Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T05H10_2
(1191 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531193|ref|NP_495687.1| apurinic/apyrimidinic endonuclease ... 796 0.0
gi|39587818|emb|CAE67836.1| Hypothetical protein CBG13421 [Caeno... 596 e-169
gi|2133453|pir||JC5235 DNA-(apurinic or apyrimidinic site) lyase... 572 e-162
gi|29350059|ref|NP_813562.1| endonuclease IV [Bacteroides thetai... 278 1e-73
gi|23481545|gb|EAA17792.1| AP endonuclease 1 [Plasmodium yoelii ... 275 1e-72
gi|16765533|ref|NP_461148.1| endonuclease IV [Salmonella typhimu... 273 4e-72
gi|48831863|ref|ZP_00288913.1| COG0648: Endonuclease IV [Magneto... 273 6e-72
gi|16761144|ref|NP_456761.1| endonuclease IV [Salmonella enteric... 273 8e-72
gi|50121650|ref|YP_050817.1| endonuclease IV [Erwinia carotovora... 272 1e-71
gi|21673155|ref|NP_661220.1| AP (apurinic or apyrimidinic) endon... 270 5e-71
gi|34558061|ref|NP_907876.1| ENDONUCLEASE IV [Wolinella succinog... 269 8e-71
gi|28897272|ref|NP_796877.1| endonuclease IV [Vibrio parahaemoly... 268 2e-70
gi|27364003|ref|NP_759531.1| Endonuclease IV [Vibrio vulnificus ... 267 3e-70
gi|22126756|ref|NP_670179.1| endonuclease IV [Yersinia pestis KI... 266 5e-70
gi|37678838|ref|NP_933447.1| endonuclease IV [Vibrio vulnificus ... 266 7e-70
gi|37526747|ref|NP_930091.1| endonuclease IV (endodeoxyribonucle... 266 9e-70
gi|23619267|ref|NP_705229.1| apurinic/apyrimidinic endonuclease ... 265 1e-69
gi|26248542|ref|NP_754582.1| Endonuclease IV [Escherichia coli C... 265 2e-69
gi|15076900|gb|AAK82983.1| apurinic/apyrimidinic endonuclease Ap... 265 2e-69
gi|16121588|ref|NP_404901.1| endonuclease IV [Yersinia pestis] >... 265 2e-69
gi|15642357|ref|NP_231990.1| endonuclease IV [Vibrio cholerae O1... 264 3e-69
gi|14278957|dbj|BAB59036.1| DdAPN [Dictyostelium discoideum] 263 6e-69
gi|15802715|ref|NP_288742.1| endonuclease IV [Escherichia coli O... 262 1e-68
gi|405898|gb|AAA60529.1| endonuclease IV [Escherichia coli] >gnl... 262 1e-68
gi|6573704|pdb|1QTW|A Chain A, High-Resolution Crystal Structure... 262 1e-68
gi|15832305|ref|NP_311078.1| endonuclease IV [Escherichia coli O... 262 1e-68
gi|24113546|ref|NP_708056.1| endonuclease IV [Shigella flexneri ... 261 2e-68
gi|146954|gb|AAA24216.1| endonuclease IV 260 4e-68
gi|46227657|gb|EAK88592.1| AP endonuclease of the TIM barrel fol... 259 7e-68
gi|50874942|emb|CAG34782.1| probable endonuclease IV [Desulfotal... 255 1e-66
gi|21672420|ref|NP_660487.1| endonuclease IV [Buchnera aphidicol... 250 4e-65
gi|32035806|ref|ZP_00135650.1| COG0648: Endonuclease IV [Actinob... 249 7e-65
gi|47226126|emb|CAG04500.1| unnamed protein product [Tetraodon n... 249 9e-65
gi|33152191|ref|NP_873544.1| endonuclease IV [Haemophilus ducrey... 248 3e-64
gi|7490448|pir||T41497 DNA (apurinic or apyrimidinic site) lyase... 245 1e-63
gi|50305755|ref|XP_452838.1| unnamed protein product [Kluyveromy... 244 3e-63
gi|15616757|ref|NP_239969.1| endonuclease IV [Buchnera aphidicol... 240 4e-62
gi|38112063|gb|EAA57537.1| hypothetical protein MG10609.4 [Magna... 240 5e-62
gi|32405100|ref|XP_323163.1| hypothetical protein [Neurospora cr... 237 4e-61
gi|50255122|gb|EAL17861.1| hypothetical protein CNBL1230 [Crypto... 237 5e-61
gi|27904631|ref|NP_777757.1| putative endonuclease IV [Buchnera ... 237 5e-61
gi|46912185|emb|CAG18980.1| putative endonuclease IV [Photobacte... 235 1e-60
gi|46108932|ref|XP_381524.1| hypothetical protein FG01348.1 [Gib... 233 7e-60
gi|171068|gb|AAA34429.1| apurinic endonuclease (APN1) 232 1e-59
gi|46437744|gb|EAK97085.1| hypothetical protein CaO19.7428 [Cand... 231 2e-59
gi|45185176|ref|NP_982893.1| ABL054Cp [Eremothecium gossypii] >g... 231 2e-59
gi|6322735|ref|NP_012808.1| major apurinic/apyrimidinic endonucl... 231 3e-59
gi|11066945|gb|AAG28773.1| endonuclease IV [Salmonella typhimurium] 231 3e-59
gi|46445979|ref|YP_007344.1| probable endonuclease IV [Parachlam... 229 7e-59
gi|50292569|ref|XP_448717.1| unnamed protein product [Candida gl... 229 7e-59
gi|19074955|ref|NP_586461.1| DNA LYASE/ENDONUCLEASE 4 [Encephali... 229 7e-59
gi|15618642|ref|NP_224928.1| Endonuclease IV [Chlamydophila pneu... 229 1e-58
gi|50424751|ref|XP_460965.1| unnamed protein product [Debaryomyc... 228 2e-58
gi|50548559|ref|XP_501749.1| hypothetical protein [Yarrowia lipo... 228 3e-58
gi|29839781|ref|NP_828887.1| endonuclease IV [Chlamydophila cavi... 226 6e-58
gi|48429230|sp|P50525|APN1_SCHPO DNA-(apurinic or apyrimidinic s... 226 1e-57
gi|15835527|ref|NP_297286.1| endonuclease IV [Chlamydia muridaru... 220 6e-56
gi|15605356|ref|NP_220142.1| Endonuclease IV [Chlamydia trachoma... 217 5e-55
