95988.1| unnamed protein product [Tetraodon n... 68 2e-10
gi|14326568|gb|AAK60328.1| At1g80030/F18B13_37 [Arabidopsis thal... 67 3e-10
gi|18412605|ref|NP_565227.1| DNAJ heat shock protein, putative [... 67 3e-10
gi|29246611|gb|EAA38201.1| GLP_13_7837_9549 [Giardia lamblia ATC... 67 3e-10
gi|50122802|ref|YP_051969.1| chaperone protein DnaJ [Erwinia car... 67 3e-10
gi|29840088|ref|NP_829194.1| dnaJ protein [Chlamydophila caviae ... 67 3e-10
gi|46103471|ref|ZP_00198394.1| COG0484: DnaJ-class molecular cha... 67 3e-10
gi|11132612|sp|Q9ZFC5|DNAJ_METSS Chaperone protein dnaJ >gnl|BL_... 67 3e-10
gi|39934273|ref|NP_946549.1| putative heat shock protein DnaJ [R... 67 3e-10
gi|16800577|ref|NP_470845.1| heat shock protein DnaJ [Listeria i... 67 3e-10
gi|15799695|ref|NP_285707.1| chaperone with DnaK; heat shock pro... 67 3e-10
gi|49097820|ref|XP_410370.1| hypothetical protein AN6233.2 [Aspe... 67 3e-10
gi|25296044|pir||G96831 hypothetical protein F18B13.12 [imported... 67 3e-10
gi|46438362|gb|EAK97694.1| hypothetical protein CaO19.10942 [Can... 67 3e-10
gi|49250545|gb|AAH74569.1| Unknown (protein for MGC:69518) [Xeno... 67 3e-10
gi|15609510|ref|NP_216889.1| dnaJ2 [Mycobacterium tuberculosis H... 67 3e-10
gi|21672435|ref|NP_660502.1| DnaJ protein [Buchnera aphidicola s... 67 3e-10
gi|42561138|ref|NP_975589.1| heat shock protein DnaJ (chaperone)... 67 3e-10
gi|42519957|ref|NP_965872.1| dnaJ protein [Wolbachia endosymbion... 67 3e-10
gi|25404348|pir||E96643 hypothetical protein T13M11.13 [imported... 67 3e-10
gi|30696610|ref|NP_176370.2| DNAJ heat shock N-terminal domain-c... 67 3e-10
gi|38105555|gb|EAA51970.1| hypothetical protein MG03565.4 [Magna... 67 3e-10
gi|34897976|ref|NP_910334.1| DnaJ protein-like~contains EST AU18... 67 3e-10
gi|46580285|ref|YP_011093.1| dnaJ protein, putative [Desulfovibr... 67 3e-10
gi|23474964|ref|ZP_00130255.1| COG2214: DnaJ-class molecular cha... 67 3e-10
gi|45190948|ref|NP_985202.1| AER346Wp [Eremothecium gossypii] >g... 67 3e-10
gi|16803512|ref|NP_464997.1| heat shock protein DnaJ [Listeria m... 67 3e-10
gi|15218901|ref|NP_176181.1| DNAJ heat shock protein, putative [... 67 3e-10
gi|15599954|ref|NP_253448.1| DnaJ protein [Pseudomonas aeruginos... 67 3e-10
gi|48854237|ref|ZP_00308400.1| COG2214: DnaJ-class molecular cha... 67 4e-10
gi|2735762|gb|AAC35417.1| heat shock protein DnaJ [Leptospira in... 67 4e-10
gi|50255984|gb|EAL18713.1| hypothetical protein CNBI2990 [Crypto... 67 4e-10
gi|49076434|ref|XP_402191.1| hypothetical protein UM04576.1 [Ust... 67 4e-10
gi|128503|sp|P26508|NOLC_RHIFR NolC protein >gnl|BL_ORD_ID|51078... 67 4e-10
gi|47224128|emb|CAG13048.1| unnamed protein product [Tetraodon n... 67 4e-10
