Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T09B4_8
(801 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25141381|ref|NP_491781.2| c-term of Hsp70-iNteracting protein... 542 e-153
gi|7507513|pir||T25874 hypothetical protein T09B4.10 - Caenorhab... 536 e-151
gi|39595627|emb|CAE67129.1| Hypothetical protein CBG12551 [Caeno... 487 e-136
gi|41054441|ref|NP_955968.1| STIP1 homology and U-Box containing... 216 6e-55
gi|14043119|gb|AAH07545.1| STIP1 homology and U-Box containing p... 207 3e-52
gi|27668368|ref|XP_213270.1| similar to carboxy terminus of Hsp7... 207 3e-52
gi|12832963|dbj|BAB22329.1| unnamed protein product [Mus musculus] 206 5e-52
gi|9789907|ref|NP_062693.1| STIP1 homology and U-Box containing ... 206 5e-52
gi|4928064|gb|AAD33400.1| carboxy terminus of Hsp70-interacting ... 205 8e-52
gi|5031963|ref|NP_005852.1| STIP1 homology and U-Box containing ... 203 3e-51
gi|47225971|emb|CAG04345.1| unnamed protein product [Tetraodon n... 197 3e-49
gi|31237787|ref|XP_319666.1| ENSANGP00000021376 [Anopheles gambi... 195 1e-48
gi|17137692|ref|NP_477441.1| CG5203-PA [Drosophila melanogaster]... 186 4e-46
gi|29841090|gb|AAP06103.1| similar to GenBank Accession Number A... 179 6e-44
gi|10441867|gb|AAG17211.1| unknown [Homo sapiens] 173 3e-42
gi|18397925|ref|NP_566305.1| tetratricopeptide repeat (TPR)-cont... 157 3e-37
gi|30421300|gb|AAP31263.1| Hsp70-interacting protein [Drosophila... 151 2e-35
gi|30421298|gb|AAP31262.1| Hsp70-interacting protein [Drosophila... 150 2e-35
gi|30421302|gb|AAP31264.1| Hsp70-interacting protein [Drosophila... 150 4e-35
gi|30421308|gb|AAP31267.1| Hsp70-interacting protein [Drosophila... 149 9e-35
gi|30421304|gb|AAP31265.1| Hsp70-interacting protein [Drosophila... 148 1e-34
gi|23612460|ref|NP_704021.1| hypothetical protein [Plasmodium fa... 142 8e-33
gi|23486143|gb|EAA20730.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 142 8e-33
gi|46136313|ref|XP_389848.1| hypothetical protein FG09672.1 [Gib... 116 6e-25
gi|38111494|gb|EAA57066.1| hypothetical protein MG08035.4 [Magna... 115 8e-25
gi|50755395|ref|XP_425224.1| PREDICTED: similar to miro protein ... 115 1e-24
gi|50556200|ref|XP_505508.1| hypothetical protein [Yarrowia lipo... 110 3e-23
gi|49097166|ref|XP_410043.1| hypothetical protein AN5906.2 [Aspe... 94 3e-18
gi|34898298|ref|NP_910495.1| sti (stress inducible protein)-like... 88 2e-16
gi|40882163|emb|CAF05989.1| related to CHIP protein (carboxyl te... 82 1e-14
gi|46433594|gb|EAK93029.1| hypothetical protein CaO19.14154 [Can... 82 1e-14
gi|50806883|ref|XP_424527.1| PREDICTED: similar to STIP1 homolog... 80 4e-14
gi|34898302|ref|NP_910497.1| contains ESTs AU068890(C50849),AU06... 77 3e-13
gi|1890281|gb|AAB49720.1| transformation-sensitive protein homol... 74 3e-12
gi|46136823|ref|XP_390103.1| hypothetical protein FG09927.1 [Gib... 71 3e-11
gi|32405944|ref|XP_323585.1| mitochondrial precursor protein imp... 71 3e-11
gi|49388654|dbj|BAD25789.1| putative stress-induced protein sti1... 69 9e-11
gi|129115|sp|P23231|OM70_NEUCR Mitochondrial precursor proteins ... 68 2e-10
gi|4530327|gb|AAD21979.1| mitochondrial precursor protein import... 68 2e-10
gi|30678171|ref|NP_171674.2| U-box domain-containing protein [Ar... 67 4e-10
gi|46440705|gb|EAL00008.1| hypothetical protein CaO19.13473 [Can... 67 4e-10
gi|11346440|pir||T48150 stress-induced protein sti1-like protein... 67 6e-10
gi|42408365|dbj|BAD09517.1| unknown protein [Oryza sativa (japon... 66 8e-10
gi|31324052|gb|AAP47158.1| TPR1 [Medicago sativa] 66 1e-09
gi|2745838|gb|AAB94760.1| Hsp70/Hsp90 organizing protein; hop [C... 66 1e-09
gi|26344902|dbj|BAC36100.1| unnamed protein product [Mus musculus] 65 1e-09
gi|14389431|ref|NP_058017.1| stress-induced phosphoprotein 1; st... 65 1e-09
gi|20302113|ref|NP_620266.1| stress-induced-phosphoprotein 1 (Hs... 65 1e-09
gi|5803181|ref|NP_006810.1| stress-induced-phosphoprotein 1 (Hsp... 65 1e-09
gi|13277819|gb|AAH03794.1| Stress-induced phosphoprotein 1 [Mus ... 65 1e-09
gi|38567872|emb|CAE03021.3| OSJNBa0091D06.14 [Oryza sativa (japo... 64 3e-09
gi|28973653|gb|AAO64147.1| putative TPR-repeat protein [Arabidop... 64 4e-09
gi|15221564|ref|NP_176461.1| stress-inducible protein, putative ... 64 4e-09
gi|41018257|sp|Q43468|STIP_SOYBN Heat shock protein STI (Stress ... 64 4e-09
gi|2129844|pir||S56658 stress-induced protein sti1 - soybean 64 4e-09
gi|38102486|gb|EAA49321.1| hypothetical protein MG00979.4 [Magna... 64 5e-09
gi|50415309|gb|AAH78016.1| Unknown (protein for MGC:82554) [Xeno... 63 6e-09
gi|50260964|gb|EAL23614.1| hypothetical protein CNBA2610 [Crypto... 63 8e-09
gi|45185361|ref|NP_983078.1| ABR131Wp [Eremothecium gossypii] >g... 63 8e-09
gi|7330643|gb|AAC60555.2| STI1 stress-inducible protein homolog ... 62 1e-08
gi|2407970|emb|CAA75047.1| TOM70 [Podospora anserina] 62 1e-08
gi|6319631|ref|NP_009713.1| cyclophilin seven suppressor; Cns1p ... 62 1e-08
gi|50420643|ref|XP_458858.1| unnamed protein product [Debaryomyc... 62 1e-08
