Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T09B4_7
(1278 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508985|ref|NP_491780.1| of inner mitochondrial membrane 44 ... 852 0.0
gi|39595626|emb|CAE67128.1| Hypothetical protein CBG12550 [Caeno... 803 0.0
gi|50760904|ref|XP_418174.1| PREDICTED: similar to Import inner ... 361 2e-98
gi|19705563|ref|NP_035722.1| translocator of inner mitochondrial... 359 9e-98
gi|19483882|gb|AAH23454.1| Timm44 protein [Mus musculus] 359 9e-98
gi|48104922|ref|XP_395866.1| similar to ENSANGP00000012494 [Apis... 357 3e-97
gi|33636719|ref|NP_006342.2| translocase of inner mitochondrial ... 354 3e-96
gi|4103602|gb|AAD01797.1| putative mitochondrial inner membrane ... 354 3e-96
gi|8394449|ref|NP_058963.1| translocase of inner mitochondrial m... 354 3e-96
gi|2809420|gb|AAB97740.1| translocase of inner mitochondrial mem... 353 4e-96
gi|47225693|emb|CAG08036.1| unnamed protein product [Tetraodon n... 347 3e-94
gi|25009742|gb|AAN71045.1| AT09326p [Drosophila melanogaster] >g... 341 2e-92
gi|24648138|ref|NP_650786.2| CG11779-PA [Drosophila melanogaster... 341 2e-92
gi|24648140|ref|NP_732403.1| CG11779-PB [Drosophila melanogaster... 341 2e-92
gi|31203763|ref|XP_310830.1| ENSANGP00000012494 [Anopheles gambi... 333 7e-90
gi|47216426|emb|CAG01977.1| unnamed protein product [Tetraodon n... 329 7e-89
gi|16183135|gb|AAL13638.1| GH18370p [Drosophila melanogaster] 310 4e-83
gi|31211361|ref|XP_314650.1| ENSANGP00000020820 [Anopheles gambi... 273 8e-72
gi|32420443|ref|XP_330665.1| hypothetical protein [Neurospora cr... 152 2e-35
gi|46111759|ref|XP_382937.1| hypothetical protein FG02761.1 [Gib... 144 3e-33
gi|49086802|ref|XP_405418.1| hypothetical protein AN1281.2 [Aspe... 133 1e-29
gi|6322167|ref|NP_012242.1| 48.8 kDa protein involved in mitocho... 127 7e-28
gi|19112697|ref|NP_595905.1| putative mitochondrial import inner... 126 1e-27
gi|50307591|ref|XP_453775.1| unnamed protein product [Kluyveromy... 123 1e-26
gi|50257579|gb|EAL20284.1| hypothetical protein CNBF0960 [Crypto... 119 2e-25
gi|45187755|ref|NP_983978.1| ADL118Cp [Eremothecium gossypii] >g... 117 8e-25
gi|50290757|ref|XP_447811.1| unnamed protein product [Candida gl... 112 2e-23
gi|46439447|gb|EAK98765.1| hypothetical protein CaO19.12899 [Can... 111 3e-23
gi|50551255|ref|XP_503101.1| hypothetical protein [Yarrowia lipo... 110 7e-23
gi|50418853|ref|XP_457947.1| unnamed protein product [Debaryomyc... 102 1e-20
gi|49076478|ref|XP_402209.1| hypothetical protein UM04594.1 [Ust... 97 8e-19
gi|25370690|pir||B84590 hypothetical protein At2g20510 [imported... 80 1e-13
gi|18399377|ref|NP_565473.1| mitochondrial import inner membrane... 77 1e-12
gi|42569661|ref|NP_181151.3| mitochondrial import inner membrane... 73 2e-11
gi|31220237|ref|XP_316896.1| ENSANGP00000011213 [Anopheles gambi... 71 6e-11
gi|25370689|pir||E84776 hypothetical protein At2g36070 [imported... 68 5e-10
gi|39933380|ref|NP_945656.1| conserved unknown protein [Rhodopse... 64 1e-08
gi|50508458|dbj|BAD30582.1| mitochondrial inner membrane translo... 63 2e-08
gi|23502922|ref|NP_699049.1| conserved hypothetical protein [Bru... 62 3e-08
gi|17988336|ref|NP_540970.1| TRANSPORTER [Brucella melitensis 16... 60 8e-08
gi|49474924|ref|YP_032965.1| hypothetical protein BH01040 [Barto... 57 7e-07
gi|27375753|ref|NP_767282.1| blr0642 [Bradyrhizobium japonicum U... 57 7e-07
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 54 1e-05
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 54 1e-05
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 54 1e-05
gi|50746907|ref|XP_420670.1| PREDICTED: similar to Centromeric p... 53 2e-05
gi|9828634|gb|AAG00257.1| F1N21.5 [Arabidopsis thaliana] 51 7e-05
gi|48735220|gb|AAH71232.1| Unknown (protein for IMAGE:30442093) ... 50 9e-05
gi|46204686|ref|ZP_00049618.2| COG4395: Uncharacterized protein ... 50 9e-05
gi|30172544|ref|NP_032043.2| structural maintenance of chromosom... 50 9e-05
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 50 1e-04
gi|42627769|tpe|CAD89875.1| TPA: SMC2 protein [Homo sapiens] 50 1e-04
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 49 2e-04
gi|19703613|ref|NP_603175.1| DNA repair protein recN [Fusobacter... 49 2e-04
gi|46201691|ref|ZP_00054533.2| COG4395: Uncharacterized protein ... 49 2e-04
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 49 2e-04
gi|15963761|ref|NP_384114.1| PUTATIVE TRANSLOCASE TRANSMEMBRANE ... 49 3e-04
gi|46451427|gb|AAS97958.1| major surface protein 3 [Anaplasma ce... 49 3e-04
gi|34868391|ref|XP_342838.1| similar to SMC2 protein [Rattus nor... 49 3e-04
gi|20093560|ref|NP_613407.1| Uncharacterized archaeal coiled-coi... 49 3e-04
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_... 49 3e-04
gi|32451885|gb|AAH54565.1| LOC407638 protein [Danio rerio] 49 3e-04
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 48 6e-04
gi|49473777|ref|YP_031819.1| hypothetical protein BQ00970 [Barto... 48 6e-04
gi|48763796|ref|ZP_00268349.1| COG4395: Uncharacterized protein ... 48 6e-04
gi|45916719|ref|ZP_00195725.2| COG4395: Uncharacterized protein ... 48 6e-04