gi|45187997|ref|NP_984220.1| ADR124Cp [Eremothecium gossypii] >g... 67 4e-10
gi|46907700|ref|YP_014089.1| chaperone protein DnaJ [Listeria mo... 67 4e-10
gi|48865946|ref|ZP_00319804.1| COG0484: DnaJ-class molecular cha... 67 4e-10
gi|3721862|dbj|BAA33726.1| heat shock protein DnaJ homologue Pfj... 67 4e-10
gi|23508294|ref|NP_700963.1| heat shock protein DnaJ homologue P... 67 4e-10
gi|34872432|ref|XP_342970.1| similar to KIAA0962 protein [Rattus... 67 4e-10
gi|24216406|ref|NP_713887.1| Chaperone protein dnaJ [Leptospira ... 67 4e-10
gi|39997501|ref|NP_953452.1| dnaJ domain protein [Geobacter sulf... 67 4e-10
gi|28897428|ref|NP_797033.1| DnaJ protein [Vibrio parahaemolytic... 67 4e-10
gi|27363826|ref|NP_759354.1| DnaJ chaperone [Vibrio vulnificus C... 67 4e-10
gi|3122004|sp|O33529|DNAJ_RHILE Chaperone protein dnaJ >gnl|BL_O... 67 4e-10
gi|37679017|ref|NP_933626.1| chaperone protein DnaJ [Vibrio vuln... 67 4e-10
gi|11132181|sp|O87385|DNAJ_VIBHA Chaperone protein dnaJ >gnl|BL_... 67 4e-10
gi|41055347|ref|NP_956694.1| hypothetical protein MGC63689 [Dani... 67 5e-10
gi|47212097|emb|CAF93917.1| unnamed protein product [Tetraodon n... 67 5e-10
gi|46136505|ref|XP_389944.1| hypothetical protein FG09768.1 [Gib... 67 5e-10
gi|16079600|ref|NP_390424.1| heat-shock protein [Bacillus subtil... 67 5e-10
gi|50556242|ref|XP_505529.1| hypothetical protein [Yarrowia lipo... 67 5e-10
gi|45506619|ref|ZP_00158971.1| COG2214: DnaJ-class molecular cha... 67 5e-10
gi|45531653|ref|ZP_00182689.1| COG2214: DnaJ-class molecular cha... 67 5e-10
gi|41054517|ref|NP_955917.1| Unknown (protein for MGC:56703); wu... 67 5e-10
gi|17230485|ref|NP_487033.1| DnaJ protein [Nostoc sp. PCC 7120] ... 67 5e-10
gi|48895741|ref|ZP_00328725.1| COG2214: DnaJ-class molecular cha... 67 5e-10
gi|29654430|ref|NP_820122.1| curved DNA-binding protein [Coxiell... 67 5e-10
gi|27377737|ref|NP_769266.1| chaperone protein [Bradyrhizobium j... 67 5e-10
gi|10177754|dbj|BAB11067.1| DnaJ protein-like [Arabidopsis thali... 66 7e-10
gi|1075596|pir||PC2306 dnaJ protein - Synechococcus sp. (strain ... 66 7e-10
gi|16128009|ref|NP_414556.1| chaperone with DnaK; heat shock pro... 66 7e-10
gi|30061585|ref|NP_835756.1| chaperone with DnaK; heat shock pro... 66 7e-10
gi|15611468|ref|NP_223119.1| putative co-chaperone with DnaK [He... 66 7e-10
gi|15645638|ref|NP_207814.1| co-chaperone-curved DNA binding pro... 66 7e-10
gi|18399949|ref|NP_565533.1| DNAJ heat shock family protein [Ara... 66 7e-10
gi|30794072|gb|AAP40480.1| putative DnaJ protein [Arabidopsis th... 66 7e-10
gi|21536561|gb|AAM60893.1| putative DnaJ protein [Arabidopsis th... 66 7e-10
gi|31196983|ref|XP_307439.1| ENSANGP00000023027 [Anopheles gambi... 66 7e-10