gi|25289188|pir||T52563 probable DNA-(apurinic or apyrimidinic s... 209 1e-52
gi|19075689|ref|NP_588189.1| DNA (apurinic or apyrimidinic site)... 209 1e-52
gi|23475766|ref|ZP_00131044.1| COG0648: Endonuclease IV [Desulfo... 207 4e-52
gi|49067266|ref|XP_397923.1| hypothetical protein UM00308.1 [Ust... 201 4e-50
gi|22971395|ref|ZP_00018357.1| hypothetical protein [Chloroflexu... 192 1e-47
gi|48845024|ref|ZP_00299314.1| COG0648: Endonuclease IV [Geobact... 189 8e-47
gi|49093246|ref|XP_408084.1| hypothetical protein AN3947.2 [Aspe... 186 1e-45
gi|39995636|ref|NP_951587.1| endonuclease IV [Geobacter sulfurre... 185 2e-45
gi|13541802|ref|NP_111490.1| Endonuclease IV [Thermoplasma volca... 183 8e-45
gi|48852311|ref|ZP_00306499.1| COG0648: Endonuclease IV [Ferropl... 181 2e-44
gi|15606736|ref|NP_214116.1| deoxyribonuclease IV [Aquifex aeoli... 172 1e-41
gi|15643130|ref|NP_228173.1| deoxyribonuclease IV [Thermotoga ma... 161 2e-38
gi|16081940|ref|NP_394350.1| endonuclease IV related protein [Th... 159 2e-37
gi|46579635|ref|YP_010443.1| endonuclease IV [Desulfovibrio vulg... 157 5e-37
gi|13357866|ref|NP_078140.1| endonuclease IV [Ureaplasma parvum ... 154 5e-36
gi|31544574|ref|NP_853152.1| Nfo [Mycoplasma gallisepticum R] >g... 152 1e-35
gi|26553573|ref|NP_757507.1| endonuclease IV [Mycoplasma penetra... 152 2e-35
gi|39931147|sp|Q8EWT2|END4_MYCPE Probable endonuclease IV (Endod... 151 3e-35
gi|23465335|ref|NP_695938.1| probable endonuclease IV [Bifidobac... 149 2e-34
gi|46191217|ref|ZP_00206713.1| COG0648: Endonuclease IV [Bifidob... 148 2e-34
gi|29376286|ref|NP_815440.1| endonuclease IV [Enterococcus faeca... 147 4e-34
gi|48823997|ref|ZP_00285441.1| COG0648: Endonuclease IV [Enteroc... 146 1e-33
gi|23099393|ref|NP_692859.1| endonuclease IV [Oceanobacillus ihe... 145 1e-33
gi|48870714|ref|ZP_00323433.1| COG0648: Endonuclease IV [Pedioco... 143 7e-33
gi|46198790|ref|YP_004457.1| endonuclease IV [Thermus thermophil... 143 9e-33
gi|15613949|ref|NP_242252.1| endonuclease IV [Bacillus haloduran... 142 1e-32
gi|47205664|emb|CAF92394.1| unnamed protein product [Tetraodon n... 142 2e-32
gi|15789493|ref|NP_279317.1| endonuclease IV; XthA [Halobacteriu... 142 2e-32
gi|39938940|ref|NP_950706.1| endonuclease IV [Onion yellows phyt... 141 3e-32
gi|49483806|ref|YP_041030.1| putative endonuclease [Staphylococc... 140 8e-32
gi|16079568|ref|NP_390392.1| yqfS [Bacillus subtilis subsp. subt... 140 8e-32
gi|15924547|ref|NP_372081.1| hypothetical protein SAV1557 [Staph... 139 1e-31
gi|49481293|ref|YP_038343.1| deoxyribonuclease IV, phage T4-indu... 138 2e-31
gi|30264356|ref|NP_846733.1| endonuclease IV [Bacillus anthracis... 138 2e-31
gi|21402331|ref|NP_658316.1| AP_endonulease2, AP endonuclease fa... 138 2e-31
gi|45532177|ref|ZP_00183191.1| COG0648: Endonuclease IV [Exiguob... 138 3e-31
gi|48837107|ref|ZP_00294102.1| COG0648: Endonuclease IV [Thermob... 137 5e-31
gi|12045090|ref|NP_072901.1| endonuclease IV, putative [Mycoplas... 137 6e-31
gi|29832633|ref|NP_827267.1| putative endonuclease IV [Streptomy... 136 1e-30
gi|28378618|ref|NP_785510.1| deoxyribonuclease IV [Lactobacillus... 135 1e-30
gi|30022364|ref|NP_833995.1| Endonuclease IV [Bacillus cereus AT... 135 1e-30
gi|47459383|ref|YP_016245.1| endonuclease IV [Mycoplasma mobile ... 135 2e-30
gi|49235264|ref|ZP_00329335.1| COG0648: Endonuclease IV [Moorell... 135 2e-30
gi|27468162|ref|NP_764799.1| endonuclease IV [Staphylococcus epi... 135 2e-30
gi|16800555|ref|NP_470823.1| similar to endonuclease IV [Listeri... 134 3e-30
gi|16803489|ref|NP_464974.1| similar to endonuclease IV [Listeri... 133 7e-30
gi|47095400|ref|ZP_00233010.1| endonuclease IV [Listeria monocyt... 133 7e-30
gi|13508067|ref|NP_110016.1| endonuclease IV [Mycoplasma pneumon... 133 7e-30
gi|20799559|gb|AAM28547.1| putative endonuclease IV [Tomato big ... 132 1e-29
gi|47567846|ref|ZP_00238554.1| endonuclease IV [Bacillus cereus ... 132 2e-29
gi|46907677|ref|YP_014066.1| endonuclease IV [Listeria monocytog... 132 2e-29
gi|21220589|ref|NP_626368.1| putative endonuclease [Streptomyces... 131 3e-29
gi|15829092|ref|NP_326452.1| ENDONUCLEASE IV (ENDODEOXYRIBONUCLE... 129 1e-28
gi|42783410|ref|NP_980657.1| endonuclease, putative [Bacillus ce... 127 4e-28
gi|50365149|ref|YP_053574.1| endonuclease IV [Mesoplasma florum ... 127 5e-28
gi|42560664|ref|NP_975115.1| endodeoxyribonuclease IV [Mycoplasm... 117 5e-25
gi|45545961|ref|ZP_00186072.1| COG0648: Endonuclease IV [Rubroba... 115 3e-24
gi|48478138|ref|YP_023844.1| endonuclease IV [Picrophilus torrid... 112 1e-23
gi|8809789|gb|AAF79945.1| putative endonuclease IV [Streptomyces... 104 5e-21