gi|24641294|ref|NP_727526.1| CG11727-PA [Drosophila melanogaster... 47 0.001
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 47 0.001
gi|24641296|ref|NP_572716.2| CG11727-PB [Drosophila melanogaster... 47 0.001
gi|47938675|gb|AAH72337.1| LOC432244 protein [Xenopus laevis] 47 0.001
gi|17560378|ref|NP_508029.1| pleckstrin homology domain protein ... 47 0.001
gi|7490754|pir||S62509 probable vesicular transport factor - fis... 47 0.001
gi|5453591|ref|NP_006435.1| structural maintenance of chromosome... 47 0.001
gi|16768700|gb|AAL28569.1| HL04393p [Drosophila melanogaster] 47 0.001
gi|37589364|gb|AAH59305.1| MGC68950 protein [Xenopus laevis] 47 0.001
gi|19115473|ref|NP_594561.1| putative vesicular transport factor... 47 0.001
gi|39590658|emb|CAE65028.1| Hypothetical protein CBG09866 [Caeno... 47 0.001
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa... 47 0.001
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su... 47 0.001
gi|21391968|gb|AAM48338.1| GH14362p [Drosophila melanogaster] 47 0.001
gi|6324769|ref|NP_014838.1| Kinetochore-associated protein requi... 46 0.002
gi|5031522|gb|AAD38203.1| M protein precursor [Streptococcus pyo... 46 0.002
gi|48833413|ref|ZP_00290433.1| COG4395: Uncharacterized protein ... 46 0.002
gi|29375584|ref|NP_814738.1| cell division protein DivIVA [Enter... 46 0.002
gi|23491588|dbj|BAC16746.1| myosin heavy chain [Branchiostoma be... 46 0.002
gi|15887367|ref|NP_353048.1| AGR_C_12p [Agrobacterium tumefacien... 46 0.002
gi|33866772|ref|NP_898331.1| conserved hypothetical protein [Syn... 46 0.002
gi|17933933|ref|NP_530723.1| conserved hypothetical protein [Agr... 46 0.002
gi|7245792|pdb|1C1G|A Chain A, Crystal Structure Of Tropomyosin ... 45 0.003
gi|1174760|sp|P42639|TPM1_PIG Tropomyosin 1 alpha chain (Alpha-t... 45 0.003
gi|23486501|gb|EAA20811.1| hypothetical protein [Plasmodium yoel... 45 0.004
gi|23613080|ref|NP_703402.1| hypothetical protein [Plasmodium fa... 45 0.004
gi|48850722|ref|ZP_00304964.1| COG4395: Uncharacterized protein ... 45 0.004
gi|207355|gb|AAA42252.1| brain alpha-tropomyosin (TMBr-1) 45 0.004
gi|39585311|emb|CAE61633.1| Hypothetical protein CBG05563 [Caeno... 45 0.004
gi|15828877|ref|NP_326237.1| unknown; predicted coding region [M... 45 0.004
gi|15614944|ref|NP_243247.1| BH2381~unknown conserved protein in... 45 0.004
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 45 0.005
gi|48095516|ref|XP_392311.1| similar to Short stop/Kakapo long i... 45 0.005
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 45 0.005
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 45 0.005
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 45 0.005
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 45 0.005
gi|48894269|ref|ZP_00327378.1| COG0457: FOG: TPR repeat [Trichod... 45 0.005
gi|31237366|ref|XP_319596.1| ENSANGP00000016709 [Anopheles gambi... 45 0.005
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 45 0.005
gi|48826192|ref|ZP_00287417.1| COG3599: Cell division initiation... 45 0.005
gi|126669|sp|P02977|M5_STRP5 M protein, serotype 5 precursor >gn... 44 0.006
gi|207351|gb|AAA21805.1| non-muscle alpha tropomyosin 44 0.006
gi|31560030|ref|NP_077745.2| tropomyosin 1, alpha; alpha tropomy... 44 0.006
gi|34902674|ref|NP_912683.1| mitochondrial inner membrane transl... 44 0.006
gi|437191|gb|AAA50854.1| M5.8193 protein 44 0.006
gi|32417248|ref|XP_329102.1| hypothetical protein [Neurospora cr... 44 0.006
gi|15241358|ref|NP_197547.1| myosin, putative [Arabidopsis thali... 44 0.006
gi|32406786|ref|XP_324006.1| predicted protein [Neurospora crass... 44 0.008
gi|23508113|ref|NP_700783.1| hypothetical protein [Plasmodium fa... 44 0.008
gi|18978304|ref|NP_579661.1| hypothetical protein PF1932 [Pyroco... 44 0.008
gi|230767|pdb|2TMA|A Chain A, Tropomyosin >gnl|BL_ORD_ID|1837837... 44 0.008
gi|88928|pir||A27674 tropomyosin 3, fibroblast - human >gnl|BL_O... 44 0.008
gi|26328709|dbj|BAC28093.1| unnamed protein product [Mus musculus] 44 0.008
gi|20178271|sp|P58772|TPM1_RABIT Tropomyosin 1 alpha chain (Alph... 44 0.008
gi|136092|sp|P09493|TPM1_HUMAN Tropomyosin 1 alpha chain (Alpha-... 44 0.008
gi|28557131|dbj|BAC57570.1| tropomyosin3 [Takifugu rubripes] 44 0.008
gi|207353|gb|AAA21802.1| hepatoma alpha tropomyosin 44 0.008
gi|49660014|gb|AAT68295.1| tropomyosin alpha striated muscle iso... 44 0.008
gi|112444|pir||B39816 tropomyosin 3, fibroblast - rat >gnl|BL_OR... 44 0.008
gi|92921|pir||B27407 tropomyosin alpha chain, striated muscle - rat 44 0.008
gi|1351289|sp|P04692|TPM1_RAT Tropomyosin 1 alpha chain (Alpha-t... 44 0.008
gi|28574245|ref|NP_724047.2| CG5020-PB [Drosophila melanogaster]... 44 0.008
gi|15220369|ref|NP_176892.1| expressed protein [Arabidopsis thal... 44 0.008
gi|31199853|ref|XP_308874.1| ENSANGP00000005723 [Anopheles gambi... 44 0.008
gi|207352|gb|AAA21803.1| minor striated-muscle alpha tropomyosin 44 0.008
gi|45552035|ref|NP_788072.2| CG5020-PD [Drosophila melanogaster]... 44 0.008
gi|14009350|gb|AAK50339.1| emm type protein precursor [Streptoco... 44 0.008
gi|20094208|ref|NP_614055.1| Uncharacterized protein [Methanopyr... 44 0.008