gi|31236154|ref|XP_319365.1| ENSANGP00000012254 [Anopheles gambi... 62 1e-08
gi|3037137|gb|AAC12945.1| Hsp70/Hsp90 organizing protein homolog... 62 1e-08
gi|45361567|ref|NP_989360.1| hypothetical protein MGC76181 [Xeno... 62 2e-08
gi|30678166|ref|NP_171673.2| U-box domain-containing protein [Ar... 62 2e-08
gi|32403286|ref|XP_322256.1| hypothetical protein [Neurospora cr... 62 2e-08
gi|21392176|gb|AAM48442.1| RE66761p [Drosophila melanogaster] 62 2e-08
gi|24583793|ref|NP_609536.1| CG6756-PA [Drosophila melanogaster]... 62 2e-08
gi|34866054|ref|XP_235372.2| similar to TPR-containing protein i... 61 2e-08
gi|19705092|ref|NP_602587.1| Tetratricopeptide repeat family pro... 61 3e-08
gi|34762717|ref|ZP_00143707.1| TETRATRICOPEPTIDE REPEAT FAMILY P... 61 3e-08
gi|27262636|ref|NP_003105.2| sperm associated antigen 1; inferti... 60 4e-08
gi|10863768|gb|AAG23967.1| infertility-related sperm protein [Ho... 60 4e-08
gi|50286403|ref|XP_445630.1| unnamed protein product [Candida gl... 60 5e-08
gi|19115150|ref|NP_594238.1| hypothetical protein [Schizosacchar... 60 5e-08
gi|28856254|gb|AAH48062.1| Small glutamine-rich tetratricopeptid... 60 5e-08
gi|47086521|ref|NP_997929.1| small glutamine-rich tetratricopept... 60 5e-08
gi|49111568|ref|XP_411824.1| hypothetical protein AN7687.2 [Aspe... 60 5e-08
gi|50260788|gb|EAL23438.1| hypothetical protein CNBA0880 [Crypto... 60 5e-08
gi|46390551|dbj|BAD16037.1| putative immediate-early fungal elic... 60 5e-08
gi|22655105|gb|AAM98143.1| stress-induced protein sti1-like prot... 60 7e-08
gi|30682109|ref|NP_192977.2| stress-inducible protein, putative ... 60 7e-08
gi|17137540|ref|NP_477354.1| CG2720-PA [Drosophila melanogaster]... 60 7e-08
gi|49079732|ref|XP_403479.1| hypothetical protein UM05864.1 [Ust... 60 7e-08
gi|28279373|gb|AAH46313.1| Spag1 protein [Mus musculus] 59 9e-08
gi|6755616|ref|NP_036161.1| sperm associated antigen 1; TPR-cont... 59 9e-08
gi|25517986|pir||E86147 T1N6.4 protein - Arabidopsis thaliana >g... 59 9e-08
gi|50289377|ref|XP_447120.1| unnamed protein product [Candida gl... 59 1e-07
gi|45200829|ref|NP_986399.1| AGL268Cp [Eremothecium gossypii] >g... 59 1e-07
gi|23509546|ref|NP_702213.1| hypothetical protein, conserved [Pl... 59 1e-07
gi|15223450|ref|NP_171672.1| U-box domain-containing protein [Ar... 59 2e-07
gi|32408829|ref|XP_324894.1| hypothetical protein [Neurospora cr... 59 2e-07
gi|6324208|ref|NP_014278.1| Translocase of Outer Mitochondrial m... 59 2e-07
gi|30694120|ref|NP_191039.2| armadillo/beta-catenin repeat famil... 58 2e-07
gi|26452249|dbj|BAC43212.1| unknown protein [Arabidopsis thaliana] 58 2e-07
gi|21622382|emb|CAD37036.1| related to ubiquitin fusion degradat... 58 2e-07
gi|23491036|gb|EAA22670.1| stress-induced protein sti1-like prot... 58 2e-07
gi|11358376|pir||T47638 hypothetical protein T5N23.150 - Arabido... 58 2e-07
gi|32404004|ref|XP_322615.1| hypothetical protein [Neurospora cr... 58 2e-07
gi|6671940|gb|AAF23200.1| hypothetical protein [Arabidopsis thal... 58 2e-07
gi|49078444|ref|XP_402974.1| hypothetical protein UM05359.1 [Ust... 58 2e-07
gi|18399375|ref|NP_566402.1| U-box domain-containing protein [Ar... 58 2e-07
gi|17864418|ref|NP_524796.1| CG2708-PA [Drosophila melanogaster]... 58 3e-07
gi|15292599|gb|AAK93568.1| SD10334p [Drosophila melanogaster] 58 3e-07
gi|26449410|dbj|BAC41832.1| unknown protein [Arabidopsis thalian... 58 3e-07
gi|50758677|ref|XP_417366.1| PREDICTED: similar to Mitochondrial... 58 3e-07
gi|30695406|ref|NP_191698.2| U-box domain-containing protein [Ar... 58 3e-07
gi|19114679|ref|NP_593767.1| putative mitochondrial precursor pr... 58 3e-07
gi|11358119|pir||T47931 hypothetical protein T20K12.290 - Arabid... 58 3e-07
gi|7486455|pir||T02455 hypothetical protein At2g45920 [imported]... 57 4e-07
gi|39850012|gb|AAH64275.1| LOC394994 protein [Xenopus tropicalis] 57 4e-07
gi|42569952|ref|NP_182116.2| U-box domain-containing protein [Ar... 57 4e-07
gi|48477919|ref|YP_023625.1| tetratricopeptide repeat family pro... 57 4e-07
gi|31238236|ref|XP_319734.1| ENSANGP00000019419 [Anopheles gambi... 57 4e-07
gi|50345104|ref|NP_001002225.1| zgc:92462 [Danio rerio] >gnl|BL_... 57 4e-07
gi|41052814|dbj|BAD07682.1| putative immediate-early fungal elic... 57 5e-07
gi|15231222|ref|NP_190813.1| U-box domain-containing protein [Ar... 57 5e-07
gi|42408388|dbj|BAD09539.1| putative arm repeat-containing prote... 57 6e-07
gi|30013683|gb|AAP03884.1| Avr9/Cf-9 rapidly elicited protein 74... 57 6e-07
gi|15678111|ref|NP_275226.1| O-linked GlcNAc transferase [Methan... 57 6e-07
gi|4082|emb|CAA29085.1| unnamed protein product [Saccharomyces c... 57 6e-07
gi|49072875|ref|XP_400713.1| hypothetical protein UM03098.1 [Ust... 56 8e-07
gi|28564115|gb|AAO32436.1| TOM70 [Saccharomyces bayanus] 56 8e-07
gi|17535447|ref|NP_494893.1| small glutamine-rich tetratricopept... 56 1e-06
gi|20177075|gb|AAM12299.1| SD06937p [Drosophila melanogaster] 56 1e-06
gi|47227046|emb|CAG00408.1| unnamed protein product [Tetraodon n... 56 1e-06