gi|47157040|gb|AAT12397.1| DNA lyase/endonuclease 4 [Antonospora... 87 6e-16
gi|6682103|gb|AAF23271.1| probable endonuclease IV [Staphylococc... 87 8e-16
gi|15828008|ref|NP_302271.1| putataive endonuclease IV (apurinas... 81 5e-14
gi|8928097|sp|O86954|END4_THENE Probable endonuclease IV (Endode... 76 2e-12
gi|15607810|ref|NP_215184.1| end [Mycobacterium tuberculosis H37... 75 2e-12
gi|41410230|ref|NP_963066.1| End [Mycobacterium avium subsp. par... 75 4e-12
gi|9631347|ref|NP_048188.1| ORF MSV117 putative DNA polymerase b... 69 3e-10
gi|23007412|ref|ZP_00049293.1| COG0648: Endonuclease IV [Magneto... 66 1e-09
gi|9964524|ref|NP_064992.1| putative DNA polymerase beta/AP endo... 64 5e-09
gi|15898937|ref|NP_343542.1| Endonuclease IV related protein [Su... 59 2e-07
gi|50843670|ref|YP_056897.1| probable endonuclease IV [Propionib... 57 8e-07
gi|18310061|ref|NP_561995.1| conserved hypothetical protein [Clo... 57 8e-07
gi|20807725|ref|NP_622896.1| Endonuclease IV [Thermoanaerobacter... 54 9e-06
gi|9628240|ref|NP_042826.1| AP endonuclease class II [African sw... 50 1e-04
gi|14601844|ref|NP_148385.1| hypothetical protein APE2104 [Aerop... 48 5e-04
gi|48858161|ref|ZP_00312124.1| COG0648: Endonuclease IV [Clostri... 48 5e-04
gi|15679028|ref|NP_276145.1| endonuclease IV [Methanothermobacte... 46 0.001
gi|23112522|ref|ZP_00097995.1| COG0648: Endonuclease IV [Desulfi... 46 0.001
gi|17570471|ref|NP_508081.1| putative protein, with a coiled coi... 45 0.003
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 42 0.022
gi|20092355|ref|NP_618430.1| conserved hypothetical protein [Met... 42 0.037
gi|28211396|ref|NP_782340.1| endonuclease IV [Clostridium tetani... 41 0.063
gi|27227741|emb|CAD59239.1| NAD(+) ADP-ribosyltransferase-3 [Dic... 41 0.063
gi|41614874|ref|NP_963372.1| NEQ077a [Nanoarchaeum equitans Kin4... 41 0.063
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 41 0.063
gi|2072290|gb|AAC60120.1| XL-INCENP [Xenopus laevis] 40 0.082
gi|46142624|ref|ZP_00149373.2| COG0648: Endonuclease IV [Methano... 40 0.082
gi|2495362|sp|Q94738|HS97_STRFN 97 KDA HEAT SHOCK PROTEIN (HEAT ... 40 0.11
gi|28828540|gb|AAO51148.1| similar to Y55B1BR.3.p [Caenorhabditi... 40 0.11
gi|40804952|gb|AAR91744.1| topoisomerase II [Trichomonas vaginalis] 40 0.11
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 40 0.14
gi|220592|dbj|BAA00768.1| ORF2 [Mus musculus] 40 0.14
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 39 0.18
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 39 0.18
gi|32398799|emb|CAD98509.1| putative translation initiation fact... 39 0.18
gi|91833|pir||JX0167 transcription elongation factor S-II-relate... 39 0.18
gi|46229287|gb|EAK90136.1| Fun12p GTpase; translation initiation... 39 0.18
gi|42527584|ref|NP_972682.1| conserved hypothetical protein [Tre... 39 0.24
gi|45439355|ref|NP_958845.1| transcription elongation factor A 1... 39 0.24
gi|19074805|ref|NP_586311.1| hypothetical protein [Encephalitozo... 39 0.24
gi|5803191|ref|NP_006747.1| transcription elongation factor A 1 ... 39 0.24
gi|23491005|gb|EAA22644.1| similar to suppressor of Ty 5 homolog... 39 0.31
gi|15241403|ref|NP_196948.1| surfeit locus 2 protein-related / S... 39 0.31
gi|339443|gb|AAA61138.1| transcription elongation factor SII 39 0.31
gi|38454156|gb|AAR20772.1| At5g14440 [Arabidopsis thaliana] >gnl... 39 0.31
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 39 0.31
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 38 0.41
gi|601931|gb|AAA57153.1| neurofilament-H 38 0.41
gi|24653671|ref|NP_610972.2| CG12864-PA [Drosophila melanogaster... 38 0.41
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ... 38 0.41
gi|15291841|gb|AAK93189.1| LD29301p [Drosophila melanogaster] 38 0.41
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 38 0.41
gi|32403448|ref|XP_322337.1| hypothetical protein [Neurospora cr... 38 0.41
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 38 0.41
gi|4456149|emb|CAB37359.1| PALM [Gallus gallus] 38 0.53
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (... 38 0.53
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR... 38 0.53
gi|22653922|sp|Q9YGL6|PALM_CHICK Paralemmin >gnl|BL_ORD_ID|11606... 38 0.53
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ... 38 0.53
gi|201937|gb|AAA40418.1| transcription factor S-II 38 0.53
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (... 38 0.53
gi|15645662|ref|NP_207839.1| translation initiation factor IF-2 ... 38 0.53
gi|33417081|gb|AAH55988.1| Flj25286-prov protein [Xenopus laevis] 38 0.53
gi|32410313|ref|XP_325637.1| hypothetical protein [Neurospora cr... 38 0.53
