Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T07C4_5
(393 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554972|ref|NP_499285.1| transthyretin-like family member (1... 259 7e-69
gi|39580122|emb|CAE56793.1| Hypothetical protein CBG24605 [Caeno... 243 6e-64
gi|482224|pir||S41018 hypothetical protein T07C4.5 - Caenorhabdi... 202 9e-52
gi|39593698|emb|CAE61990.1| Hypothetical protein CBG05998 [Caeno... 145 2e-34
gi|17542886|ref|NP_502060.1| transthyretin-like family member (1... 144 3e-34
gi|39593699|emb|CAE61991.1| Hypothetical protein CBG05999 [Caeno... 141 3e-33
gi|39593697|emb|CAE61989.1| Hypothetical protein CBG05997 [Caeno... 140 4e-33
gi|17542888|ref|NP_502061.1| transthyretin-like precursor family... 137 6e-32
gi|433175|gb|AAA20079.1| unknown [Caenorhabditis elegans] 79 7e-31
gi|39585731|emb|CAE59933.1| Hypothetical protein CBG03419 [Caeno... 71 4e-12
gi|17559006|ref|NP_506352.1| transthyretin-like protein precurso... 71 6e-12
gi|25395550|pir||D88131 protein F10G7.10 [imported] - Caenorhabd... 70 7e-12
gi|32564269|ref|NP_871961.1| transthyretin-like precursor family... 70 7e-12
gi|39583097|emb|CAE60637.1| Hypothetical protein CBG04281 [Caeno... 69 3e-11
gi|17538432|ref|NP_501831.1| esophageal gland cell secretory pro... 68 5e-11
gi|17554602|ref|NP_498657.1| esophageal gland cell secretory pro... 68 5e-11
gi|17554032|ref|NP_499203.1| esophageal gland cell secretory pro... 67 8e-11
gi|39590717|emb|CAE65087.1| Hypothetical protein CBG09945 [Caeno... 67 1e-10
gi|39582018|emb|CAE64449.1| Hypothetical protein CBG09156 [Caeno... 64 7e-10
gi|39594954|emb|CAE70822.1| Hypothetical protein CBG17593 [Caeno... 64 9e-10
gi|39590716|emb|CAE65086.1| Hypothetical protein CBG09944 [Caeno... 64 9e-10
gi|39592956|emb|CAE62570.1| Hypothetical protein CBG06683 [Caeno... 63 1e-09
gi|17569623|ref|NP_509801.1| esophageal gland cell secretory pro... 63 1e-09
gi|17564046|ref|NP_505561.1| transthyretin-like precursor family... 63 1e-09
gi|17554030|ref|NP_499202.1| esophageal gland cell secretory pro... 61 4e-09
gi|39594706|emb|CAE72285.1| Hypothetical protein CBG19413 [Caeno... 61 4e-09
gi|39587695|emb|CAE58633.1| Hypothetical protein CBG01801 [Caeno... 60 8e-09
gi|39590863|emb|CAE65237.1| Hypothetical protein CBG10120 [Caeno... 60 8e-09
gi|17552590|ref|NP_499054.1| esophageal gland cell secretory pro... 60 1e-08
gi|17553322|ref|NP_499198.1| esophageal gland cell secretory pro... 60 1e-08
gi|39594900|emb|CAE70768.1| Hypothetical protein CBG17519 [Caeno... 60 1e-08
gi|39587696|emb|CAE58634.1| Hypothetical protein CBG01802 [Caeno... 59 2e-08
gi|17567255|ref|NP_509098.1| esophageal gland cell secretory pro... 59 3e-08
gi|17568287|ref|NP_509839.1| esophageal gland cell secretory pro... 58 4e-08
gi|17557970|ref|NP_506149.1| predicted CDS, esophageal gland cel... 58 5e-08
gi|17554598|ref|NP_498658.1| esophageal gland cell secretory pro... 57 6e-08
gi|39586715|emb|CAE65757.1| Hypothetical protein CBG10846 [Caeno... 57 8e-08
gi|17570123|ref|NP_509110.1| esophageal gland cell secretory pro... 57 8e-08
gi|17565986|ref|NP_507628.1| esophageal gland cell secretory pro... 57 1e-07
gi|39585858|emb|CAE61272.1| Hypothetical protein CBG05087 [Caeno... 57 1e-07
gi|32699206|gb|AAP82637.2| Hypothetical protein T19C3.9 [Caenorh... 56 1e-07
gi|39582017|emb|CAE64448.1| Hypothetical protein CBG09155 [Caeno... 56 2e-07
gi|39581094|emb|CAE73172.1| Hypothetical protein CBG20568 [Caeno... 56 2e-07