gi|18422864|ref|NP_568690.1| DNAJ heat shock protein, mitochondr... 66 7e-10
gi|21429604|gb|AAM49801.1| GFA2 [Arabidopsis thaliana] 66 7e-10
gi|21553367|gb|AAM62460.1| DnaJ protein-like [Arabidopsis thaliana] 66 7e-10
gi|4218148|emb|CAA10739.1| DnaJ1 protein [Anabaena variabilis] 66 7e-10
gi|17230483|ref|NP_487031.1| DnaJ protein [Nostoc sp. PCC 7120] ... 66 7e-10
gi|46129401|ref|ZP_00163160.2| COG2214: DnaJ-class molecular cha... 66 7e-10
gi|26554350|ref|NP_758284.1| heat shock protein DnaJ [Mycoplasma... 66 7e-10
gi|11132184|sp|O87778|DNAJ_LACSK Chaperone protein dnaJ >gnl|BL_... 66 7e-10
gi|25296019|pir||G84611 probable DnaJ protein [imported] - Arabi... 66 7e-10
gi|15640872|ref|NP_230503.1| dnaJ protein [Vibrio cholerae O1 bi... 66 7e-10
gi|29346654|ref|NP_810157.1| chaperone protein dnaJ [Bacteroides... 66 7e-10
gi|24111464|ref|NP_705974.1| chaperone with DnaK; heat shock pro... 66 7e-10
gi|47574814|ref|ZP_00244849.1| COG0484: DnaJ-class molecular cha... 66 7e-10
gi|15231993|ref|NP_187509.1| DNAJ heat shock N-terminal domain-c... 66 7e-10
gi|27803004|emb|CAD60707.1| unnamed protein product [Podospora a... 66 7e-10
gi|38106222|gb|EAA52557.1| hypothetical protein MG05249.4 [Magna... 66 7e-10
gi|46135018|ref|ZP_00162266.2| COG2214: DnaJ-class molecular cha... 66 7e-10
gi|4218137|emb|CAA10745.1| DnaJ1 protein [Anabaena sp.] 66 7e-10
gi|5542127|pdb|1BQZ| J-Domain (Residues 1-77) Of The Escherichi... 66 7e-10
gi|49388122|dbj|BAD25253.1| putative DnaJ homolog, subfamily C, ... 66 7e-10
gi|5542126|pdb|1BQ0| J-Domain (Residues 1-77) Of The Escherichi... 66 7e-10
gi|1942570|pdb|1XBL| Nmr Structure Of The J-Domain (Residues 2-... 66 7e-10
gi|49119322|gb|AAH73404.1| Unknown (protein for MGC:80867) [Xeno... 66 9e-10
gi|26991409|ref|NP_746834.1| dnaJ protein [Pseudomonas putida KT... 66 9e-10
gi|15617956|ref|NP_224240.1| Heat Shock Protein J [Chlamydophila... 66 9e-10
gi|32413741|ref|XP_327350.1| hypothetical protein [Neurospora cr... 66 9e-10
gi|49097742|ref|XP_410331.1| hypothetical protein AN6194.2 [Aspe... 66 9e-10
gi|23104784|ref|ZP_00091244.1| COG0484: DnaJ-class molecular cha... 66 9e-10
gi|45521649|ref|ZP_00173167.1| COG0484: DnaJ-class molecular cha... 66 9e-10
gi|28972546|dbj|BAC65689.1| mKIAA0962 protein [Mus musculus] 66 9e-10
gi|48893705|ref|ZP_00326903.1| COG2214: DnaJ-class molecular cha... 66 9e-10
gi|41053046|dbj|BAD07976.1| putative heat shock protein 40 [Oryz... 66 9e-10
gi|23128457|ref|ZP_00110304.1| COG2214: DnaJ-class molecular cha... 66 9e-10
gi|7507879|pir||T24938 hypothetical protein T15H9.1 - Caenorhabd... 66 9e-10
gi|41053303|ref|NP_956338.1| Unknown (protein for MGC:63563); wu... 66 9e-10
gi|25152100|ref|NP_741036.1| DNaJ domain (prokaryotic heat shock... 66 9e-10