gi|34881371|ref|XP_229096.2| similar to heat-shock protein hsp84... 38 0.53
gi|32563639|ref|NP_871800.1| HMG-I and HMG-Y DNA-binding domain ... 38 0.53
gi|6755728|ref|NP_035671.1| transcription elongation factor A (S... 38 0.53
gi|24653978|ref|NP_725510.1| CG18255-PD [Drosophila melanogaster... 37 0.70
gi|17543530|ref|NP_502971.1| zn-finger-like, PHD finger and nucl... 37 0.70
gi|17541964|ref|NP_501983.1| putative nuclear protein family mem... 37 0.70
gi|2980817|emb|CAA82046.1| MNN4 [Saccharomyces cerevisiae] 37 0.70
gi|6322648|ref|NP_012721.1| Putative positive regulator of manno... 37 0.70
gi|24653966|ref|NP_725506.1| CG18255-PA [Drosophila melanogaster... 37 0.70
gi|15221682|ref|NP_173826.1| expressed protein [Arabidopsis thal... 37 0.70
gi|23481000|gb|EAA17411.1| ELM2 domain, putative [Plasmodium yoe... 37 0.70
gi|23509979|ref|NP_702646.1| hypothetical protein [Plasmodium fa... 37 0.70
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain 37 0.70
gi|39584941|emb|CAE64365.1| Hypothetical protein CBG09052 [Caeno... 37 0.70
gi|50732541|ref|XP_418684.1| PREDICTED: similar to PHD finger pr... 37 0.70
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 37 0.91
gi|23507858|ref|NP_700528.1| hypothetical protein [Plasmodium fa... 37 0.91
gi|41615158|ref|NP_963656.1| NEQ368 [Nanoarchaeum equitans Kin4-... 37 0.91
gi|39592294|emb|CAE75515.1| Hypothetical protein CBG23530 [Caeno... 37 0.91
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 37 0.91
gi|11357655|pir||T47281 hypothetical protein F26B15.30 - Arabido... 37 0.91
gi|47206465|emb|CAF94365.1| unnamed protein product [Tetraodon n... 37 0.91
gi|42656220|ref|XP_371542.2| RW1 protein [Homo sapiens] 37 0.91
gi|12230553|sp|Q92545|RW1_HUMAN RW1 protein >gnl|BL_ORD_ID|21219... 37 0.91
gi|50309249|ref|XP_454631.1| unnamed protein product [Kluyveromy... 37 0.91
gi|50291305|ref|XP_448085.1| unnamed protein product [Candida gl... 37 0.91
gi|39581924|emb|CAE72886.1| Hypothetical protein CBG20199 [Caeno... 37 0.91
gi|40074467|gb|AAR39441.1| kinesin family member 12 [Dictyosteli... 37 0.91
gi|24645942|ref|NP_731573.1| CG31374-PB [Drosophila melanogaster... 37 1.2
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 37 1.2
gi|1722855|sp|P50532|SMC4_XENLA Structural maintenance of chromo... 37 1.2
gi|23509114|ref|NP_701782.1| hypothetical protein [Plasmodium fa... 37 1.2
gi|13629976|sp|O77788|NFM_BOVIN Neurofilament triplet M protein ... 37 1.2
gi|46143831|ref|ZP_00133959.2| COG3064: Membrane protein involve... 37 1.2
gi|50750467|ref|XP_422007.1| PREDICTED: hypothetical protein XP_... 37 1.2
gi|23593357|ref|NP_473135.2| erythrocyte membrane protein 1 (PfE... 37 1.2
gi|24645944|ref|NP_731574.1| CG31374-PA [Drosophila melanogaster... 37 1.2
gi|282110|pir||C41859 IgA-specific metalloendopeptidase (EC 3.4.... 37 1.2
gi|15218159|ref|NP_173540.1| eukaryotic translation initiation f... 37 1.2
gi|1170517|sp|P45386|IGA4_HAEIN Immunoglobulin A1 protease precu... 37 1.2
gi|7494351|pir||B71600 variant-specific surface protein 1 homolo... 37 1.2
gi|47221633|emb|CAF97898.1| unnamed protein product [Tetraodon n... 37 1.2
gi|49618963|gb|AAT68066.1| myc-regulated DEAD/H box 18 RNA helic... 37 1.2
gi|15292193|gb|AAK93365.1| LD41932p [Drosophila melanogaster] 37 1.2
gi|21227650|ref|NP_633572.1| conserved protein [Methanosarcina m... 37 1.2
gi|25511650|pir||G86344 T22I11.2 protein - Arabidopsis thaliana ... 37 1.2
gi|15222310|ref|NP_172194.1| Ran-binding protein 1a (RanBP1a) [A... 36 1.6
gi|4885513|ref|NP_005373.1| neurofilament 3 (150kDa medium); neu... 36 1.6
gi|23491276|gb|EAA22854.1| hypothetical protein [Plasmodium yoel... 36 1.6
gi|37523131|ref|NP_926508.1| two-component sensor histidine kina... 36 1.6
gi|7512107|pir||T31659 hypothetical protein COS41.5 - sea squirt... 36 1.6
gi|31239493|ref|XP_320160.1| ENSANGP00000011626 [Anopheles gambi... 36 1.6
gi|23478548|gb|EAA15605.1| AhpC/TSA family, putative [Plasmodium... 36 1.6
gi|50754327|ref|XP_414332.1| PREDICTED: similar to mKIAA0699 pro... 36 1.6
gi|15229884|ref|NP_187157.1| SAR DNA-binding protein, putative [... 36 1.6
gi|47218618|emb|CAG04947.1| unnamed protein product [Tetraodon n... 36 1.6
gi|24020878|gb|AAN40837.1| heavy neurofilament protein [Canis fa... 36 1.6
gi|47575780|ref|NP_001001234.1| hypothetical protein MGC69461 [X... 36 1.6
gi|39580113|emb|CAE56132.1| Hypothetical protein CBG23744 [Caeno... 36 1.6
gi|5106769|gb|AAD39835.1| Ran-binding protein siRanBP [Arabidops... 36 1.6
gi|7489869|pir||T30330 gelsolin-related protein GRP125 - slime m... 36 1.6