gi|42525946|ref|NP_971044.1| TPR domain protein [Treponema denti... 56 1e-06
gi|20129483|ref|NP_609597.1| CG9934-PA [Drosophila melanogaster]... 56 1e-06
gi|28302354|gb|AAH46709.1| Stip1-prov protein [Xenopus laevis] 55 1e-06
gi|21779939|gb|AAM77586.1| stress-induced phosphoprotein STI1; X... 55 1e-06
gi|6324601|ref|NP_014670.1| Heat shock protein also induced by c... 55 1e-06
gi|21593020|gb|AAM64969.1| unknown [Arabidopsis thaliana] 55 1e-06
gi|18408447|ref|NP_564866.1| U-box domain-containing protein [Ar... 55 1e-06
gi|13937285|gb|AAK50116.1| chloroplast protein-translocon-like p... 55 1e-06
gi|31615650|pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical A... 55 2e-06
gi|18406066|ref|NP_565985.1| serine/threonine protein phosphatas... 55 2e-06
gi|49070766|ref|XP_399672.1| hypothetical protein UM02057.1 [Ust... 55 2e-06
gi|28141302|gb|AAO26216.1| type 5 protein serine/threonine phosp... 55 2e-06
gi|50293839|ref|XP_449331.1| unnamed protein product [Candida gl... 55 2e-06
gi|25289020|pir||E84858 phosphoprotein phosphatase (EC 3.1.3.16)... 55 2e-06
gi|48852688|ref|ZP_00306872.1| COG0457: FOG: TPR repeat [Ferropl... 55 2e-06
gi|21313588|ref|NP_078775.1| small glutamine-rich tetratricopept... 55 2e-06
gi|26347835|dbj|BAC37566.1| unnamed protein product [Mus musculus] 55 2e-06
gi|39932540|sp|Q95LY5|TTCC_MACFA Tetratricopeptide repeat protei... 55 2e-06
gi|49094236|ref|XP_408579.1| hypothetical protein AN4442.2 [Aspe... 55 2e-06
gi|12083667|ref|NP_073194.1| small glutamine-rich tetratricopept... 55 2e-06
gi|26333537|dbj|BAC30486.1| unnamed protein product [Mus musculu... 55 2e-06
gi|48894045|ref|ZP_00327243.1| COG0457: FOG: TPR repeat [Trichod... 55 2e-06
gi|34898364|ref|NP_910528.1| Similar to Glycine max gmsti mRNA.(... 55 2e-06
gi|37536640|ref|NP_922622.1| putative arm repeat containing prot... 55 2e-06
gi|50413142|ref|XP_457213.1| unnamed protein product [Debaryomyc... 55 2e-06
gi|50293035|ref|XP_448950.1| unnamed protein product [Candida gl... 54 3e-06
gi|37805291|gb|AAH59994.1| MGC68780 protein [Xenopus laevis] 54 3e-06
gi|25408431|pir||G84774 hypothetical protein At2g35930 [imported... 54 3e-06
gi|39596770|emb|CAE58997.1| Hypothetical protein CBG02270 [Caeno... 54 3e-06
gi|50306299|ref|XP_453122.1| unnamed protein product [Kluyveromy... 54 3e-06
gi|28565010|gb|AAO32588.1| TOM71 [Saccharomyces kluyveri] 54 3e-06
gi|38105204|gb|EAA51660.1| hypothetical protein MG03255.4 [Magna... 54 3e-06
gi|46431989|gb|EAK91501.1| hypothetical protein CaO19.3700 [Cand... 54 3e-06
gi|30686609|ref|NP_181137.2| U-box domain-containing protein [Ar... 54 3e-06
gi|23509095|ref|NP_701763.1| hypothetical protein [Plasmodium fa... 54 3e-06
gi|37535874|ref|NP_922239.1| putative TPR (tetratricopeptide rep... 54 3e-06
gi|50731785|ref|XP_418359.1| PREDICTED: similar to sperm associa... 54 4e-06
gi|33348820|gb|AAQ16110.1| small glutamine-rich tetratricopeptid... 54 4e-06
gi|48891679|ref|ZP_00325162.1| COG0457: FOG: TPR repeat [Trichod... 54 4e-06
gi|44662987|gb|AAS47584.1| chloroplast Toc64-1 [Physcomitrella p... 54 4e-06
gi|50731783|ref|XP_418358.1| PREDICTED: similar to sperm associa... 54 4e-06
gi|34908566|ref|NP_915630.1| P0505D12.10 [Oryza sativa (japonica... 54 5e-06
gi|7512934|pir||T08782 hypothetical protein DKFZp586N1020.1 - hu... 54 5e-06
gi|46436190|gb|EAK95557.1| hypothetical protein CaO19.3191 [Cand... 54 5e-06
gi|1698880|gb|AAB37318.1| protein antigen LmSTI1 [Leishmania major] 54 5e-06
gi|4506921|ref|NP_003012.1| small glutamine-rich tetratricopepti... 54 5e-06
gi|46436331|gb|EAK95695.1| hypothetical protein CaO19.10702 [Can... 54 5e-06
gi|50729660|ref|XP_416605.1| PREDICTED: similar to translocase o... 54 5e-06
gi|50510371|dbj|BAD32171.1| mKIAA0126 protein [Mus musculus] 53 7e-06
gi|50302753|ref|XP_451313.1| unnamed protein product [Kluyveromy... 53 7e-06
gi|28416691|gb|AAO42876.1| At4g08320 [Arabidopsis thaliana] 53 7e-06
gi|22958160|ref|ZP_00005838.1| COG0457: FOG: TPR repeat [Rhodoba... 53 7e-06
gi|28564906|gb|AAO32537.1| TOM70 [Saccharomyces castellii] 53 7e-06
gi|24649785|ref|NP_651289.1| CG6980-PA [Drosophila melanogaster]... 53 7e-06
gi|7487493|pir||T14186 hypothetical protein T28D5.10 - Arabidops... 53 7e-06
gi|23128715|ref|ZP_00110555.1| COG0457: FOG: TPR repeat [Nostoc ... 53 7e-06
gi|42566332|ref|NP_192572.2| tetratricopeptide repeat (TPR)-cont... 53 7e-06
gi|26331970|dbj|BAC29715.1| unnamed protein product [Mus musculus] 53 7e-06
gi|50555658|ref|XP_505237.1| hypothetical protein [Yarrowia lipo... 53 7e-06
gi|47214138|emb|CAG01396.1| unnamed protein product [Tetraodon n... 53 7e-06
gi|50413212|ref|XP_457226.1| unnamed protein product [Debaryomyc... 53 7e-06
gi|47228414|emb|CAG05234.1| unnamed protein product [Tetraodon n... 53 9e-06
gi|31225837|ref|XP_317622.1| ENSANGP00000018424 [Anopheles gambi... 53 9e-06
gi|46250126|gb|AAH68804.1| MGC81394 protein [Xenopus laevis] 53 9e-06
gi|38106300|gb|EAA52627.1| hypothetical protein MG05319.4 [Magna... 53 9e-06
gi|50761537|ref|XP_424754.1| PREDICTED: similar to small glutami... 53 9e-06