gi|17541148|ref|NP_502549.1| transthyretin-like precursor family... 56 2e-07
gi|30145695|emb|CAB05225.2| Hypothetical protein JC8.8 [Caenorha... 56 2e-07
gi|39595914|emb|CAE67417.1| Hypothetical protein CBG12905 [Caeno... 55 3e-07
gi|12958839|gb|AAK09442.1| transthyretin-like precursor protein ... 55 4e-07
gi|39595913|emb|CAE67416.1| Hypothetical protein CBG12904 [Caeno... 54 7e-07
gi|34555938|emb|CAA93097.2| Hypothetical protein T14G10.3 [Caeno... 53 1e-06
gi|7497156|pir||T34396 hypothetical protein C37C3.7 - Caenorhabd... 53 2e-06
gi|32567064|ref|NP_872192.1| transthyretin-like family member (1... 53 2e-06
gi|17559198|ref|NP_505424.1| transthyretin-like protein family m... 52 2e-06
gi|17563210|ref|NP_506225.1| esophageal gland cell secretory pro... 52 4e-06
gi|17565988|ref|NP_507629.1| esophageal gland cell secretory pro... 52 4e-06
gi|8571913|gb|AAF76925.1| hypothetical esophageal gland cell sec... 51 5e-06
gi|39595911|emb|CAE67414.1| Hypothetical protein CBG12902 [Caeno... 51 5e-06
gi|39593252|emb|CAE64722.1| Hypothetical protein CBG09508 [Caeno... 51 6e-06
gi|25153261|ref|NP_509240.2| esophageal gland cell secretory pro... 51 6e-06
gi|39586832|emb|CAE65875.1| Hypothetical protein CBG11024 [Caeno... 50 8e-06
gi|39592297|emb|CAE75518.1| Hypothetical protein CBG23536 [Caeno... 50 8e-06
gi|39597265|emb|CAE59493.1| Hypothetical protein CBG02878 [Caeno... 49 2e-05
gi|39596200|emb|CAE69837.1| Hypothetical protein CBG16161 [Caeno... 49 2e-05
gi|17565990|ref|NP_507630.1| esophageal gland cell secretory pro... 49 2e-05
gi|7495983|pir||T19280 hypothetical protein C14C10.2 - Caenorhab... 49 2e-05
gi|39593294|emb|CAE64764.1| Hypothetical protein CBG09554 [Caeno... 49 2e-05
gi|39590715|emb|CAE65085.1| Hypothetical protein CBG09943 [Caeno... 49 3e-05
gi|17554036|ref|NP_499204.1| esophageal gland cell secretory pro... 48 5e-05
gi|39592496|emb|CAE63573.1| Hypothetical protein CBG08061 [Caeno... 47 7e-05
gi|39593250|emb|CAE64720.1| Hypothetical protein CBG09506 [Caeno... 47 1e-04
gi|17567233|ref|NP_508245.1| esophageal gland cell secretory pro... 47 1e-04
gi|17531297|ref|NP_496453.1| esophageal gland cell secretory pro... 47 1e-04
gi|17557822|ref|NP_505630.1| esophageal gland cell secretory pro... 46 2e-04
gi|17542426|ref|NP_501856.1| transthyretin-like family member (4... 45 3e-04
gi|17563836|ref|NP_506068.1| esophageal gland cell secretory pro... 45 3e-04
gi|39585718|emb|CAE59920.1| Hypothetical protein CBG03406 [Caeno... 45 4e-04
gi|39578799|emb|CAE57118.1| Hypothetical protein CBG25028 [Caeno... 45 4e-04
gi|17563214|ref|NP_506227.1| esophageal gland cell secretory pro... 44 7e-04
gi|17538966|ref|NP_501683.1| transthyretin-like precursor family... 44 7e-04
gi|25513697|pir||G89567 protein T08A9.2 [imported] - Caenorhabdi... 44 0.001
gi|34555933|emb|CAA92798.2| Hypothetical protein C33A12.15 [Caen... 44 0.001
gi|39586145|emb|CAE69221.1| Hypothetical protein CBG15261 [Caeno... 43 0.001
gi|39580359|emb|CAE61464.1| Hypothetical protein CBG05356 [Caeno... 43 0.001
gi|17570587|ref|NP_508666.1| esophageal gland cell secretory pro... 42 0.002
gi|39590484|emb|CAE66224.1| Hypothetical protein CBG11466 [Caeno... 42 0.002
gi|17540186|ref|NP_500522.1| esophageal gland cell secretory pro... 42 0.003
gi|17563212|ref|NP_506226.1| esophageal gland cell secretory pro... 42 0.004
gi|17559434|ref|NP_506433.1| esophageal gland cell secretory pro... 42 0.004