gi|45594277|gb|AAS68515.1| structural maintenance of chromosomes... 44 0.008
gi|24584810|ref|NP_724048.1| CG5020-PC [Drosophila melanogaster]... 44 0.008
gi|339956|gb|AAA61226.1| skeletal muscle tropomyosin 44 0.008
gi|38106086|gb|EAA52437.1| hypothetical protein MG05129.4 [Magna... 44 0.008
gi|24584806|ref|NP_609835.2| CG5020-PA [Drosophila melanogaster]... 44 0.008
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ... 44 0.008
gi|28386007|gb|AAH46493.1| AU016693 protein [Mus musculus] 44 0.008
gi|31418418|gb|AAH53439.1| Unknown (protein for MGC:59487) [Mus ... 44 0.008
gi|11094038|gb|AAG29545.1| 1-beta dynein [Drosophila melanogaster] 44 0.008
gi|27467708|ref|NP_764345.1| conserved hypothetical protein [Sta... 44 0.008
gi|47123937|gb|AAH70725.1| LOC398429 protein [Xenopus laevis] 44 0.011
gi|27368039|gb|AAN87031.1| kinetochore spindle checkpoint protei... 44 0.011
gi|17553764|ref|NP_497706.1| protein kinase beta like (3E511) [C... 44 0.011
gi|26346649|dbj|BAC36973.1| unnamed protein product [Mus musculus] 44 0.011
gi|27597085|ref|NP_000357.3| tropomyosin 1 (alpha) [Homo sapiens... 44 0.011
gi|9280816|gb|AAC51654.2| myosin VI [Homo sapiens] 44 0.011
gi|15221524|ref|NP_177046.1| expressed protein [Arabidopsis thal... 44 0.011
gi|34764252|ref|ZP_00145101.1| DNA repair protein recN [Fusobact... 44 0.011
gi|47077229|dbj|BAD18535.1| unnamed protein product [Homo sapiens] 44 0.011
gi|13518400|ref|NP_084759.1| Ycf1 protein [Oenothera elata subsp... 44 0.011
gi|112440|pir||A34787 tropomyosin 1 alpha, brain - rat 44 0.011
gi|30585023|gb|AAP36784.1| Homo sapiens tropomyosin 1 (alpha) [s... 44 0.011
gi|6066428|emb|CAB58295.1| hypothetical protein L2581.09 [Leishm... 43 0.014
gi|45387763|ref|NP_991239.1| tropomyosin3 [Danio rerio] >gnl|BL_... 43 0.014
gi|17565748|ref|NP_504160.1| myosin heavy like (50.1 kD) (5E646)... 43 0.014
gi|50749815|ref|XP_421767.1| PREDICTED: similar to CTCL tumor an... 43 0.014
gi|1075681|pir||S54871 M protein - Streptococcus sp >gnl|BL_ORD_... 43 0.014
gi|5420159|emb|CAB46637.1| FL(2)D protein [Drosophila melanogaster] 43 0.014
gi|28972888|dbj|BAC65860.1| mKIAA3005 protein [Mus musculus] 43 0.014
gi|24379696|ref|NP_721651.1| putative DNA gyrase subunit B [Stre... 43 0.014
gi|13928704|ref|NP_113708.1| myosin heavy chain 10, non-muscle; ... 43 0.014
gi|33598964|ref|NP_780469.1| myosin heavy chain 10, non-muscle; ... 43 0.014
gi|14134107|gb|AAK54243.1| tropomyosin alpha isoform [Rattus nor... 43 0.014
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 43 0.014
gi|24308155|ref|NP_060473.1| uveal autoantigen with coiled-coil ... 43 0.014
gi|20521940|dbj|BAB13387.2| KIAA1561 protein [Homo sapiens] 43 0.014
gi|46445652|ref|YP_007017.1| hypothetical protein pc0018 [Parach... 43 0.014
gi|39590030|emb|CAE61028.1| Hypothetical protein CBG04771 [Caeno... 43 0.014
gi|12240158|gb|AAG49576.1| uveal autoantigen [Bos taurus] 43 0.014
gi|26332899|dbj|BAC30167.1| unnamed protein product [Mus musculus] 43 0.014
gi|37604192|gb|AAH59863.1| Myh10 protein [Mus musculus] 43 0.014
gi|3462838|gb|AAC33106.1| M protein [Streptococcus pyogenes] 43 0.014
gi|7662062|ref|NP_055450.1| GRIP coiled-coil protein GCC185 isof... 43 0.018
gi|29837126|emb|CAD58850.2| SMC1 protein cohesin subunit [Gallus... 43 0.018
gi|4098584|gb|AAD00329.1| unknown [Rhodobacter capsulatus] 43 0.018
gi|86150|pir||A28499 tropomyosin alpha chain, skin fibroblast - ... 43 0.018
gi|31563507|ref|NP_852118.1| GRIP coiled-coil protein GCC185 iso... 43 0.018
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 43 0.018
gi|41406064|ref|NP_005955.1| myosin, heavy polypeptide 10, non-m... 43 0.018
gi|1346640|sp|P35580|MYHA_HUMAN Myosin heavy chain, nonmuscle ty... 43 0.018
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 43 0.018
gi|15607012|ref|NP_214394.1| initiation factor IF-2 [Aquifex aeo... 43 0.018
gi|15669512|ref|NP_248322.1| purine NTPase [Methanocaldococcus j... 43 0.018
gi|7715551|gb|AAF68093.1| PspA [Streptococcus pneumoniae] 43 0.018
gi|34485696|gb|AAQ73233.1| M protein [Streptococcus pyogenes] 43 0.018
gi|47226236|emb|CAG08383.1| unnamed protein product [Tetraodon n... 43 0.018
gi|21483824|gb|AAM52325.1| M protein precursor [Streptococcus py... 43 0.018
gi|40788217|dbj|BAA20794.2| KIAA0336 [Homo sapiens] 43 0.018
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 43 0.018
gi|4928755|gb|AAD33718.1| myosin heavy chain [Amoeba proteus] 42 0.024
gi|20178268|sp|P58773|TPM1_COTJA Tropomyosin 1 alpha chain (Alph... 42 0.024
gi|211226|gb|AAA48610.1| alpha-tropomyosin 42 0.024
gi|2133394|pir||S61535 nucleotide-binding head-stalk protein 183... 42 0.024
gi|29248170|gb|EAA39711.1| GLP_741_55154_50292 [Giardia lamblia ... 42 0.024
gi|42520333|ref|NP_966248.1| hypothetical protein WD0462 [Wolbac... 42 0.024
gi|27807325|ref|NP_777259.1| myosin, heavy polypeptide 10, non-m... 42 0.024
gi|39590082|emb|CAE61080.1| Hypothetical protein CBG04830 [Caeno... 42 0.024
gi|212815|gb|AAA49113.1| alpha-tropomyosin (partial) 42 0.024
gi|31197665|ref|XP_307780.1| ENSANGP00000012927 [Anopheles gambi... 42 0.024