gi|50289447|ref|XP_447155.1| unnamed protein product [Candida gl... 53 9e-06
gi|37718894|gb|AAR01765.1| putative ubiquitin conjugation factor... 53 9e-06
gi|14285643|sp|O94826|OM70_HUMAN Mitochondrial precursor protein... 52 1e-05
gi|34868124|ref|XP_221530.2| similar to mKIAA0719 protein [Rattu... 52 1e-05
gi|47058988|ref|NP_997684.1| TOM70 protein [Rattus norvegicus] >... 52 1e-05
gi|7453538|gb|AAF62870.1| Toc64 [Pisum sativum] 52 1e-05
gi|31238885|ref|XP_319871.1| ENSANGP00000010637 [Anopheles gambi... 52 1e-05
gi|40788338|dbj|BAA34439.2| KIAA0719 protein [Homo sapiens] 52 1e-05
gi|48895620|ref|ZP_00328604.1| COG0457: FOG: TPR repeat [Trichod... 52 1e-05
gi|23486551|gb|EAA20828.1| similar to tetratricopeptide repeat d... 52 1e-05
gi|41152392|ref|NP_956296.1| translocase of outer mitochondrial ... 52 1e-05
gi|28972369|dbj|BAC65638.1| mKIAA0719 protein [Mus musculus] 52 1e-05
gi|42476301|ref|NP_055635.2| translocase of outer mitochondrial ... 52 1e-05
gi|14285644|sp|Q9CZW5|OM70_MOUSE Mitochondrial precursor protein... 52 1e-05
gi|27552760|ref|NP_613065.2| DNA segment, Chr 16, Wayne State Un... 52 1e-05
gi|20892953|ref|XP_147172.1| DNA segment, Chr 16, Wayne State Un... 52 1e-05
gi|7487248|pir||T00518 hypothetical protein At2g23140 [imported]... 52 1e-05
gi|48859179|ref|ZP_00313117.1| COG0457: FOG: TPR repeat [Clostri... 52 1e-05
gi|50731787|ref|XP_418360.1| PREDICTED: similar to sperm associa... 52 1e-05
gi|11282501|pir||T43725 ubiquitin fusion degradation protein 2 -... 52 1e-05
gi|46805946|dbj|BAD17240.1| putative Toc64 [Oryza sativa (japoni... 52 1e-05
gi|50421229|ref|XP_459160.1| unnamed protein product [Debaryomyc... 52 1e-05
gi|31202499|ref|XP_310198.1| ENSANGP00000011046 [Anopheles gambi... 52 1e-05
gi|30681980|ref|NP_179895.2| armadillo/beta-catenin repeat famil... 52 1e-05
gi|46109372|ref|XP_381744.1| hypothetical protein FG01568.1 [Gib... 52 1e-05
gi|15893706|ref|NP_347055.1| TPR-repeat-containing protein [Clos... 52 1e-05
gi|19911585|dbj|BAB86896.1| syringolide-induced protein 13-1-1 [... 52 1e-05
gi|31205733|ref|XP_311818.1| ENSANGP00000018230 [Anopheles gambi... 52 1e-05
gi|37530696|ref|NP_919650.1| hypothetical protein [Oryza sativa ... 52 2e-05
gi|37573049|dbj|BAC98577.1| putative arm repeat protein [Oryza s... 52 2e-05
gi|45190383|ref|NP_984637.1| AEL224Wp [Eremothecium gossypii] >g... 52 2e-05
gi|33860566|ref|NP_892127.1| conserved hypothetical protein [Pro... 52 2e-05
gi|42409028|dbj|BAD10281.1| putative Avr9/Cf-9 rapidly elicited ... 52 2e-05
gi|15679902|ref|NP_275211.1| TPR-repeat-containing protein [Meth... 52 2e-05
gi|19115178|ref|NP_594266.1| hypothetical protein [Schizosacchar... 52 2e-05
gi|23479903|gb|EAA16611.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|15240259|ref|NP_198565.1| U-box domain-containing protein [Ar... 52 2e-05
gi|18401867|ref|NP_565676.1| armadillo/beta-catenin repeat famil... 51 3e-05
gi|14334730|gb|AAK59543.1| unknown protein [Arabidopsis thaliana] 51 3e-05
gi|28141004|gb|AAO26213.1| type 5 protein serine/threonine phosp... 51 3e-05
gi|50798980|ref|XP_424047.1| PREDICTED: similar to small glutami... 51 3e-05
gi|15894350|ref|NP_347699.1| TPR-repeat-containing protein [Clos... 51 3e-05
gi|48892684|ref|ZP_00326017.1| COG0457: FOG: TPR repeat [Trichod... 51 3e-05
gi|49388863|dbj|BAD26073.1| putative Avr9/Cf-9 rapidly elicited ... 51 3e-05
gi|19114542|ref|NP_593630.1| ubiquitin fusion degradation protei... 51 3e-05
gi|28974687|gb|AAO61490.1| arm repeat-containing protein [Nicoti... 51 3e-05
gi|15241068|ref|NP_195803.1| armadillo/beta-catenin repeat famil... 51 3e-05
gi|50546495|ref|XP_500717.1| hypothetical protein [Yarrowia lipo... 51 3e-05
gi|24954813|gb|AAN64317.1| type 5 serine/threonine phosphatase 5... 51 3e-05
gi|14582198|gb|AAK69400.1| immediate-early fungal elicitor prote... 51 3e-05
gi|21674651|ref|NP_662716.1| TPR domain protein [Chlorobium tepi... 51 3e-05
gi|46124601|ref|XP_386854.1| hypothetical protein FG06678.1 [Gib... 51 3e-05
gi|14582200|gb|AAK69401.1| immediate-early fungal elicitor prote... 51 3e-05
gi|15678100|ref|NP_275215.1| O-linked GlcNAc transferase [Methan... 51 3e-05
gi|7766910|pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a-Do... 51 3e-05
gi|50546124|ref|XP_500589.1| hypothetical protein [Yarrowia lipo... 51 3e-05
gi|47086921|ref|NP_998455.1| zgc:85806 [Danio rerio] >gnl|BL_ORD... 51 3e-05
gi|38346713|emb|CAE04863.2| OSJNBa0086O06.11 [Oryza sativa (japo... 51 3e-05
gi|20161458|dbj|BAB90382.1| B1065E10.33 [Oryza sativa (japonica ... 51 3e-05
gi|50310599|ref|XP_455319.1| unnamed protein product [Kluyveromy... 51 3e-05
gi|15218585|ref|NP_172526.1| armadillo/beta-catenin repeat famil... 51 3e-05
gi|15237122|ref|NP_192865.1| phosphatase-related [Arabidopsis th... 50 4e-05
gi|478009|pir||C48583 stress-inducible protein STI1 homolog - Le... 50 4e-05
gi|31542709|ref|NP_060338.2| tetratricopeptide repeat domain 12 ... 50 4e-05
gi|42562786|ref|NP_176039.2| serine/threonine protein phosphatas... 50 4e-05