gi|27261818|ref|NP_758841.1| RIKEN cDNA 4732437J24 [Mus musculus... 66 9e-10
gi|46110244|ref|XP_382180.1| hypothetical protein FG02004.1 [Gib... 65 1e-09
gi|16759006|ref|NP_454623.1| DnaJ protein [Salmonella enterica s... 65 1e-09
gi|15835234|ref|NP_296993.1| dnaJ protein [Chlamydia muridarum] ... 65 1e-09
gi|15605064|ref|NP_219848.1| Heat Shock Protein J [Chlamydia tra... 65 1e-09
gi|32421513|ref|XP_331200.1| hypothetical protein [Neurospora cr... 65 1e-09
gi|50306743|ref|XP_453346.1| unnamed protein product [Kluyveromy... 65 1e-09
gi|45513262|ref|ZP_00164828.1| COG2214: DnaJ-class molecular cha... 65 1e-09
gi|32450159|gb|AAH53791.1| Dnaja2-prov protein [Xenopus laevis] 65 1e-09
gi|48763848|ref|ZP_00268401.1| COG0484: DnaJ-class molecular cha... 65 1e-09
gi|24372710|ref|NP_716752.1| chaperone protein DnaJ [Shewanella ... 65 1e-09
gi|48140695|ref|XP_393522.1| similar to Zgc:85806 [Apis mellifera] 65 1e-09
gi|7441921|pir||T06594 heat shock protein dnaJ - garden pea >gnl... 65 1e-09
gi|34541399|ref|NP_905878.1| dnaJ protein [Porphyromonas gingiva... 65 1e-09
gi|19111916|ref|NP_595124.1| hypothetical dnaJ protein [Schizosa... 65 2e-09
gi|38234291|ref|NP_940058.1| chaperone protein 2 [Corynebacteriu... 65 2e-09
gi|42564975|ref|NP_188410.2| DNAJ heat shock family protein [Ara... 65 2e-09
gi|23474234|ref|ZP_00129528.1| COG0484: DnaJ-class molecular cha... 65 2e-09
gi|31195093|ref|XP_306494.1| ENSANGP00000014657 [Anopheles gambi... 65 2e-09
gi|2689720|gb|AAB91418.1| DnaJ homologue [Arabidopsis thaliana] 65 2e-09
gi|24580827|ref|NP_608586.1| CG5001-PA [Drosophila melanogaster]... 65 2e-09
gi|7490703|pir||T39674 hypothetical dnaJ protein - fission yeast... 65 2e-09
gi|50291421|ref|XP_448143.1| unnamed protein product [Candida gl... 65 2e-09
gi|15640026|ref|NP_218657.1| heat shock protein [Treponema palli... 65 2e-09
gi|7441931|pir||F71379 heat shock protein dnaJ - syphilis spiroc... 65 2e-09
gi|39595520|emb|CAE60558.1| Hypothetical protein CBG04187 [Caeno... 65 2e-09
gi|16331768|ref|NP_442496.1| DnaJ protein [Synechocystis sp. PCC... 65 2e-09
gi|22970119|ref|ZP_00017267.1| hypothetical protein [Chloroflexu... 65 2e-09
gi|34897648|ref|NP_910170.1| hypothetical protein [Oryza sativa]... 65 2e-09
gi|31210751|ref|XP_314342.1| ENSANGP00000013114 [Anopheles gambi... 65 2e-09
gi|49522038|gb|AAH74594.1| Unknown (protein for MGC:69460) [Xeno... 65 2e-09
gi|46432725|gb|EAK92195.1| hypothetical protein CaO19.6672 [Cand... 65 2e-09
gi|49075818|ref|XP_401947.1| hypothetical protein UM04332.1 [Ust... 65 2e-09
gi|23129421|ref|ZP_00111248.1| COG2214: DnaJ-class molecular cha... 65 2e-09
gi|23501321|ref|NP_697448.1| chaperone protein DnaJ, putative [B... 65 2e-09