gi|26342124|dbj|BAC34724.1| unnamed protein product [Mus musculus] 36 2.0
gi|6679048|ref|NP_032717.1| neurofilament 3, medium; neurofilame... 36 2.0
gi|9631362|ref|NP_048223.1| ORF MSV152 putative core protein P4a... 36 2.0
gi|450734|emb|CAA50842.1| unnamed protein product [African swine... 36 2.0
gi|2664214|emb|CAA10906.1| G2484-1 [Arabidopsis thaliana] 36 2.0
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 36 2.0
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 36 2.0
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 36 2.0
gi|50801336|ref|XP_424168.1| PREDICTED: similar to CBF1 interact... 36 2.0
gi|2133473|pir||A57667 pop-1 protein - Caenorhabditis elegans 36 2.0
gi|50753009|ref|XP_413830.1| PREDICTED: similar to Ubiquitin car... 36 2.0
gi|23481592|gb|EAA17823.1| hypothetical protein [Plasmodium yoel... 36 2.0
gi|19115891|ref|NP_594979.1| putative helicase [Schizosaccharomy... 36 2.0
gi|226213|prf||1501343A neurofilament protein NF-H C term 36 2.0
gi|2498712|sp|Q91628|ORC2_XENLA ORIGIN RECOGNITION COMPLEX SUBUN... 36 2.0
gi|284667|pir||A43427 neurofilament triplet H1 protein - rabbit ... 36 2.0
gi|50730400|ref|XP_416885.1| PREDICTED: similar to RW1 protein [... 36 2.0
gi|2058282|emb|CAA66045.1| atranbp1a [Arabidopsis thaliana] 36 2.0
gi|48838312|ref|ZP_00295257.1| COG0648: Endonuclease IV [Methano... 36 2.0
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 36 2.0
gi|22328747|ref|NP_193464.2| agenet domain-containing protein [A... 36 2.0
gi|7485109|pir||D71442 hypothetical protein - Arabidopsis thalia... 36 2.0
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 36 2.0
gi|28372531|ref|NP_777567.1| protein phosphatase 4, regulatory s... 35 2.6
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 35 2.6
gi|50312991|ref|XP_455895.1| unnamed protein product [Kluyveromy... 35 2.6
gi|23480531|gb|EAA17067.1| mature-parasite-infected erythrocyte ... 35 2.6
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 35 2.6
gi|7512759|pir||T08692 hypothetical protein DKFZp564K112.1 - hum... 35 2.6
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 35 2.6
gi|2127379|pir||JC6032 lactocepin (EC 3.4.21.96) precursor [simi... 35 2.6
gi|40789092|ref|NP_955518.1| expressed sequence AA408556 [Mus mu... 35 2.6
gi|32405064|ref|XP_323145.1| hypothetical protein [Neurospora cr... 35 2.6
gi|49476244|ref|YP_034285.1| Cobalamin biosynthesis protein cobT... 35 2.6
gi|39104494|dbj|BAC65628.3| mKIAA0690 protein [Mus musculus] 35 2.6
gi|496249|gb|AAA92343.1| heat shock protein 90 35 2.6
gi|15678337|ref|NP_275452.1| unknown [Methanothermobacter therma... 35 2.6
gi|50424603|ref|XP_460891.1| unnamed protein product [Debaryomyc... 35 2.6
gi|42779687|ref|NP_976934.1| internalin, putative [Bacillus cere... 35 2.6
gi|21262152|emb|CAD32690.1| SMC4 protein [Oryza sativa] 35 2.6
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 35 2.6
gi|46435305|gb|EAK94689.1| hypothetical protein CaO19.658 [Candi... 35 2.6
gi|46438938|gb|EAK98262.1| hypothetical protein CaO19.3831 [Cand... 35 2.6
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii] 35 2.6
gi|31212781|ref|XP_315375.1| ENSANGP00000021112 [Anopheles gambi... 35 2.6
gi|46435346|gb|EAK94729.1| hypothetical protein CaO19.8274 [Cand... 35 2.6
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 35 2.6
gi|28850293|gb|AAM45317.2| similar to Required for the transfer ... 35 2.6
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 35 2.6
gi|48841023|ref|ZP_00297949.1| COG0810: Periplasmic protein TonB... 35 3.5
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_... 35 3.5
gi|2905649|gb|AAC03547.1| cytoplasmic linker protein CLIP-170 [G... 35 3.5
gi|23508881|ref|NP_701549.1| Formin 2, putative [Plasmodium falc... 35 3.5
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 35 3.5
gi|15607012|ref|NP_214394.1| initiation factor IF-2 [Aquifex aeo... 35 3.5
gi|17555060|ref|NP_499812.1| thrombospondin type 3 repeat (3O709... 35 3.5
gi|50543690|ref|XP_500011.1| hypothetical protein [Yarrowia lipo... 35 3.5
gi|31229237|ref|XP_318188.1| ENSANGP00000016247 [Anopheles gambi... 35 3.5
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 35 3.5
gi|38079996|ref|XP_287445.2| expressed sequence AF013969 [Mus mu... 35 3.5
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 35 3.5
gi|42524061|ref|NP_969441.1| putative serine/threonine protein p... 35 3.5
gi|23508762|ref|NP_701430.1| hypothetical protein [Plasmodium fa... 35 3.5
gi|18378735|ref|NP_055625.2| centrosome-associated protein 350 [... 35 3.5
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [... 35 3.5