gi|39932542|sp|Q9H892|TTCC_HUMAN Tetratricopeptide repeat protei... 50 4e-05
gi|14324257|dbj|BAB59185.1| hypothetical protein [Thermoplasma v... 50 4e-05
gi|23619476|ref|NP_705438.1| serine/threonine protein phosphatas... 50 4e-05
gi|7489893|pir||T14576 nosA protein - slime mold (Dictyostelium ... 50 4e-05
gi|27311825|gb|AAO00878.1| unknown protein [Arabidopsis thaliana] 50 4e-05
gi|13540875|ref|NP_110563.1| TPR-repeat-containing protein [Ther... 50 4e-05
gi|15219996|ref|NP_173716.1| armadillo/beta-catenin repeat famil... 50 4e-05
gi|29249496|gb|EAA41006.1| GLP_12_20753_18909 [Giardia lamblia A... 50 4e-05
gi|7020708|dbj|BAA91242.1| unnamed protein product [Homo sapiens] 50 4e-05
gi|34863274|ref|XP_236195.2| similar to Ab2-232 [Rattus norvegic... 50 4e-05
gi|15341501|gb|AAK95648.1| serine/threonine protein phosphatase ... 50 4e-05
gi|17223793|gb|AAL15170.1| serine/threonine protein phosphatase ... 50 4e-05
gi|15219271|ref|NP_175737.1| thioredoxin family protein [Arabido... 50 4e-05
gi|34540729|ref|NP_905208.1| TPR domain protein [Porphyromonas g... 50 4e-05
gi|50760226|ref|XP_425812.1| PREDICTED: similar to neural cell a... 50 4e-05
gi|49078258|ref|XP_402900.1| hypothetical protein UM05285.1 [Ust... 50 4e-05
gi|25354711|pir||D86364 hypothetical protein F10G19.3 - Arabidop... 50 4e-05
gi|47210998|emb|CAF95830.1| unnamed protein product [Tetraodon n... 50 4e-05
gi|47207592|emb|CAG02333.1| unnamed protein product [Tetraodon n... 50 6e-05
gi|15219673|ref|NP_171915.1| tetratricopeptide repeat (TPR)-cont... 50 6e-05
gi|44662989|gb|AAS47585.1| chloroplast Toc64-2 [Physcomitrella p... 50 6e-05
gi|15221275|ref|NP_172691.1| stress-inducible protein, putative ... 50 6e-05
gi|31208135|ref|XP_313034.1| ENSANGP00000011234 [Anopheles gambi... 50 6e-05
gi|5926758|dbj|BAA84654.1| Ufd2 homolog [Schizosaccharomyces pombe] 50 6e-05
gi|25012777|gb|AAN71480.1| RE69804p [Drosophila melanogaster] 50 7e-05
gi|42562487|ref|NP_174606.2| tetratricopeptide repeat (TPR)-cont... 50 7e-05
gi|25403187|pir||F86457 unknown protein, 33246-28649 [imported] ... 50 7e-05
gi|47207456|emb|CAF90177.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|31228193|ref|XP_318014.1| ENSANGP00000010730 [Anopheles gambi... 50 7e-05
gi|15231445|ref|NP_190235.1| armadillo/beta-catenin repeat famil... 50 7e-05
gi|47216212|emb|CAG01246.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|47230591|emb|CAF99784.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|48851672|ref|ZP_00305873.1| COG0457: FOG: TPR repeat [Ferropl... 50 7e-05
gi|42567869|ref|NP_568313.2| U-box domain-containing protein [Ar... 50 7e-05
gi|34898308|ref|NP_910500.1| contains ESTs C73147(E2988),AU07541... 50 7e-05
gi|26450409|dbj|BAC42319.1| unknown protein [Arabidopsis thaliana] 50 7e-05
gi|50547717|ref|XP_501328.1| hypothetical protein [Yarrowia lipo... 50 7e-05
gi|49134986|ref|XP_413261.1| hypothetical protein AN9124.2 [Aspe... 50 7e-05
gi|50422491|ref|XP_459813.1| unnamed protein product [Debaryomyc... 49 1e-04
gi|31212273|ref|XP_315121.1| ENSANGP00000015220 [Anopheles gambi... 49 1e-04
gi|40788870|dbj|BAA09475.2| KIAA0126 [Homo sapiens] 49 1e-04
gi|2495703|sp|Q14139|UB4A_HUMAN Ubiquitin conjugation factor E4 A 49 1e-04
gi|46443554|gb|EAL02835.1| hypothetical protein CaO19.9242 [Cand... 49 1e-04
gi|38327029|ref|NP_004779.2| ubiquitination factor E4A; homologo... 49 1e-04
gi|29367591|gb|AAO72657.1| arm repeat protein [Oryza sativa (jap... 49 1e-04
gi|30688702|ref|NP_194777.3| tetratricopeptide repeat (TPR)-cont... 49 1e-04
gi|46575997|gb|AAT01358.1| putative arm repeat protein [Oryza sa... 49 1e-04
gi|47217894|emb|CAG05016.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|46443682|gb|EAL02962.1| hypothetical protein CaO19.1673 [Cand... 49 1e-04
gi|45387793|ref|NP_991251.1| hypothetical protein zgc:77853 [Dan... 49 1e-04
gi|47497788|dbj|BAD19887.1| ankyrin repeat protein E4_8-like [Or... 49 1e-04
gi|6324580|ref|NP_014649.1| Glutamine-rich cytoplasmic protein o... 49 1e-04
gi|12853648|dbj|BAB29805.1| unnamed protein product [Mus musculu... 49 1e-04
gi|15236528|ref|NP_194088.1| phosphatase-related [Arabidopsis th... 49 1e-04
gi|17017308|gb|AAL33611.1| SGT1a [Arabidopsis thaliana] 49 1e-04
gi|37538768|ref|XP_088118.4| similar to heat shock 70kD protein ... 49 1e-04
gi|38605834|emb|CAE02914.3| OSJNBb0108J11.6 [Oryza sativa (japon... 49 1e-04
gi|30523292|gb|AAP31541.1| Hsp70/Hsp90 organizing protein [Droso... 49 1e-04
gi|30523288|gb|AAP31539.1| Hsp70/Hsp90 organizing protein [Droso... 49 1e-04
gi|30523284|gb|AAP31537.1| Hsp70/Hsp90 organizing protein [Droso... 49 1e-04
gi|30523280|gb|AAP31535.1| Hsp70/Hsp90 organizing protein [Droso... 49 1e-04
gi|30523286|gb|AAP31538.1| Hsp70/Hsp90 organizing protein [Droso... 49 1e-04
gi|41053216|dbj|BAD08177.1| putative tetratricopeptide repeat (T... 49 1e-04
gi|15234419|ref|NP_193866.1| U-box domain-containing protein [Ar... 49 1e-04
gi|15606922|ref|NP_214303.1| hypothetical protein aq_1896 [Aquif... 49 1e-04