gi|17987796|ref|NP_540430.1| CHAPERONE PROTEIN DNAJ [Brucella me... 65 2e-09
gi|42525193|ref|NP_970573.1| DnaJ protein [Bdellovibrio bacterio... 65 2e-09
gi|28871638|ref|NP_794257.1| dnaJ protein [Pseudomonas syringae ... 65 2e-09
gi|9294487|dbj|BAB02706.1| DnaJ homolog [Arabidopsis thaliana] 65 2e-09
gi|33866466|ref|NP_898025.1| DnaJ3 protein [Synechococcus sp. WH... 65 2e-09
gi|32403286|ref|XP_322256.1| hypothetical protein [Neurospora cr... 65 2e-09
gi|46849521|dbj|BAD17849.1| putative chaperone DnaJ [Hydrogenoba... 65 2e-09
gi|47222799|emb|CAG01766.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|421419|pir||A47079 heat shock protein dnaJ - Lactococcus lactis 65 2e-09
gi|15674206|ref|NP_268381.1| DnaJ [Lactococcus lactis subsp. lac... 65 2e-09
gi|21242274|ref|NP_641856.1| DnaJ protein [Xanthomonas axonopodi... 65 2e-09
gi|1352281|sp|P48207|DNAJ_FRATU Chaperone protein dnaJ >gnl|BL_O... 65 2e-09
gi|17563890|ref|NP_504452.1| DNaJ domain (prokaryotic heat shock... 65 2e-09
gi|48787239|ref|ZP_00283321.1| COG2214: DnaJ-class molecular cha... 65 2e-09
gi|27764299|emb|CAD60579.1| unnamed protein product [Podospora a... 65 2e-09
gi|17532583|ref|NP_495340.1| DNaJ domain (prokaryotic heat shock... 65 2e-09
gi|45509936|ref|ZP_00162268.1| COG2214: DnaJ-class molecular cha... 65 2e-09
gi|29466787|dbj|BAC66861.1| heat shock protein DnaJ [Lactobacill... 65 2e-09
gi|22974306|ref|ZP_00020599.1| hypothetical protein [Chloroflexu... 65 2e-09
gi|42526145|ref|NP_971243.1| chaperone protein DnaJ [Treponema d... 65 2e-09
gi|28422719|gb|AAH46954.1| MGC53478 protein [Xenopus laevis] 65 2e-09
gi|17558182|ref|NP_504454.1| DNaJ domain (prokaryotic heat shock... 65 2e-09
gi|15894565|ref|NP_347914.1| Molecular chaperones DnaJ (HSP40 fa... 65 2e-09
gi|50254787|gb|EAL17532.1| hypothetical protein CNBM0990 [Crypto... 65 2e-09
gi|46446102|ref|YP_007467.1| probable heat shock protein dnaJ [P... 65 2e-09
gi|46188193|ref|ZP_00126275.2| COG0484: DnaJ-class molecular cha... 65 2e-09
gi|144832|gb|AAA23247.1| dnaJ 65 2e-09
gi|7498014|pir||T15851 hypothetical protein C56C10.11 - Caenorha... 65 2e-09
gi|30249896|ref|NP_841966.1| DnaJ molecular chaperone [Nitrosomo... 64 3e-09
gi|25458468|pir||T52064 dnaJ-like protein [imported] - rice >gnl... 64 3e-09
gi|14582419|gb|AAK69493.1| heat shock protein DnaJ [Lactococcus ... 64 3e-09
gi|15594862|ref|NP_212651.1| heat shock protein (dnaJ-1) [Borrel... 64 3e-09
gi|33578041|gb|AAQ22347.1| heat shock protein [Pseudomonas stutz... 64 3e-09
gi|32476331|ref|NP_869325.1| DnaJ1 protein [Pirellula sp. 1] >gn... 64 3e-09
gi|45526679|ref|ZP_00177882.1| COG2214: DnaJ-class molecular cha... 64 3e-09
gi|38109579|gb|EAA55428.1| hypothetical protein MG09235.4 [Magna... 64 3e-09