gi|23488745|gb|EAA21389.1| hypothetical protein [Plasmodium yoel... 35 3.5
gi|33604014|gb|AAH56232.1| Expressed sequence AA408556 [Mus musc... 35 3.5
gi|34853159|ref|XP_342401.1| similar to hypothetical protein [Ra... 35 3.5
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 35 3.5
gi|39581836|emb|CAE60729.1| Hypothetical protein CBG04407 [Caeno... 35 3.5
gi|14520575|ref|NP_126050.1| chromosome segregation protein smc1... 35 3.5
gi|39595358|emb|CAE60395.1| Hypothetical protein CBG03997 [Caeno... 35 3.5
gi|27924176|gb|AAH44964.1| Epb4.1l3 protein [Xenopus laevis] 35 3.5
gi|31043812|emb|CAB03350.3| Hypothetical protein T12D8.9 [Caenor... 35 3.5
gi|7513594|pir||T03730 antigen containing epitope to monoclonal ... 35 3.5
gi|423125|pir||S34159 transcription elongation factor IIS - huma... 35 3.5
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 35 3.5
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 35 4.5
gi|7510243|pir||T31639 hypothetical protein Y57A10A.q - Caenorha... 35 4.5
gi|17537603|ref|NP_496595.1| splicing coactivator SRm300 like (4... 35 4.5
gi|28564097|gb|AAO32427.1| SMY2 [Saccharomyces bayanus] 35 4.5
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo... 35 4.5
gi|27734072|ref|NP_775552.1| RIKEN cDNA 2810411A03 [Mus musculus... 35 4.5
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 35 4.5
gi|16799701|ref|NP_469969.1| lin0626 [Listeria innocua Clip11262... 35 4.5
gi|42520333|ref|NP_966248.1| hypothetical protein WD0462 [Wolbac... 35 4.5
gi|14165456|ref|NP_114399.1| microtubule-associated protein 1B i... 35 4.5
gi|50740540|ref|XP_444655.1| PREDICTED: heat shock protein 90 be... 35 4.5
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 35 4.5
gi|46133229|ref|ZP_00156849.2| COG3468: Type V secretory pathway... 35 4.5
gi|23023781|ref|ZP_00063012.1| hypothetical protein [Leuconostoc... 35 4.5
gi|23487197|gb|EAA20995.1| hypothetical protein [Plasmodium yoel... 35 4.5
gi|46227587|gb|EAK88522.1| predicted secreted protein, signal pe... 35 4.5
gi|39581985|emb|CAE73847.1| Hypothetical protein CBG21421 [Caeno... 35 4.5
gi|28481944|ref|XP_127961.3| RIKEN cDNA 9930116P15 [Mus musculus] 35 4.5
gi|31239145|ref|XP_319986.1| ENSANGP00000005315 [Anopheles gambi... 35 4.5
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 35 4.5
gi|27368084|gb|AAN86963.1| retinitis pigmentosa 1-like 1 protein... 35 4.5
gi|28301672|emb|CAD36957.1| retinitis pigmentosa 1-like protein ... 35 4.5
gi|19114287|ref|NP_593375.1| hypothetical coiled-coil protein [S... 35 4.5
gi|416562|sp|P32251|A2AR_CARAU Alpha-2 adrenergic receptor (Alph... 35 4.5
gi|28564139|gb|AAO32448.1| MNN4 [Saccharomyces bayanus] 35 4.5
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 35 4.5
gi|34785789|gb|AAH57486.1| Atrxl protein [Danio rerio] 35 4.5
gi|7510239|pir||T31635 hypothetical protein Y57A10A.m - Caenorha... 35 4.5
gi|5174525|ref|NP_005900.1| microtubule-associated protein 1B is... 35 4.5
gi|48106226|ref|XP_396069.1| similar to ENSANGP00000021516 [Apis... 35 4.5
gi|46435553|gb|EAK94932.1| hypothetical protein CaO19.7742 [Cand... 35 4.5
gi|39583086|emb|CAE60626.1| Hypothetical protein CBG04269 [Caeno... 35 4.5
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 35 4.5
gi|50742552|ref|XP_419673.1| PREDICTED: similar to A-kinase anch... 35 4.5
gi|25518567|pir||E86336 hypothetical protein F14O10.11 - Arabido... 35 4.5
gi|23002778|ref|ZP_00046451.1| hypothetical protein [Lactobacill... 35 4.5
gi|42559826|sp|Q8IWN7|RPL1_HUMAN Retinitis pigmentosa 1-like 1 p... 35 4.5
gi|40255278|ref|NP_849188.3| retinitis pigmentosa 1-like 1 [Homo... 35 4.5
gi|48095605|ref|XP_392327.1| similar to vacuolar protein sorting... 34 5.9
gi|42407269|dbj|BAD10851.1| lymphoid specific helicase variant8 ... 34 5.9
gi|26000368|gb|AAN75480.1| dentin matrix protein 1 [Centurio senex] 34 5.9
gi|41054653|ref|NP_955859.1| transcriptional regulator protein; ... 34 5.9
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi... 34 5.9
gi|12007268|gb|AAG45105.1| gravin-like [Xenopus laevis] 34 5.9
gi|49257012|dbj|BAD24804.1| lymphoid specific helicase variant9 ... 34 5.9
gi|40786817|gb|AAR89918.1| RTN3-A [Rattus norvegicus] 34 5.9
gi|47214430|emb|CAF95765.1| unnamed protein product [Tetraodon n... 34 5.9
gi|23612820|ref|NP_704359.1| hypothetical protein [Plasmodium fa... 34 5.9
gi|50420683|ref|XP_458878.1| unnamed protein product [Debaryomyc... 34 5.9
gi|23478773|gb|EAA15769.1| ATPase, P-type, HAD superfamily, subf... 34 5.9
gi|47604960|ref|NP_996842.1| heat shock protein 90 beta [Gallus ... 34 5.9
gi|38090181|ref|XP_135176.3| similar to huntingtin interacting p... 34 5.9