gi|31560180|ref|NP_080590.2| dyslexia susceptibility 1 candidate... 49 1e-04
gi|31202619|ref|XP_310258.1| ENSANGP00000015274 [Anopheles gambi... 49 1e-04
gi|15238931|ref|NP_199049.1| armadillo/beta-catenin repeat famil... 49 2e-04
gi|33862569|ref|NP_894129.1| TPR repeat [Prochlorococcus marinus... 49 2e-04
gi|50752908|ref|XP_413794.1| PREDICTED: similar to EKN1 [Gallus ... 49 2e-04
gi|48892144|ref|ZP_00325556.1| COG0457: FOG: TPR repeat [Trichod... 49 2e-04
gi|35902760|ref|NP_919343.1| ubiquitination factor E4B, UFD2 hom... 49 2e-04
gi|21537266|gb|AAM61607.1| unknown [Arabidopsis thaliana] 49 2e-04
gi|22331792|ref|NP_191045.2| armadillo/beta-catenin repeat famil... 49 2e-04
gi|39596919|emb|CAE59146.1| Hypothetical protein CBG02451 [Caeno... 49 2e-04
gi|45187969|ref|NP_984192.1| ADR096Cp [Eremothecium gossypii] >g... 49 2e-04
gi|50548309|ref|XP_501624.1| hypothetical protein [Yarrowia lipo... 49 2e-04
gi|48892721|ref|ZP_00326054.1| COG0457: FOG: TPR repeat [Trichod... 49 2e-04
gi|30682691|ref|NP_196504.2| chloroplast outer membrane transloc... 49 2e-04
gi|34864342|ref|XP_343429.1| similar to RIKEN cDNA 1700010I24 [R... 49 2e-04
gi|34864607|ref|XP_217142.2| similar to RIKEN cDNA E330017O07 [R... 48 2e-04
gi|17648033|ref|NP_523584.1| CG4599-PA [Drosophila melanogaster]... 48 2e-04
gi|42526635|ref|NP_971733.1| TPR domain protein [Treponema denti... 48 2e-04
gi|40215983|gb|AAR82810.1| GM02532p [Drosophila melanogaster] 48 2e-04
gi|39581875|emb|CAE60769.1| Hypothetical protein CBG04457 [Caeno... 48 2e-04
gi|26328411|dbj|BAC27944.1| unnamed protein product [Mus musculus] 48 2e-04
gi|6272682|gb|AAF06161.1| TPR-containing protein involved in spe... 48 2e-04
gi|34912674|ref|NP_917684.1| P0686E09.6 [Oryza sativa (japonica ... 48 2e-04
gi|46445042|gb|EAL04313.1| hypothetical protein CaO19.13386 [Can... 48 2e-04
gi|21741126|emb|CAD41926.1| OSJNBa0070M12.4 [Oryza sativa (japon... 48 2e-04
gi|47847630|dbj|BAD22116.1| Avr9/Cf-9 rapidly elicited protein-l... 48 2e-04
gi|24584630|ref|NP_723974.1| CG4599-PB [Drosophila melanogaster]... 48 2e-04
gi|17531933|ref|NP_495087.1| tetratricopeptide repeat 4 (49.0 kD... 48 2e-04
gi|19920838|ref|NP_609060.1| CG11070-PA [Drosophila melanogaster... 48 2e-04
gi|46981302|gb|AAT07620.1| unknown protein [Oryza sativa (japoni... 48 2e-04
gi|50255954|gb|EAL18683.1| hypothetical protein CNBI2710 [Crypto... 48 2e-04
gi|46126035|ref|XP_387571.1| hypothetical protein FG07395.1 [Gib... 48 2e-04
gi|5902398|gb|AAD55500.1| Unknown protein [Arabidopsis thaliana] 48 3e-04
gi|50416668|ref|XP_457569.1| unnamed protein product [Debaryomyc... 48 3e-04
gi|48891770|ref|ZP_00325236.1| COG0457: FOG: TPR repeat [Trichod... 48 3e-04
gi|34907856|ref|NP_915275.1| putative arm repeat containing prot... 48 3e-04
gi|50875257|emb|CAG35097.1| hypothetical protein [Desulfotalea p... 48 3e-04
gi|18402223|ref|NP_566632.1| U-box domain-containing protein [Ar... 48 3e-04
gi|50252669|dbj|BAD28838.1| putative immediate-early fungal elic... 48 3e-04
gi|49257856|gb|AAH74276.1| Unknown (protein for MGC:84046) [Xeno... 48 3e-04
gi|47230714|emb|CAF99907.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|48096483|ref|XP_392467.1| similar to ENSANGP00000012259 [Apis... 48 3e-04
gi|46485190|ref|NP_997493.1| ubiquitin conjugation factor E4 A [... 48 3e-04
gi|48846090|ref|ZP_00300357.1| COG0457: FOG: TPR repeat [Geobact... 48 3e-04
gi|42563127|ref|NP_177258.3| armadillo/beta-catenin repeat famil... 48 3e-04
gi|46228178|gb|EAK89077.1| ubiquitin-fusion degadation-2 (UFD2) ... 48 3e-04
gi|30013679|gb|AAP03882.1| Avr9/Cf-9 rapidly elicited protein 27... 48 3e-04
gi|50259221|gb|EAL21894.1| hypothetical protein CNBC0350 [Crypto... 48 3e-04
gi|18397921|ref|NP_566304.1| armadillo/beta-catenin repeat famil... 47 4e-04
gi|15613825|ref|NP_242128.1| BH1262~unknown conserved protein [B... 47 4e-04
gi|23125541|ref|ZP_00107470.1| COG0457: FOG: TPR repeat [Nostoc ... 47 4e-04
gi|50251218|dbj|BAD27662.1| putative Avr9/Cf-9 rapidly elicited ... 47 4e-04
gi|23612751|ref|NP_704290.1| hypothetical protein [Plasmodium fa... 47 4e-04
gi|48891686|ref|ZP_00325169.1| COG0438: Glycosyltransferase [Tri... 47 4e-04
gi|31213285|ref|XP_315586.1| ENSANGP00000017775 [Anopheles gambi... 47 4e-04
gi|24584835|ref|NP_609842.1| CG5094-PA [Drosophila melanogaster]... 47 4e-04
gi|9955529|emb|CAC05468.1| putative subunit of TOC complex [Arab... 47 4e-04
gi|50312239|ref|XP_456151.1| unnamed protein product [Kluyveromy... 47 4e-04
gi|50750856|ref|XP_422175.1| PREDICTED: similar to hypothetical ... 47 4e-04
gi|38345522|emb|CAE01806.2| OSJNBa0039K24.25 [Oryza sativa (japo... 47 4e-04
gi|5777615|emb|CAB53476.1| CAA30373.1 protein [Oryza sativa] 47 4e-04
gi|48138394|ref|XP_393400.1| similar to small glutamine-rich tet... 47 5e-04
gi|34860666|ref|XP_230832.2| similar to Mitochondrial import rec... 47 5e-04
gi|37535536|ref|NP_922070.1| putative tetratricopeptide repeat p... 47 5e-04