gi|17565714|ref|NP_507986.1| predicted CDS, transthyretin-like f... 40 0.014
gi|17553050|ref|NP_499767.1| transthyretin-like (3O495) [Caenorh... 39 0.024
gi|39597799|emb|CAE68491.1| Hypothetical protein CBG14296 [Caeno... 38 0.040
gi|39593251|emb|CAE64721.1| Hypothetical protein CBG09507 [Caeno... 37 0.12
gi|17564528|ref|NP_505717.1| esophageal gland cell secretory pro... 36 0.20
gi|39594584|emb|CAE72162.1| Hypothetical protein CBG19262 [Caeno... 35 0.26
gi|39594470|emb|CAE72048.1| Hypothetical protein CBG19132 [Caeno... 35 0.34
gi|39589073|emb|CAE57805.1| Hypothetical protein CBG00829 [Caeno... 35 0.34
gi|7499685|pir||T32066 hypothetical protein F22E5.7 - Caenorhabd... 35 0.34
gi|17533425|ref|NP_494316.1| putative secreted or extracellular ... 35 0.34
gi|7494376|pir||E71622 probable membrane associated protein PFB0... 34 0.58
gi|39585348|emb|CAE61670.1| Hypothetical protein CBG05612 [Caeno... 34 0.58
gi|4503681|ref|NP_003881.1| Fc fragment of IgG binding protein; ... 34 0.58
gi|23593265|ref|NP_472954.2| hypothetical protein [Plasmodium fa... 34 0.58
gi|39580788|emb|CAE58957.1| Hypothetical protein CBG02225 [Caeno... 34 0.58
gi|5080756|gb|AAD39266.1| Human Fc gamma BP [AA 1-2843] [Homo sa... 34 0.58
gi|39594705|emb|CAE72284.1| Hypothetical protein CBG19412 [Caeno... 34 0.76
gi|50547367|ref|XP_501153.1| hypothetical protein [Yarrowia lipo... 32 2.9
gi|50746317|ref|XP_420440.1| PREDICTED: similar to LPS-responsiv... 32 3.8
gi|39591076|emb|CAE58856.1| Hypothetical protein CBG02081 [Caeno... 32 3.8
gi|15613276|ref|NP_241579.1| ABC transporter (ATP-binding protei... 31 4.9
gi|15902416|ref|NP_357966.1| Seryl-tRNA synthetase [Streptococcu... 31 4.9
gi|30173153|sp|Q8DR22|SYS_STRR6 Seryl-tRNA synthetase (Serine--t... 31 4.9
gi|15900330|ref|NP_344934.1| seryl-tRNA synthetase [Streptococcu... 31 4.9
gi|46908931|ref|YP_015320.1| ABC transporter, ATP-binding/permea... 31 4.9
gi|47095552|ref|ZP_00233161.1| ABC transporter, ATP-binding/perm... 31 4.9
gi|16804782|ref|NP_466267.1| similar to ABC transporter (ATP-bin... 31 4.9
gi|16801948|ref|NP_472216.1| similar to ABC transporter (ATP-bin... 31 4.9
gi|34870380|ref|XP_341035.1| similar to RIKEN cDNA 2700038I16 [R... 31 6.5
gi|15603166|ref|NP_246239.1| unknown [Pasteurella multocida Pm70... 30 8.4
gi|39594755|emb|CAE70623.1| Hypothetical protein CBG17307 [Caeno... 30 8.4
gi|18312864|ref|NP_559531.1| paREP2b [Pyrobaculum aerophilum str... 30 8.4
>gi|17554972|ref|NP_499285.1| transthyretin-like family member (14.5
kD) (3L429) [Caenorhabditis elegans]
gi|21542313|sp|Q22288|YNS5_CAEEL Hypothetical UPF0205 protein
T07C4.5 protein in chromosome III precursor
gi|25335960|pir||A88579 protein T07C4.5 [imported] - Caenorhabditis
elegans
gi|3879512|emb|CAA82574.1| Hypothetical protein T07C4.5
[Caenorhabditis elegans]
Length = 130
Score = 259 bits (663), Expect = 7e-69
Identities = 130/130 (100%), Positives = 130/130 (100%)
Frame = +1
Query: 1 MRALLFTSVVLLALAFVEAKKQTITVKGTTICNKKRIQAEVTLWEKDTLDPDDKLASMQS 180
MRALLFTSVVLLALAFVEAKKQTITVKGTTICNKKRIQAEVTLWEKDTLDPDDKLASMQS
Sbjct: 1 MRALLFTSVVLLALAFVEAKKQTITVKGTTICNKKRIQAEVTLWEKDTLDPDDKLASMQS 60
Query: 181 NKEGEFSLTGSDDEITSISPYLIITHNCNVKKAGCKRVSEYLIPKEKIGGTYDMTYVTLD 360
NKEGEFSLTGSDDEITSISPYLIITHNCNVKKAGCKRVSEYLIPKEKIGGTYDMTYVTLD
Sbjct: 61 NKEGEFSLTGSDDEITSISPYLIITHNCNVKKAGCKRVSEYLIPKEKIGGTYDMTYVTLD 120
Query: 361 ILSAKDKEKC 390
ILSAKDKEKC
Sbjct: 121 ILSAKDKEKC 130