gi|46436859|gb|EAK96215.1| hypothetical protein CaO19.7197 [Cand... 34 5.9
gi|50511077|dbj|BAD32524.1| mKIAA1732 protein [Mus musculus] 34 5.9
gi|50289049|ref|XP_446954.1| unnamed protein product [Candida gl... 34 5.9
gi|46229415|gb|EAK90233.1| membrane protein with multiple cystei... 34 5.9
gi|47223210|emb|CAG11345.1| unnamed protein product [Tetraodon n... 34 5.9
gi|18146874|dbj|BAB82492.1| nucleolar protein [Asterina pectinif... 34 5.9
gi|39581569|emb|CAE58354.1| Hypothetical protein CBG01475 [Caeno... 34 5.9
gi|6996614|dbj|BAA90827.1| nucleic acid-associated protein 36 [A... 34 5.9
gi|42407259|dbj|BAD10846.1| lymphoid specific helicase variant3 ... 34 5.9
gi|46906291|ref|YP_012680.1| conserved hypothetical protein [Lis... 34 5.9
gi|23485824|gb|EAA20589.1| Formin Homology 2 Domain, putative [P... 34 5.9
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 34 5.9
gi|42407261|dbj|BAD10847.1| lymphoid specific helicase variant4 ... 34 5.9
gi|50841951|ref|YP_055178.1| putative myo-inositol catabolism pr... 34 5.9
gi|48697020|ref|YP_025017.1| hypothetical protein B124 [Sulfolob... 34 5.9
gi|26996665|gb|AAH41019.1| Similar to hypothetical protein LOC21... 34 5.9
gi|13235475|emb|CAC33634.1| hypothetical protein [Rickettsia mon... 34 5.9
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 34 5.9
gi|8922438|ref|NP_060571.1| cell division cycle associated 8; bo... 34 5.9
gi|16877392|gb|AAH16944.1| Cell division cycle associated 8 [Hom... 34 5.9
gi|26338325|dbj|BAC32848.1| unnamed protein product [Mus musculus] 34 5.9
gi|21914927|ref|NP_060533.2| helicase, lymphoid-specific; prolif... 34 5.9
gi|47077355|dbj|BAD18566.1| unnamed protein product [Homo sapiens] 34 5.9
gi|37748162|gb|AAH59049.1| BC031601 protein [Mus musculus] 34 5.9
gi|15218382|ref|NP_177360.1| SEC14 cytosolic factor family prote... 34 5.9
gi|1083273|pir||A55817 cyclin-dependent kinase p130-PITSLRE - mo... 34 5.9
gi|50556978|ref|XP_505897.1| hypothetical protein [Yarrowia lipo... 34 5.9
gi|49257014|dbj|BAD24805.1| lymphoid specific helicase variant10... 34 5.9
gi|17505635|ref|NP_491917.1| putative nuclear protein, with 2 co... 34 5.9
gi|42407263|dbj|BAD10848.1| lymphoid specific helicase variant5 ... 34 5.9
gi|46228298|gb|EAK89197.1| hypothetical protein with signal pept... 34 5.9
gi|42407267|dbj|BAD10850.1| lymphoid specific helicase variant7 ... 34 5.9
gi|14917064|sp|O75069|Y481_HUMAN Hypothetical protein KIAA0481 (... 34 5.9
gi|23485809|gb|EAA20583.1| hypothetical protein [Plasmodium yoel... 34 5.9
gi|20089175|ref|NP_615250.1| conserved hypothetical protein [Met... 34 5.9
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 34 5.9
gi|49095256|ref|XP_409089.1| hypothetical protein AN4952.2 [Aspe... 34 5.9
gi|28372521|ref|NP_055673.1| cerebral protein 11 [Homo sapiens] ... 34 5.9
gi|46981263|gb|AAT07581.1| putative SMC protein [Oryza sativa (j... 34 5.9
gi|42407265|dbj|BAD10849.1| lymphoid specific helicase variant6 ... 34 5.9
gi|39591773|emb|CAE71351.1| Hypothetical protein CBG18254 [Caeno... 34 5.9
gi|19704348|ref|NP_603910.1| Hypothetical protein [Fusobacterium... 34 5.9
gi|50761789|ref|XP_424837.1| PREDICTED: similar to transmembrane... 34 7.7
gi|17556242|ref|NP_497198.1| chromo domain containing protein (7... 34 7.7
gi|28571214|ref|NP_727928.2| CG32580-PA [Drosophila melanogaster... 34 7.7
gi|6323204|ref|NP_013276.1| major low affinity 55 kDa Centromere... 34 7.7
gi|23613089|ref|NP_703411.1| hypothetical protein [Plasmodium fa... 34 7.7
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 34 7.7
gi|46437976|gb|EAK97314.1| hypothetical protein CaO19.5241 [Cand... 34 7.7
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens] 34 7.7
gi|38080839|ref|XP_358982.1| similar to endonuclease/reverse tra... 34 7.7
gi|46438039|gb|EAK97376.1| hypothetical protein CaO19.12706 [Can... 34 7.7
gi|9631760|ref|NP_048539.1| Lys, Arg-rich [Paramecium bursaria C... 34 7.7
gi|4506813|ref|NP_002968.1| sodium channel, voltage-gated, type ... 34 7.7
gi|47077439|dbj|BAD18607.1| unnamed protein product [Homo sapiens] 34 7.7
gi|17556268|ref|NP_499557.1| putative nuclear protein, with 6 co... 34 7.7
gi|12247459|gb|AAG49891.1| urea transporter [Alcolapia grahami] 34 7.7
gi|246049|gb|AAB21495.1| neurofilament protein M [rats, Peptide ... 34 7.7
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 34 7.7
gi|39580106|emb|CAE56125.1| Hypothetical protein CBG23734 [Caeno... 34 7.7
gi|586126|sp|P37915|TSAK_RICTS 56 KD TYPE-SPECIFIC ANTIGEN PRECU... 34 7.7
gi|30842037|gb|AAP35087.1| 56 kilodalton type-specific antigen p... 34 7.7
gi|38090882|ref|XP_137067.5| similar to mKIAA1927 protein [Mus m... 34 7.7