gi|47221056|emb|CAG12750.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|41054551|ref|NP_955904.1| DnaJ (Hsp40) homolog, subfamily C, ... 47 5e-04
gi|16329409|ref|NP_440137.1| mitochondrial outer membrane 72K pr... 47 5e-04
gi|15896250|ref|NP_349599.1| TPR-repeat-containing protein [Clos... 47 5e-04
gi|17381178|gb|AAL36401.1| putative arm repeat-containing protei... 47 5e-04
gi|15218915|ref|NP_174228.1| armadillo/beta-catenin repeat famil... 47 5e-04
gi|30688693|ref|NP_849557.1| tetratricopeptide repeat (TPR)-cont... 47 5e-04
gi|30684733|ref|NP_188424.2| chloroplast outer membrane transloc... 47 5e-04
gi|27370132|ref|NP_766358.1| tetratricopeptide repeat domain 12 ... 47 6e-04
gi|50260162|gb|EAL22823.1| hypothetical protein CNBB0440 [Crypto... 47 6e-04
gi|26345398|dbj|BAC36350.1| unnamed protein product [Mus musculus] 47 6e-04
gi|31210531|ref|XP_314232.1| ENSANGP00000014458 [Anopheles gambi... 47 6e-04
gi|7486895|pir||T04562 hypothetical protein T12H17.60 - Arabidop... 47 6e-04
gi|16330801|ref|NP_441529.1| hypothetical protein [Synechocystis... 47 6e-04
gi|46390655|dbj|BAD16137.1| putative Avr9/Cf-9 rapidly elicited ... 47 6e-04
gi|39996861|ref|NP_952812.1| TPR domain protein [Geobacter sulfu... 47 6e-04
gi|48892813|ref|ZP_00326146.1| COG0457: FOG: TPR repeat [Trichod... 47 6e-04
gi|39545718|emb|CAD40926.3| OSJNBa0033G16.8 [Oryza sativa (japon... 47 6e-04
gi|32411429|ref|XP_326195.1| hypothetical protein [Neurospora cr... 47 6e-04
gi|6321909|ref|NP_011985.1| Translocase of the Outer Mitochondri... 47 6e-04
gi|38345231|emb|CAD41127.2| OSJNBa0084K20.5 [Oryza sativa (japon... 47 6e-04
gi|18415982|ref|NP_567663.1| tetratricopeptide repeat (TPR)-cont... 47 6e-04
gi|15219012|ref|NP_176225.1| armadillo/beta-catenin repeat famil... 47 6e-04
gi|13539578|emb|CAC35703.1| photoperiod responsive protein [Sola... 47 6e-04
gi|33989661|gb|AAH56415.1| FLJ21908 protein [Homo sapiens] 46 8e-04
gi|22749103|ref|NP_689741.1| WD repeat and SAM domain containing... 46 8e-04
gi|13375809|ref|NP_078880.1| hypothetical protein FLJ21908 [Homo... 46 8e-04
gi|28564113|gb|AAO32435.1| TOM71 [Saccharomyces bayanus] 46 8e-04
gi|48847360|ref|ZP_00301616.1| COG0457: FOG: TPR repeat [Geobact... 46 8e-04
gi|49093736|ref|XP_408329.1| hypothetical protein AN4192.2 [Aspe... 46 8e-04
gi|20090225|ref|NP_616300.1| O-linked N-acetylglucosamine transf... 46 8e-04
gi|34854703|ref|XP_342438.1| similar to hypothetical protein FLJ... 46 8e-04
gi|34904036|ref|NP_913365.1| P0665D10.16 [Oryza sativa (japonica... 46 8e-04
gi|48894110|ref|ZP_00327308.1| COG0457: FOG: TPR repeat [Trichod... 46 8e-04
gi|30523282|gb|AAP31536.1| Hsp70/Hsp90 organizing protein [Droso... 46 8e-04
gi|20810487|gb|AAH29520.1| WDSAM1 protein [Homo sapiens] 46 8e-04
gi|24650441|ref|NP_651514.1| CG18472-PA [Drosophila melanogaster... 46 0.001
gi|46250303|gb|AAH68702.1| MGC81126 protein [Xenopus laevis] 46 0.001
gi|47227027|emb|CAG05919.1| unnamed protein product [Tetraodon n... 46 0.001
gi|41107617|gb|AAH65443.1| DnaJ (Hsp40) homolog, subfamily C, me... 46 0.001
gi|19173237|ref|NP_597040.1| hypothetical protein [Encephalitozo... 46 0.001
gi|42527528|ref|NP_972626.1| TPR domain protein [Treponema denti... 46 0.001
gi|18677737|ref|NP_570722.1| dyslexia susceptibility 1 candidate... 46 0.001
gi|38502960|sp|Q863A7|DYX1_PANTR Dyslexia susceptibility 1 candi... 46 0.001
gi|38502958|sp|Q863A5|DYX1_GORGO Dyslexia susceptibility 1 candi... 46 0.001
gi|38502957|sp|Q863A4|DYX1_PONPY Dyslexia susceptibility 1 candi... 46 0.001
gi|38502959|sp|Q863A6|DYX1_PANPA Dyslexia susceptibility 1 candi... 46 0.001
gi|15607128|ref|NP_214510.1| hypothetical protein aq_2197 [Aquif... 45 0.001
gi|897761|emb|CAA61595.1| protein phosphatase 5 [Homo sapiens] 45 0.001
gi|7485874|pir||T00954 hypothetical protein F20D22.4 - Arabidops... 45 0.001
gi|37589898|gb|AAH00750.4| PPP5C protein [Homo sapiens] >gnl|BL_... 45 0.001
gi|48857973|ref|ZP_00311945.1| COG0457: FOG: TPR repeat [Clostri... 45 0.001
gi|39595520|emb|CAE60558.1| Hypothetical protein CBG04187 [Caeno... 45 0.001
gi|17563052|ref|NP_503322.1| stress-induced-phosphoprotein 1 lik... 45 0.001
gi|15222827|ref|NP_176000.1| U-box domain-containing protein [Ar... 45 0.001
gi|13386276|ref|NP_082279.1| RIKEN cDNA 2310042P20 [Mus musculus... 45 0.001
gi|1122931|gb|AAB60384.1| serine-threonine phosphatase 45 0.001
gi|47228811|emb|CAG07543.1| unnamed protein product [Tetraodon n... 45 0.001
gi|47226365|emb|CAG09333.1| unnamed protein product [Tetraodon n... 45 0.001
gi|48099820|ref|XP_394942.1| similar to sperm associated antigen... 45 0.001
gi|19075623|ref|NP_588123.1| activator of Hsp70 and Hsp90 chaper... 45 0.001
gi|25461543|pir||T51996 hypothetical protein stil+ - fission yea... 45 0.001
gi|26451730|dbj|BAC42960.1| unknown protein [Arabidopsis thaliana] 45 0.001
gi|15222819|ref|NP_175400.1| U-box domain-containing protein [Ar... 45 0.001
gi|31377703|ref|NP_078801.2| tetratricopeptide repeat domain 13 ... 45 0.001
gi|5453958|ref|NP_006238.1| protein phosphatase 5, catalytic sub... 45 0.001