gi|19704106|ref|NP_603668.1| Oxygen-independent coproporphyrinog... 42 0.024
gi|49256476|gb|AAH74138.1| Unknown (protein for IMAGE:7008480) [... 42 0.024
gi|29421288|gb|AAO59306.1| kinesin [Gibberella moniliformis] 42 0.031
gi|29838546|gb|AAO92603.1| M protein [Streptococcus pyogenes] 42 0.031
gi|212451|gb|AAA48987.1| nonmuscle myosin heavy chain 42 0.031
gi|212450|gb|AAA48986.1| nonmuscle myosin heavy chain 42 0.031
gi|39582764|emb|CAE74227.1| Hypothetical protein CBG21911 [Caeno... 42 0.031
gi|48101374|ref|XP_395113.1| similar to CG18076-PH [Apis mellifera] 42 0.031
gi|212449|gb|AAA48985.1| nonmuscle myosin heavy chain 42 0.031
gi|22536796|ref|NP_687647.1| DNA gyrase, B subunit [Streptococcu... 42 0.031
gi|11358443|pir||T46211 hypothetical protein T8P19.180 - Arabido... 42 0.031
gi|15239023|ref|NP_199671.1| structural maintenance of chromosom... 42 0.031
gi|6752387|gb|AAF27704.1| PspA [Streptococcus pneumoniae] 42 0.031
gi|7715585|gb|AAF68104.1| PspA [Streptococcus pneumoniae] 42 0.031
gi|45382679|ref|NP_990805.1| nonmuscle myosin heavy chain [Gallu... 42 0.031
gi|7715583|gb|AAF68103.1| PspA [Streptococcus pneumoniae] 42 0.031
gi|547983|sp|Q99105|MYSU_RABIT Myosin heavy chain, embryonic smo... 42 0.031
gi|15894666|ref|NP_348015.1| Membrane associated chemotaxis sens... 42 0.031
gi|24417370|gb|AAN60295.1| unknown [Arabidopsis thaliana] 42 0.031
gi|50416526|gb|AAH77739.1| Unknown (protein for MGC:78831) [Xeno... 42 0.041
gi|11498637|ref|NP_069865.1| purine NTPase, putative [Archaeoglo... 42 0.041
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r... 42 0.041
gi|16078489|ref|NP_389308.1| yknT [Bacillus subtilis subsp. subt... 42 0.041
gi|23508154|ref|NP_700824.1| hypothetical protein [Plasmodium fa... 42 0.041
gi|6752397|gb|AAF27709.1| PspA [Streptococcus pneumoniae] 42 0.041
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 42 0.041
gi|211110|gb|AAA48580.1| alpha-tropomyosin [Gallus gallus] 42 0.041
gi|47097000|ref|ZP_00234574.1| exonuclease, SbcC family [Listeri... 42 0.041
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr... 42 0.041
gi|47093681|ref|ZP_00231435.1| exonuclease, SbcC family [Listeri... 42 0.041
gi|46907874|ref|YP_014263.1| exonuclease, SbcC family [Listeria ... 42 0.041
gi|50511089|dbj|BAD32530.1| mKIAA1749 protein [Mus musculus] 42 0.041
gi|127751|sp|P02567|MYSD_CAEEL Myosin heavy chain D (MHC D) >gnl... 42 0.041
gi|2120431|pir||S70533 bbK2.10 protein precursor - Lyme disease ... 42 0.041
gi|17508449|ref|NP_492053.1| MYOsin heavy chain structural gene,... 42 0.041
gi|24584968|ref|NP_609877.2| CG12750-PA [Drosophila melanogaster... 42 0.041
gi|23112739|ref|ZP_00098186.1| COG0840: Methyl-accepting chemota... 42 0.041
gi|24653459|ref|NP_523732.2| CG6315-PA [Drosophila melanogaster]... 42 0.041
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 42 0.041
gi|50604174|gb|AAH77622.1| Unknown (protein for MGC:84656) [Xeno... 42 0.041
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 42 0.041
gi|18394229|ref|NP_563971.1| methyl-CpG-binding domain-containin... 42 0.041
gi|47224673|emb|CAG03657.1| unnamed protein product [Tetraodon n... 42 0.041
gi|48847089|ref|ZP_00301347.1| hypothetical protein Gmet02000559... 42 0.041
gi|23488575|gb|EAA21352.1| hypothetical protein [Plasmodium yoel... 42 0.041
gi|39585468|emb|CAE70551.1| Hypothetical protein CBG17195 [Caeno... 42 0.041
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 42 0.041
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod... 42 0.041
gi|33942081|ref|NP_898837.1| Cdc42 binding protein kinase beta [... 42 0.041
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 42 0.041
gi|16769850|gb|AAL29144.1| SD04745p [Drosophila melanogaster] 42 0.041
gi|33413786|gb|AAN39450.1| normocyte binding protein 2b [Plasmod... 41 0.053
gi|33413780|gb|AAN39449.1| normocyte binding protein 2b [Plasmod... 41 0.053
gi|30581135|ref|NP_006297.2| SMC1 structural maintenance of chro... 41 0.053
gi|2135244|pir||I54383 chromosome segregation protein smc1 [simi... 41 0.053
gi|9790237|ref|NP_062684.1| SMC1 structural maintenance of chrom... 41 0.053
gi|30172566|ref|NP_777039.1| SMC1 structural maintenance of chro... 41 0.053
gi|34365245|emb|CAE45960.1| hypothetical protein [Homo sapiens] 41 0.053
gi|541347|pir||S43556 plasminogen-binding protein MLC36 - Strept... 41 0.053
gi|20178336|sp|P21107|TPM3_MOUSE Tropomyosin alpha 3 chain (Trop... 41 0.053
gi|40254525|ref|NP_071709.2| tropomyosin 3, gamma; tropomyosin 5... 41 0.053
gi|1079274|pir||JC2551 tropomyosin alpha chain - axolotl >gnl|BL... 41 0.053
gi|136085|sp|P06753|TPM3_HUMAN Tropomyosin alpha 3 chain (Tropom... 41 0.053
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno... 41 0.053
gi|48856232|ref|ZP_00310390.1| COG1196: Chromosome segregation A... 41 0.053
gi|37595268|gb|AAQ94519.1| M protein [Streptococcus pyogenes] 41 0.053
gi|34860597|ref|XP_342346.1| similar to CENTROMERIC PROTEIN E (C... 41 0.053
gi|2370078|emb|CAB09784.1| dJ339A18.1 (KIAA0178 (ortholog of Fug... 41 0.053
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 41 0.053
gi|46440662|gb|EAK99965.1| hypothetical protein CaO19.13430 [Can... 41 0.053