gi|48845784|ref|ZP_00300056.1| COG0484: DnaJ-class molecular cha... 64 3e-09
gi|144000|gb|AAA22948.1| dnaJ homologue 64 3e-09
gi|39589181|emb|CAE57914.1| Hypothetical protein CBG00965 [Caeno... 64 3e-09
gi|19113582|ref|NP_596790.1| DNAJ domain protein similar to huma... 64 3e-09
gi|1354228|gb|AAB01923.1| 16 kDa protein 64 3e-09
gi|4218150|emb|CAA10740.1| DnaJ2 protein [Anabaena variabilis] 64 3e-09
gi|3859851|gb|AAC72887.1| heat shock protein Ddj1 [Dictyostelium... 64 3e-09
gi|143978|gb|AAA22925.1| putative 64 3e-09
gi|477566|pir||A49210 heat shock protein dnaJ - Lyme disease spi... 64 3e-09
gi|47210998|emb|CAF95830.1| unnamed protein product [Tetraodon n... 64 3e-09
gi|50811832|ref|NP_998658.1| similar to DnaJ subfamily A member ... 64 3e-09
gi|48732219|ref|ZP_00265962.1| COG2214: DnaJ-class molecular cha... 64 3e-09
gi|49474890|ref|YP_032931.1| Heat shock protein DnaJ [Bartonella... 64 3e-09
gi|28378659|ref|NP_785551.1| chaperone protein DnaJ [Lactobacill... 64 3e-09
gi|49089298|ref|XP_406375.1| hypothetical protein AN2238.2 [Aspe... 64 3e-09
gi|41409940|ref|NP_962776.1| DnaJ [Mycobacterium avium subsp. pa... 64 3e-09
gi|45531751|ref|ZP_00182781.1| COG0484: DnaJ-class molecular cha... 64 3e-09
gi|9937996|ref|NP_064662.1| DnaJ (Hsp40) homolog, subfamily B, m... 64 3e-09
gi|18420568|ref|NP_568076.1| DNAJ heat shock family protein [Ara... 64 3e-09
gi|7441928|pir||F71623 protein with DnaJ domain PFB0090c - malar... 64 3e-09
gi|19920464|ref|NP_608525.1| CG4164-PA [Drosophila melanogaster]... 64 3e-09
gi|25029183|ref|NP_739237.1| putative heat shock protein DnaJ [C... 64 3e-09
gi|15602605|ref|NP_245677.1| DnaJ [Pasteurella multocida Pm70] >... 64 3e-09
gi|16805018|ref|NP_473047.1| heat shock 40 kDa protein, putative... 64 3e-09
gi|15238746|ref|NP_197315.1| DNAJ heat shock N-terminal domain-c... 64 3e-09
gi|17510335|ref|NP_491084.1| DNaJ domain (prokaryotic heat shock... 64 3e-09
gi|48732394|ref|ZP_00266137.1| COG0484: DnaJ-class molecular cha... 64 3e-09
gi|48103935|ref|XP_395676.1| similar to CG2790-PA [Apis mellifera] 64 3e-09
gi|15230424|ref|NP_187824.1| DNAJ heat shock N-terminal domain-c... 64 3e-09
gi|14091768|ref|NP_114468.1| DnaJ (Hsp40) homolog, subfamily A, ... 64 3e-09
gi|9789937|ref|NP_062768.1| DnaJ (Hsp40) homolog, subfamily A, m... 64 3e-09
gi|5031741|ref|NP_005871.1| DnaJ subfamily A member 2; cell cycl... 64 3e-09
gi|16329714|ref|NP_440442.1| DnaJ protein [Synechocystis sp. PCC... 64 3e-09
gi|41408260|ref|NP_961096.1| DnaJ2 [Mycobacterium avium subsp. p... 64 3e-09
gi|7441920|pir||T06102 heat shock protein T5J17.130, dnaJ-type -... 64 3e-09
gi|38234667|ref|NP_940434.1| chaperone protein cofactor 1 [Coryn... 64 3e-09