gi|50758130|ref|XP_415774.1| PREDICTED: similar to cardiomyopath... 45 0.001
gi|41719589|ref|ZP_00148465.1| COG0457: FOG: TPR repeat [Methano... 45 0.001
gi|47208729|emb|CAF93381.1| unnamed protein product [Tetraodon n... 45 0.001
gi|46390686|dbj|BAD16187.1| putative immediate-early fungal elic... 45 0.001
gi|22761790|dbj|BAC11700.1| unnamed protein product [Homo sapiens] 45 0.001
gi|2135921|pir||S52570 phosphoprotein phosphatase (EC 3.1.3.16) ... 45 0.001
gi|48891084|ref|ZP_00324658.1| COG0457: FOG: TPR repeat [Trichod... 45 0.001
gi|29245443|gb|EAA37081.1| GLP_113_15656_17419 [Giardia lamblia ... 45 0.002
gi|50752675|ref|XP_413706.1| PREDICTED: similar to Bardet-Biedl ... 45 0.002
gi|1399813|gb|AAC64484.1| hTOM34p [Homo sapiens] 45 0.002
gi|28557058|dbj|BAC57494.1| translocase of outer mitochondrial m... 45 0.002
gi|24212072|sp|Q9CYG7|OM34_MOUSE Mitochondrial import receptor s... 45 0.002
gi|48893693|ref|ZP_00326891.1| COG0457: FOG: TPR repeat [Trichod... 45 0.002
gi|33862568|ref|NP_894128.1| TPR repeat [Prochlorococcus marinus... 45 0.002
gi|34868119|ref|XP_217045.2| similar to RIKEN cDNA 2310042P20 [R... 45 0.002
gi|21450231|ref|NP_659087.1| small glutamine-rich tetratricopept... 45 0.002
gi|31745160|ref|NP_853660.1| small glutamine rich protein with t... 45 0.002
gi|21229432|ref|NP_635354.1| O-linked N-acetylglucosamine transf... 45 0.002
gi|38074777|ref|XP_130321.3| RIKEN cDNA 2610014F08 [Mus musculus... 45 0.002
gi|1083755|pir||A55346 phosphoprotein phosphatase (EC 3.1.3.16) ... 45 0.002
gi|18379248|ref|NP_563702.1| tetratricopeptide repeat (TPR)-cont... 45 0.002
gi|50291345|ref|XP_448105.1| unnamed protein product [Candida gl... 45 0.002
gi|50728250|ref|XP_416053.1| PREDICTED: similar to hypothetical ... 45 0.002
gi|13385500|ref|NP_080272.1| translocase of outer mitochondrial ... 45 0.002
gi|28557059|dbj|BAC57495.1| translocase of outer mitochondrial m... 45 0.002
gi|34853708|ref|XP_345339.1| similar to RIKEN cDNA 1200002K10 ge... 45 0.002
gi|50730637|ref|XP_416982.1| PREDICTED: similar to DnaJ (Hsp40) ... 45 0.002
gi|46120081|ref|ZP_00179403.2| COG0457: FOG: TPR repeat [Crocosp... 45 0.002
gi|21674622|ref|NP_662687.1| TPR domain protein [Chlorobium tepi... 45 0.002
gi|33864076|ref|NP_895636.1| TPR repeat [Prochlorococcus marinus... 45 0.002
gi|22327904|ref|NP_680448.1| protein kinase family protein [Arab... 45 0.002
gi|15224775|ref|NP_179531.1| protein kinase family protein [Arab... 45 0.002
gi|42525948|ref|NP_971046.1| TPR domain protein, truncation [Tre... 45 0.002
gi|46390605|dbj|BAD16089.1| MAP kinase-like [Oryza sativa (japon... 45 0.002
gi|48893430|ref|ZP_00326666.1| COG0457: FOG: TPR repeat [Trichod... 45 0.002
gi|38109405|gb|EAA55284.1| hypothetical protein MG06941.4 [Magna... 44 0.003
gi|27380734|ref|NP_772263.1| TPR domain protein [Bradyrhizobium ... 44 0.003
gi|21361356|ref|NP_006800.2| translocase of outer mitochondrial ... 44 0.003
gi|17933746|ref|NP_524946.1| CG8402-PA [Drosophila melanogaster]... 44 0.003
gi|34865251|ref|XP_216713.2| similar to o-linked N-acetylglucosa... 44 0.003
gi|37521471|ref|NP_924848.1| unknown protein [Gloeobacter violac... 44 0.003
gi|24308141|ref|NP_061945.1| small glutamine-rich tetratricopept... 44 0.003
gi|30021458|ref|NP_833089.1| TPR-repeat-containing protein [Baci... 44 0.003
gi|48891183|ref|ZP_00324746.1| COG0457: FOG: TPR repeat [Trichod... 44 0.003
gi|38636778|dbj|BAD03021.1| putative armadillo repeat containing... 44 0.003
gi|28564904|gb|AAO32536.1| TOM70 [Saccharomyces castellii] 44 0.003
>gi|25141381|ref|NP_491781.2| c-term of Hsp70-iNteracting protein,
CHIP family, TPR domains containing protein, related to
hsp70/hsp90 organizing protein (31.1 kD) (chn-1)
[Caenorhabditis elegans]
gi|12276029|gb|AAG50227.1| Hsp70-interacting protein
[Caenorhabditis elegans]
gi|16950456|gb|AAB53012.2| C-term of hsp70-interacting protein
(chip family) protein 1 [Caenorhabditis elegans]
Length = 266
Score = 542 bits (1397), Expect = e-153
Identities = 266/266 (100%), Positives = 266/266 (100%)
Frame = -1
Query: 801 MSSGAEQHNTNGKKCYMNKRYDDAVDHYSKAIKVNPLPKYYQNRAMCYFQLNNLKMTEED 622
MSSGAEQHNTNGKKCYMNKRYDDAVDHYSKAIKVNPLPKYYQNRAMCYFQLNNLKMTEED
Sbjct: 1 MSSGAEQHNTNGKKCYMNKRYDDAVDHYSKAIKVNPLPKYYQNRAMCYFQLNNLKMTEED 60
Query: 621 CKRALELSPNEVKPLYFLGNVFLQSKKYSEAISCLSKALYHNAVITNAPDIENALKRARH 442
CKRALELSPNEVKPLYFLGNVFLQSKKYSEAISCLSKALYHNAVITNAPDIENALKRARH
Sbjct: 61 CKRALELSPNEVKPLYFLGNVFLQSKKYSEAISCLSKALYHNAVITNAPDIENALKRARH 120
Query: 441 QKYEEEESKRIVQDVEFHTYLESLIEKDRQENSENPEELQRADMAKKRLTELTLATQEKR 262
QKYEEEESKRIVQDVEFHTYLESLIEKDRQENSENPEELQRADMAKKRLTELTLATQEKR
Sbjct: 121 QKYEEEESKRIVQDVEFHTYLESLIEKDRQENSENPEELQRADMAKKRLTELTLATQEKR 180
Query: 261 QNREVPEMLCGKITLELMKEPVIVPSGITYDREEIVQHLRRIGHFDPVTRKPLTENEIIP 82
QNREVPEMLCGKITLELMKEPVIVPSGITYDREEIVQHLRRIGHFDPVTRKPLTENEIIP
Sbjct: 181 QNREVPEMLCGKITLELMKEPVIVPSGITYDREEIVQHLRRIGHFDPVTRKPLTENEIIP 240
Query: 81 NYALKEVIEKFLDDNPWAKYEPGGMV 4
NYALKEVIEKFLDDNPWAKYEPGGMV
Sbjct: 241 NYALKEVIEKFLDDNPWAKYEPGGMV 266