gi|7507640|pir||T24806 hypothetical protein T10G3.5 - Caenorhabd... 34 7.7
gi|2498203|sp|Q27976|CALD_BOVIN Non-muscle caldesmon (CDM) (L-ca... 34 7.7
gi|25150872|ref|NP_506347.2| similar to early endosome-associate... 34 7.7
gi|482393|pir||A45669 neurofilament triplet M protein - rat >gnl... 34 7.7
gi|8393823|ref|NP_058725.1| neurofilament 3, medium; Neurofilame... 34 7.7
gi|27806279|ref|NP_776683.1| caldesmon, smooth muscle [Bos tauru... 34 7.7
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 34 7.7
gi|41615030|ref|NP_963528.1| NEQ236 [Nanoarchaeum equitans Kin4-... 34 7.7
gi|15240555|ref|NP_200377.1| expressed protein [Arabidopsis thal... 34 7.7
gi|23508723|ref|NP_701391.1| hypothetical protein, conserved [Pl... 34 7.7
gi|15644749|ref|NP_206919.1| hypothetical protein HP0119 [Helico... 34 7.7
gi|32418170|ref|XP_329563.1| hypothetical protein [Neurospora cr... 34 7.7
gi|31982906|ref|NP_116255.2| hypothetical protein FLJ14957 [Homo... 34 7.7
gi|9758600|dbj|BAB09233.1| unnamed protein product [Arabidopsis ... 34 7.7
gi|46442260|gb|EAL01551.1| hypothetical protein CaO19.7104 [Cand... 34 7.7
gi|42733859|gb|AAS38777.1| similar to Plasmodium falciparum (iso... 34 7.7
gi|128150|sp|P12839|NFM_RAT Neurofilament triplet M protein (160... 34 7.7
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin... 34 7.7
gi|8163689|gb|AAF73803.1| surface protein PspC [Streptococcus pn... 34 7.7
gi|28829008|gb|AAO51583.1| similar to Cryptosporidium parvum. Ty... 34 7.7
gi|17510559|ref|NP_490891.1| probable atp-dependent rna helicase... 34 7.7
gi|505100|dbj|BAA06684.1| KIAA0066 [Homo sapiens] 34 7.7
gi|31874139|emb|CAD97978.1| hypothetical protein [Homo sapiens] 34 7.7
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd... 34 7.7
gi|19705263|ref|NP_602758.1| Hypothetical protein [Fusobacterium... 34 7.7
gi|48139637|ref|XP_393470.1| similar to ENSANGP00000021735 [Apis... 34 7.7
gi|50259202|gb|EAL21875.1| hypothetical protein CNBC0160 [Crypto... 34 7.7
gi|2315159|emb|CAB09575.1| caldesmon [Bos taurus] 34 7.7
gi|3978441|gb|AAC83664.1| PITSLRE protein kinase alpha SV9 isofo... 34 7.7
gi|45188246|ref|NP_984469.1| ADR373Wp [Eremothecium gossypii] >g... 34 7.7
gi|27371004|gb|AAH40746.1| BC018347 protein [Mus musculus] 34 7.7
gi|47230685|emb|CAF99878.1| unnamed protein product [Tetraodon n... 34 7.7
gi|38110219|gb|EAA55974.1| hypothetical protein MG01625.4 [Magna... 34 7.7
gi|13471121|ref|NP_102690.1| rhizopine catabolism protein modC [... 34 7.7
gi|18606161|gb|AAH22977.1| Unknown (protein for IMAGE:4997762) [... 34 7.7
gi|15242667|ref|NP_198850.1| PWWP domain-containing protein [Ara... 34 7.7
gi|50730570|ref|XP_425582.1| PREDICTED: similar to Eukaryotic tr... 34 7.7
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 34 7.7
>gi|17531193|ref|NP_495687.1| apurinic/apyrimidinic endonuclease (44.7
kD) (apn-1) [Caenorhabditis elegans]
gi|20141264|sp|Q10002|APN1_CAEEL DNA-(Apurinic or apyrimidinic site)
lyase (AP endonuclease) (Apurinic-apyrimidinic
endonuclease)
gi|15718251|emb|CAA87789.2| Hypothetical protein T05H10.2
[Caenorhabditis elegans]
Length = 396
Score = 796 bits (2055), Expect = 0.0
Identities = 396/396 (100%), Positives = 396/396 (100%)
Frame = +1
Query: 1 MANKKVTFREDVKSPAIRKLKQKLTPLKIKKGRGKIQKHIQKTLQKMKEEEESENQSPGT 180
MANKKVTFREDVKSPAIRKLKQKLTPLKIKKGRGKIQKHIQKTLQKMKEEEESENQSPGT
Sbjct: 1 MANKKVTFREDVKSPAIRKLKQKLTPLKIKKGRGKIQKHIQKTLQKMKEEEESENQSPGT 60
Query: 181 TVEETLTEENISTDKEETSKLENKPKKTRKTSGETIAQKKSRETVGVEVLKTSEGSSKML 360
TVEETLTEENISTDKEETSKLENKPKKTRKTSGETIAQKKSRETVGVEVLKTSEGSSKML
Sbjct: 61 TVEETLTEENISTDKEETSKLENKPKKTRKTSGETIAQKKSRETVGVEVLKTSEGSSKML 120
Query: 361 GFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLD 540
GFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLD
Sbjct: 121 GFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLD 180
Query: 541 QIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMT 720
QIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMT
Sbjct: 181 QIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMT 240
Query: 721 TIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIF 900
TIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIF
Sbjct: 241 TIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIF 300
Query: 901 AGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAF 1080
AGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAF
Sbjct: 301 AGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAF 360
Query: 1081 ELLMNDNRLDGIPMILETPEGKYPEEMMIMYNMDKR 1188
ELLMNDNRLDGIPMILETPEGKYPEEMMIMYNMDKR
Sbjct: 361 ELLMNDNRLDGIPMILETPEGKYPEEMMIMYNMDKR 396