gi|805097|gb|AAA67447.1| P120 41 0.053
gi|39963673|gb|AAH64368.1| SMC1L1 protein [Homo sapiens] 41 0.053
gi|88933|pir||A24199 tropomyosin NM, skeletal muscle - human >gn... 41 0.053
gi|6325275|ref|NP_015343.1| Chromatin Assembly Complex, subunit ... 41 0.069
gi|29243964|ref|NP_808268.1| hypothetical protein 4931417A20 [Mu... 41 0.069
gi|18859505|ref|NP_571180.1| alpha-tropomyosin; tropomyosin alph... 41 0.069
gi|136087|sp|P13105|TPM1_RANTE Tropomyosin 1 alpha chain (Alpha-... 41 0.069
gi|42656010|ref|XP_057107.5| KIAA1937 protein [Homo sapiens] 41 0.069
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ... 41 0.069
gi|15620933|dbj|BAB67830.1| KIAA1937 protein [Homo sapiens] 41 0.069
gi|49389245|dbj|BAD25207.1| putative BRI1-KD interacting protein... 41 0.069
gi|31235836|ref|XP_319308.1| ENSANGP00000012555 [Anopheles gambi... 41 0.069
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 41 0.069
gi|32040978|ref|ZP_00138561.1| COG0810: Periplasmic protein TonB... 41 0.069
gi|18977539|ref|NP_578896.1| smc-like [Pyrococcus furiosus DSM 3... 41 0.069
gi|23619130|ref|NP_705092.1| chromosome segregation protein, put... 41 0.069
gi|127236|sp|P26042|MOES_PIG Moesin (Membrane-organizing extensi... 41 0.069
gi|2120432|pir||S70534 bbK2.10 protein precursor - Lyme disease ... 41 0.069
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 41 0.069
gi|31235868|ref|XP_319313.1| ENSANGP00000023782 [Anopheles gambi... 41 0.069
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster... 41 0.069
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 41 0.069
gi|15596168|ref|NP_249662.1| TolA protein [Pseudomonas aeruginos... 41 0.069
gi|31235874|ref|XP_319314.1| ENSANGP00000022367 [Anopheles gambi... 41 0.069
gi|23490960|gb|EAA22610.1| hypothetical protein [Plasmodium yoel... 41 0.069
gi|161950|gb|AAA30149.1| 75 kDa invariant surface glycoprotein 41 0.069
gi|283424|pir||B38145 invariant surface glycoprotein 75 - Trypan... 41 0.069
gi|31235881|ref|XP_319315.1| ENSANGP00000024583 [Anopheles gambi... 41 0.069
gi|31235848|ref|XP_319310.1| ENSANGP00000024621 [Anopheles gambi... 41 0.069
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 41 0.069
gi|790931|gb|AAC41567.1| invariant surface glycoprotein 41 0.069
gi|31235842|ref|XP_319309.1| ENSANGP00000024129 [Anopheles gambi... 41 0.069
gi|30262170|ref|NP_844547.1| conserved domain protein [Bacillus ... 41 0.069
gi|21400020|ref|NP_656005.1| hypothetical protein predicted by G... 41 0.069
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 41 0.069
gi|20094127|ref|NP_613974.1| SMC1-family ATPase involved in DNA ... 41 0.069
gi|22538393|ref|NP_671714.1| A-kinase anchor protein 9 isoform 3... 40 0.090
gi|15422107|gb|AAK95686.1| unknown [Dictyostelium discoideum] 40 0.090
gi|24954658|gb|AAN64693.1| M protein [Streptococcus pyogenes] 40 0.090
gi|47203641|emb|CAF87225.1| unnamed protein product [Tetraodon n... 40 0.090
gi|13928946|ref|NP_113871.1| SMC1 structural maintenance of chro... 40 0.090
gi|3063940|emb|CAA91251.1| slow myotomal muscle tropomyosin [Sal... 40 0.090
gi|22538389|ref|NP_671695.1| A-kinase anchor protein 9 isoform 4... 40 0.090
gi|4558862|gb|AAD22767.1| A-kinase anchoring protein AKAP350 [Ho... 40 0.090
gi|6635819|gb|AAF19991.1| M protein precursor [Streptococcus pyo... 40 0.090
gi|16128714|ref|NP_415267.1| membrane spanning protein, required... 40 0.090
gi|50286815|ref|XP_445837.1| unnamed protein product [Candida gl... 40 0.090
gi|50418106|gb|AAH77164.1| Unknown (protein for MGC:91888) [Dani... 40 0.090
gi|3645944|gb|AAC60380.1| yotiao [Homo sapiens] 40 0.090
gi|2134903|pir||I53799 CG1 protein - human >gnl|BL_ORD_ID|851351... 40 0.090
gi|15674782|ref|NP_268956.1| putative DNA gyrase, subunit B [Str... 40 0.090
gi|20891291|ref|XP_146954.1| similar to Myosin Vc (Myosin 5C) [M... 40 0.090
gi|19745824|ref|NP_606960.1| putative DNA gyrase, subunit B [Str... 40 0.090
gi|28896290|ref|NP_802640.1| putative DNA gyrase B subunit [Stre... 40 0.090
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass... 40 0.090
gi|90095|pir||S00084 myosin heavy chain, fast skeletal muscle - ... 40 0.090
gi|40789066|dbj|BAA02794.2| KIAA0004 [Homo sapiens] 40 0.090
gi|32469853|ref|NP_863325.1| unknown [Campylobacter jejuni] >gnl... 40 0.090
gi|38089905|ref|XP_198225.3| myosin VC [Mus musculus] 40 0.090
gi|13473820|ref|NP_105388.1| hypothetical protein mlr4544 [Mesor... 40 0.090
gi|47213350|emb|CAF92973.1| unnamed protein product [Tetraodon n... 40 0.090
gi|4506467|ref|NP_002897.1| radixin [Homo sapiens] >gnl|BL_ORD_I... 40 0.090
gi|46370592|gb|AAS90118.1| condensin subunit [Tetrahymena thermo... 40 0.090
gi|16758420|ref|NP_446072.1| Cdc42-binding protein kinase beta [... 40 0.090
gi|47214617|emb|CAG01458.1| unnamed protein product [Tetraodon n... 40 0.090
gi|14520575|ref|NP_126050.1| chromosome segregation protein smc1... 40 0.090
gi|6981236|ref|NP_037326.1| myosin, heavy polypeptide 9; Myosin,... 40 0.090
gi|22538391|ref|NP_671700.1| A-kinase anchor protein 9 isoform 1... 40 0.090
gi|6320562|ref|NP_010643.1| may be involved in connecting nuclea... 40 0.090