gi|46912327|emb|CAG19119.1| putative DnaJ protein, DnaJ-class mo... 64 3e-09
gi|23593261|ref|NP_472947.2| hypothetical protein, conserved [Pl... 64 3e-09
gi|33519590|ref|NP_878422.1| DnaJ protein [Candidatus Blochmanni... 64 3e-09
gi|27667830|ref|XP_221491.1| similar to DnaJ homolog subfamily B... 64 3e-09
gi|27127313|dbj|BAC44984.1| dnaJ [Mycobacterium avium complex] >... 64 3e-09
gi|48847091|ref|ZP_00301349.1| COG2214: DnaJ-class molecular cha... 64 4e-09
gi|20138043|sp|Q9P7C6|CWFN_SCHPO Cell cycle control protein cwf23 64 4e-09
gi|19703466|ref|NP_603028.1| Chaperone protein dnaJ [Fusobacteri... 64 4e-09
gi|31199405|ref|XP_308650.1| ENSANGP00000011260 [Anopheles gambi... 64 4e-09
gi|461943|sp|Q05980|DNAJ_BRUOV Chaperone protein dnaJ >gnl|BL_OR... 64 4e-09
gi|19075357|ref|NP_587857.1| DNAJ protein [Schizosaccharomyces p... 64 4e-09
gi|31236518|ref|XP_319427.1| ENSANGP00000023631 [Anopheles gambi... 64 4e-09
gi|11132455|sp|Q9RUG2|DNAJ_DEIRA Chaperone protein dnaJ 64 4e-09
gi|15679295|ref|NP_276412.1| DnaJ protein [Methanothermobacter t... 64 4e-09
gi|15240212|ref|NP_196308.1| DNAJ heat shock protein, putative (... 64 4e-09
gi|15806441|ref|NP_295147.1| dnaJ protein [Deinococcus radiodura... 64 4e-09
gi|47459320|ref|YP_016182.1| heat shock protein DnaJ [Mycoplasma... 64 4e-09
gi|49475227|ref|YP_033268.1| heat shock protein DnaJ [Bartonella... 64 4e-09
>gi|17554900|ref|NP_497962.1| DNaJ domain (prokaryotic heat shock
protein) (29.3 kD) (dnj-18Co) [Caenorhabditis elegans]
gi|7507060|pir||T24427 hypothetical protein T04A8.9 -
Caenorhabditis elegans
gi|3879343|emb|CAA84728.1| Hypothetical protein T04A8.9
[Caenorhabditis elegans]
Length = 249
Score = 501 bits (1289), Expect = e-141
Identities = 249/249 (100%), Positives = 249/249 (100%)
Frame = +1
Query: 1 MLRLAVANQKRSLFLSVPCSSQQDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNK 180
MLRLAVANQKRSLFLSVPCSSQQDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNK
Sbjct: 1 MLRLAVANQKRSLFLSVPCSSQQDHYKVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTNK 60
Query: 181 EEAAKKFHQVAMAYEILSSEDKRKAYDMTRIRTSPMPNDPSSFSNRYRRRTSSNLKQYTD 360
EEAAKKFHQVAMAYEILSSEDKRKAYDMTRIRTSPMPNDPSSFSNRYRRRTSSNLKQYTD
Sbjct: 61 EEAAKKFHQVAMAYEILSSEDKRKAYDMTRIRTSPMPNDPSSFSNRYRRRTSSNLKQYTD 120
Query: 361 IDIDYKDFEHFQRSTRRRPQYHSHFDMPNEFYAEFGGFKKRVFKSEYEEAQEKHGSMYKD 540
IDIDYKDFEHFQRSTRRRPQYHSHFDMPNEFYAEFGGFKKRVFKSEYEEAQEKHGSMYKD
Sbjct: 121 IDIDYKDFEHFQRSTRRRPQYHSHFDMPNEFYAEFGGFKKRVFKSEYEEAQEKHGSMYKD 180
Query: 541 GRAAQREMEELRRQVEREQAAHQARYPIPTFEQIMRDKRAKEASEARQYMAGMFVTAVIA 720
GRAAQREMEELRRQVEREQAAHQARYPIPTFEQIMRDKRAKEASEARQYMAGMFVTAVIA
Sbjct: 181 GRAAQREMEELRRQVEREQAAHQARYPIPTFEQIMRDKRAKEASEARQYMAGMFVTAVIA 240
Query: 721 GFLTVLLSR 747
GFLTVLLSR
Sbjct: 241 GFLTVLLSR 249