gi|38605647|sp||P02562_2 [Segment 2 of 2] Myosin heavy chain, sk... 40 0.090
gi|46370594|gb|AAS90119.1| DNA topoisomerase type 2 [Tetrahymena... 40 0.090
gi|22538387|ref|NP_005742.4| A-kinase anchor protein 9 isoform 2... 40 0.090
gi|23480279|gb|EAA16880.1| hypothetical protein [Plasmodium yoel... 40 0.090
gi|28377545|ref|NP_784437.1| prophage Lp1 protein 50 [Lactobacil... 40 0.090
gi|21910012|ref|NP_664280.1| putative DNA gyrase, subunit B [Str... 40 0.090
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 40 0.090
gi|5030431|gb|AAA61281.2| vimentin [Homo sapiens] 40 0.090
gi|15829118|ref|NP_326478.1| predicted coding region [Mycoplasma... 40 0.090
gi|39588370|emb|CAE72721.1| Hypothetical protein CBG19958 [Caeno... 40 0.090
gi|30841498|gb|AAP34403.1| CDC42-binding protein kinase beta [Ra... 40 0.090
gi|15794440|ref|NP_284262.1| hypothetical secreted lysine-rich p... 40 0.12
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 40 0.12
gi|19704348|ref|NP_603910.1| Hypothetical protein [Fusobacterium... 40 0.12
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy... 40 0.12
gi|20137006|ref|NP_071855.1| myosin heavy chain IX [Mus musculus... 40 0.12
gi|23508707|ref|NP_701375.1| hypothetical protein [Plasmodium fa... 40 0.12
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 40 0.12
gi|39598193|emb|CAE68885.1| Hypothetical protein CBG14851 [Caeno... 40 0.12
gi|45384060|ref|NP_990605.1| MHC mRNA [Gallus gallus] >gnl|BL_OR... 40 0.12
gi|13784996|gb|AAK38348.1| fast tropomyosin [Scyliorhinus retifer] 40 0.12
gi|3915778|sp|P10587|MYHB_CHICK Myosin heavy chain, gizzard smoo... 40 0.12
gi|677198|gb|AAB00143.1| putative 40 0.12
gi|49068822|ref|XP_398700.1| hypothetical protein UM01085.1 [Ust... 40 0.12
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 40 0.12
gi|13543854|gb|AAH06075.1| Myh9 protein [Mus musculus] 40 0.12
gi|15601924|ref|NP_244996.1| PfhB2 [Pasteurella multocida Pm70] ... 40 0.12
gi|26986436|emb|CAD58915.1| SMC4 protein [Takifugu rubripes] 40 0.12
gi|48894043|ref|ZP_00327241.1| COG0419: ATPase involved in DNA r... 40 0.12
gi|790933|gb|AAC41568.1| invariant surface glycoprotein 40 0.12
gi|20819309|ref|XP_129987.1| RIKEN cDNA 2310045O21 [Mus musculus... 40 0.12
gi|15606017|ref|NP_213394.1| recombination protein RecN [Aquifex... 40 0.12
gi|17861369|gb|AAK61595.1| putative filamentous hemagglutinin [P... 40 0.12
gi|34526505|dbj|BAC85130.1| FLJ00279 protein [Homo sapiens] 40 0.12
gi|46442063|gb|EAL01355.1| hypothetical protein CaO19.10199 [Can... 40 0.12
gi|3205211|gb|AAC19403.1| non-muscle myosin heavy chain [Bos tau... 40 0.12
gi|47847498|dbj|BAD21421.1| mFLJ00279 protein [Mus musculus] 40 0.12
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 40 0.12
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 40 0.12
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 40 0.12
gi|31203693|ref|XP_310795.1| ENSANGP00000023103 [Anopheles gambi... 40 0.12
gi|50419029|ref|XP_458036.1| unnamed protein product [Debaryomyc... 40 0.12
gi|47219612|emb|CAG02657.1| unnamed protein product [Tetraodon n... 40 0.12
gi|7716519|gb|AAF68415.1| putative filamentous hemagglutinin [Pa... 40 0.12
gi|27881642|gb|AAH43703.1| Myh9 protein [Mus musculus] 40 0.12
gi|15640114|ref|NP_229741.1| conserved hypothetical protein [Vib... 40 0.12
gi|29436484|gb|AAH49479.1| Msn protein [Danio rerio] 40 0.12
gi|7716517|gb|AAF68414.1| putative filamentous hemagglutinin [Pa... 40 0.12
gi|28277050|gb|AAH44834.1| Myh9 protein [Mus musculus] 40 0.12
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 40 0.12
gi|7481995|pir||T18352 protein P120 - Mycoplasma hominis >gnl|BL... 40 0.12
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 40 0.12
gi|46439259|gb|EAK98579.1| hypothetical protein CaO19.12547 [Can... 40 0.12
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 40 0.12
gi|38106791|gb|EAA53056.1| hypothetical protein MG06184.4 [Magna... 40 0.12
gi|5051743|dbj|BAA78718.1| Centrosome- and Golgi-localized PKN-a... 40 0.15
gi|3211974|gb|AAC21558.1| paramyosin related protein [Echinococc... 40 0.15
gi|23619292|ref|NP_705254.1| Plasmodium falciparum reticulocyte ... 40 0.15
gi|4503179|ref|NP_003602.1| oral-facial-digital syndrome 1; chro... 40 0.15
gi|33413778|gb|AAN39448.1| normocyte binding protein 2b [Plasmod... 40 0.15
gi|45382323|ref|NP_990732.1| tropomyosin (CTm4) [Gallus gallus] ... 40 0.15
gi|23487791|gb|EAA21145.1| TATA element modulatory factor [Plasm... 40 0.15
gi|30268331|emb|CAD89954.1| hypothetical protein [Homo sapiens] 40 0.15
gi|211109|gb|AAA48579.1| alpha-tropomyosin [Gallus gallus] 40 0.15
gi|15803211|ref|NP_289243.1| alanyl-tRNA synthetase [Escherichia... 40 0.15
gi|15677199|ref|NP_274352.1| conserved hypothetical protein [Nei... 40 0.15
gi|6636514|gb|AAF20208.1| cingulin [Xenopus laevis] 40 0.15
gi|50290619|ref|XP_447742.1| unnamed protein product [Candida gl... 40 0.15
gi|23612516|ref|NP_704077.1| hypothetical protein [Plasmodium fa... 40 0.15
gi|6648536|gb|AAF21215.1| moesin [Xenopus laevis] 40 0.15
gi|27923756|sp|Q9PTD7|CING_XENLA Cingulin 40 0.15
gi|2134385|pir||I50463 protein kinase - chicken >gnl|BL_ORD_ID|1... 40 0.15
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [... 40 0.15
gi|13345189|gb|AAK19245.1| reticulocyte binding protein 2 homolo... 40 0.15
gi|23487793|gb|EAA21147.1| protein mix-1, putative [Plasmodium y... 40 0.15
gi|9631776|ref|NP_048555.1| KAEKA (6X), SDDD (7X) [Paramecium bu... 40 0.15
gi|6752399|gb|AAF27710.1| PspA [Streptococcus pneumoniae] 40 0.15
gi|24113995|ref|NP_708505.1| alanyl-tRNA synthetase [Shigella fl... 40 0.15
gi|38107681|gb|EAA53821.1| hypothetical protein MG09571.4 [Magna... 40 0.15
gi|50770620|ref|XP_423115.1| PREDICTED: similar to meiosis-speci... 40 0.15
gi|2498896|sp|Q60563|SCP1_MESAU Synaptonemal complex protein 1 (... 40 0.15
gi|15894110|ref|NP_347459.1| Predicted membrane protein [Clostri... 40 0.15
gi|48113484|ref|XP_393156.1| similar to ENSANGP00000018167 [Apis... 40 0.15
gi|23489443|gb|EAA21576.1| hypothetical protein [Plasmodium yoel... 40 0.15
gi|39579470|emb|CAE56115.1| Hypothetical protein CBG23721 [Caeno... 40 0.15
gi|37595252|gb|AAQ94511.1| M protein [Streptococcus pyogenes] 40 0.15
gi|30064057|ref|NP_838228.1| alanyl-tRNA synthetase [Shigella fl... 40 0.15
gi|34555946|emb|CAA99798.2| Hypothetical protein C54D10.8 [Caeno... 40 0.15
gi|15832808|ref|NP_311581.1| alanyl-tRNA synthetase [Escherichia... 40 0.15
gi|27596815|gb|AAO20886.1| merozoite surface protein 3 alpha [Pl... 39 0.20
gi|30021331|ref|NP_832962.1| surface protein [Bacillus cereus AT... 39 0.20
gi|34865346|ref|XP_216723.2| similar to ninein [Rattus norvegicus] 39 0.20
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo... 39 0.20
gi|6752401|gb|AAF27711.1| PspA [Streptococcus pneumoniae] 39 0.20
gi|2120433|pir||S70531 bbk2.11 protein precursor - Lyme disease ... 39 0.20
gi|22335457|dbj|BAC10418.1| myosin heavy chain fetal [Bos taurus] 39 0.20
gi|49085420|ref|XP_404833.1| hypothetical protein AN0696.2 [Aspe... 39 0.20
gi|7521921|pir||T30534 chromosome segregation protein SMC1 homol... 39 0.20
gi|21707845|gb|AAH34046.1| PPFIA1 protein [Homo sapiens] 39 0.20
gi|15793308|ref|NP_283130.1| probable signal recognition particl... 39 0.20
gi|17553682|ref|NP_498199.1| putative mitochondrial protein, wit... 39 0.20
gi|10435300|dbj|BAB14554.1| unnamed protein product [Homo sapiens] 39 0.20
gi|21634277|gb|AAM51173.1| extracellular matrix binding protein ... 39 0.20
gi|47206494|emb|CAF92339.1| unnamed protein product [Tetraodon n... 39 0.20
gi|346655|pir||A44131 tropomyosin beta 2 - mouse >gnl|BL_ORD_ID|... 39 0.20
gi|6319962|ref|NP_010042.1| Protein required for spore wall form... 39 0.20
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 39 0.20
gi|34529827|dbj|BAC85777.1| unnamed protein product [Homo sapiens] 39 0.20
gi|24653448|ref|NP_610895.1| CG13337-PA [Drosophila melanogaster... 39 0.20
gi|127764|sp|P04462|MYH8_RAT Myosin heavy chain, skeletal muscle... 39 0.20
gi|4505257|ref|NP_002435.1| moesin [Homo sapiens] >gnl|BL_ORD_ID... 39 0.20
gi|5360746|dbj|BAA82144.1| myosin heavy chain 2a [Sus scrofa] 39 0.20
gi|159333|gb|AAA20179.1| glycoprotein 96-92 39 0.20
gi|29421268|gb|AAO59296.1| kinesin [Cochliobolus heterostrophus] 39 0.20
gi|6752385|gb|AAF27703.1| PspA [Streptococcus pneumoniae] 39 0.20
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis] 39 0.20
gi|27468046|ref|NP_764683.1| ebhA protein [Staphylococcus epider... 39 0.20
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 39 0.20
gi|50730731|ref|XP_417015.1| PREDICTED: similar to chromosome 13... 39 0.20
gi|131821|sp|P26044|RADI_PIG Radixin (Moesin B) >gnl|BL_ORD_ID|5... 39 0.20
gi|47228706|emb|CAG07438.1| unnamed protein product [Tetraodon n... 39 0.20
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif... 39 0.20
gi|50420883|ref|XP_458982.1| unnamed protein product [Debaryomyc... 39 0.20
gi|50795133|ref|XP_423749.1| PREDICTED: similar to TATA element ... 39 0.20
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 39 0.20
gi|16077081|ref|NP_387894.1| seryl-tRNA synthetase [Bacillus sub... 39 0.20
gi|46436888|gb|EAK96243.1| hypothetical protein CaO19.13218 [Can... 39 0.20
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 39 0.20
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 39 0.20
gi|14625824|gb|AAK71522.1| moesin/anaplastic lymphoma kinase fus... 39 0.20
gi|45383133|ref|NP_989849.1| condensin complex subunit [Gallus g... 39 0.20
gi|31207277|ref|XP_312605.1| ENSANGP00000001286 [Anopheles gambi... 39 0.20
gi|21907898|dbj|BAC05679.1| myosin heavy chain 2a [Equus caballus] 39 0.20
gi|47205442|emb|CAG05719.1| unnamed protein product [Tetraodon n... 39 0.20
gi|46093525|dbj|BAD14986.1| M12 mutant protein precursor [Strept... 39 0.20
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 39 0.20
gi|48143314|ref|XP_397419.1| similar to transforming protein bmi... 39 0.20
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 39 0.20
gi|34860445|ref|XP_238534.2| similar to alpha glucosidase II, be... 39 0.20
gi|145220|gb|AAA03208.1| alanyl-tRNA synthetase 39 0.20
gi|16130604|ref|NP_417177.1| alanyl-tRNA synthetase [Escherichia... 39 0.20
gi|50344874|ref|NP_001002109.1| zgc:85944 [Danio rerio] >gnl|BL_... 39 0.26
gi|109322|pir||A41604 myosin heavy chain, smooth muscle, long sp... 39 0.26
gi|20070691|gb|AAH26142.1| Myh11 protein [Mus musculus] 39 0.26
gi|1346644|sp|P35748|MYHB_RABIT Myosin heavy chain, smooth muscl... 39 0.26
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11... 39 0.26
gi|23380416|gb|AAN17922.1| Erp25 protein [Borrelia burgdorferi] 39 0.26
gi|23509626|ref|NP_702293.1| hypothetical protein [Plasmodium fa... 39 0.26
gi|42572655|ref|NP_974423.1| myosin heavy chain-related [Arabido... 39 0.26
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii] 39 0.26
gi|49618927|gb|AAT68048.1| chromosome adhesion protein SMC1-like... 39 0.26
gi|26246708|ref|NP_752748.1| TolA protein [Escherichia coli CFT0... 39 0.26
gi|23480656|gb|EAA17156.1| KED, putative [Plasmodium yoelii yoelii] 39 0.26
gi|48859243|ref|ZP_00313180.1| hypothetical protein Chte02001407... 39 0.26
gi|109318|pir||B33501 myosin heavy chain 2, smooth muscle - rabb... 39 0.26
gi|27881943|gb|AAH44500.1| LOC407619 protein [Danio rerio] 39 0.26
gi|7498509|pir||T20532 hypothetical protein F07A11.6b - Caenorha... 39 0.26
>gi|17508985|ref|NP_491780.1| of inner mitochondrial membrane 44 (49.4
kD) (1G754) [Caenorhabditis elegans]
gi|6016367|sp|O02161|IM44_CAEEL Probable import inner membrane
translocase subunit TIM44, mitochondrial precursor
gi|7507521|pir||T25873 hypothetical protein T09B4.9 - Caenorhabditis
elegans
gi|2039379|gb|AAB53011.1| Hypothetical protein T09B4.9
[Caenorhabditis elegans]
Length = 425
Score = 852 bits (2200), Expect = 0.0
Identities = 425/425 (100%), Positives = 425/425 (100%)
Frame = -1
Query: 1278 MLSRICGNGIRLTRTRLQFQPSIVTFRDYSNPAPKRGFLNNLIDNVRDEMQKNKELQEHQ 1099
MLSRICGNGIRLTRTRLQFQPSIVTFRDYSNPAPKRGFLNNLIDNVRDEMQKNKELQEHQ
Sbjct: 1 MLSRICGNGIRLTRTRLQFQPSIVTFRDYSNPAPKRGFLNNLIDNVRDEMQKNKELQEHQ 60
Query: 1098 QQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEA 919
QQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEA
Sbjct: 61 QQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEA 120
Query: 918 GKKMTEAGAEALKQARKAAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR 739
GKKMTEAGAEALKQARKAAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR
Sbjct: 121 GKKMTEAGAEALKQARKAAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR 180
Query: 738 PEALTKRTDGFDLEKERVVEANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWKIKY 559
PEALTKRTDGFDLEKERVVEANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWKIKY
Sbjct: 181 PEALTKRTDGFDLEKERVVEANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWKIKY 240
Query: 558 DESDNMAVRMMRGVTEKIGSVFSGQNEVSEVLTEIHKIDANFDKQEWLRFCETKIIPNIL 379
DESDNMAVRMMRGVTEKIGSVFSGQNEVSEVLTEIHKIDANFDKQEWLRFCETKIIPNIL
Sbjct: 241 DESDNMAVRMMRGVTEKIGSVFSGQNEVSEVLTEIHKIDANFDKQEWLRFCETKIIPNIL 300
Query: 378 EAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKDSRIIDINKVEMATGKMMEQGP 199
EAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKDSRIIDINKVEMATGKMMEQGP
Sbjct: 301 EAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKDSRIIDINKVEMATGKMMEQGP 360
Query: 198 VLIISFQVYMINVTKNADGKVVEGDPDNPKRINHIWVLCRDVEEYNPALAWKLLEVHMQE 19
VLIISFQVYMINVTKNADGKVVEGDPDNPKRINHIWVLCRDVEEYNPALAWKLLEVHMQE
Sbjct: 361 VLIISFQVYMINVTKNADGKVVEGDPDNPKRINHIWVLCRDVEEYNPALAWKLLEVHMQE 420
Query: 18 TPLAL 4
TPLAL
Sbjct: 421 TPLAL 425
>gi|39595626|emb|CAE67128.1| Hypothetical protein CBG12550
[Caenorhabditis briggsae]
Length = 425
Score = 803 bits (2075), Expect = 0.0
Identities = 395/425 (92%), Positives = 415/425 (96%)
Frame = -1
Query: 1278 MLSRICGNGIRLTRTRLQFQPSIVTFRDYSNPAPKRGFLNNLIDNVRDEMQKNKELQEHQ 1099
MLSRI NG+RL R RLQFQPSIVTFRDYSNPAPKRGFLNNLI+NVRDEMQKNKELQEHQ
Sbjct: 1 MLSRIFSNGVRLNRVRLQFQPSIVTFRDYSNPAPKRGFLNNLIENVRDEMQKNKELQEHQ 60
Query: 1098 QQLKARMQELNESDALKDARKKFEIVEKETLKSSEVVKQKIEELSDHMKKMVHEIQKTEA 919
QQLKARMQELNESDALKDARKKFE+VEKETLKSSE+VKQK+EELS+ MKKM+ EIQKTEA
Sbjct: 61 QQLKARMQELNESDALKDARKKFELVEKETLKSSEIVKQKVEELSEQMKKMIQEIQKTEA 120
Query: 918 GKKMTEAGAEALKQARKAAEHVEKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR 739
GKKMTEAG EALKQARKAAE +EKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR
Sbjct: 121 GKKMTEAGEEALKQARKAAEQMEKVAEKVGDTEVYKHVSTSMKTVKDEIDNIADVRMYSR 180
Query: 738 PEALTKRTDGFDLEKERVVEANDSATDVTLHKDSKWYSGWKNFSESNTYYHKLLDWKIKY 559
PE LTKRTDGF+L+K+RVVEANDSATDV LHKDSKWYSGWKNFSESNTYYHKLLDWKIKY
Sbjct: 181 PETLTKRTDGFELDKDRVVEANDSATDVQLHKDSKWYSGWKNFSESNTYYHKLLDWKIKY 240
Query: 558 DESDNMAVRMMRGVTEKIGSVFSGQNEVSEVLTEIHKIDANFDKQEWLRFCETKIIPNIL 379
+ESDN+AVRMMRGVTE+IGSVFSGQNEVSEVLTEIHKIDANFDKQEWL+FCETKIIPNIL
Sbjct: 241 EESDNIAVRMMRGVTERIGSVFSGQNEVSEVLTEIHKIDANFDKQEWLKFCETKIIPNIL 300
Query: 378 EAFIRFDLEVLQSWCHERAYTQLSTVVKEYQKMHFSTKDSRIIDINKVEMATGKMMEQGP 199
EAFIRFDLEVLQSWCHERA+TQLSTVVKEYQKMH+STKDSRIIDINKVEMATGKMMEQGP
Sbjct: 301 EAFIRFDLEVLQSWCHERAFTQLSTVVKEYQKMHWSTKDSRIIDINKVEMATGKMMEQGP 360
Query: 198 VLIISFQVYMINVTKNADGKVVEGDPDNPKRINHIWVLCRDVEEYNPALAWKLLEVHMQE 19
VLIISFQVYMINVTKNA+GKVVEGDPDNPKRINHIWVLCRDVEEYNPA+AWKLLEVHMQE
Sbjct: 361 VLIISFQVYMINVTKNAEGKVVEGDPDNPKRINHIWVLCRDVEEYNPAIAWKLLEVHMQE 420
Query: 18 TPLAL 4
TPLA+
Sbjct: 421 TPLAV 425