Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T09F3_2
(1155 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536171|ref|NP_496236.1| mitochondrial carrier protein c2 (4... 632 e-180
gi|39597158|emb|CAE59385.1| Hypothetical protein CBG02742 [Caeno... 563 e-159
gi|31202109|ref|XP_310002.1| ENSANGP00000015067 [Anopheles gambi... 218 2e-55
gi|19920528|ref|NP_608615.1| CG18317-PA [Drosophila melanogaster... 218 2e-55
gi|50540402|ref|NP_001002667.1| zgc:92447 [Danio rerio] >gnl|BL_... 212 2e-53
gi|15559393|gb|AAH14064.1| Hypothetical protein FLJ10618 [Homo s... 209 1e-52
gi|47216429|emb|CAG01980.1| unnamed protein product [Tetraodon n... 209 1e-52
gi|47224840|emb|CAG06410.1| unnamed protein product [Tetraodon n... 207 4e-52
gi|50752052|ref|XP_422631.1| PREDICTED: similar to Hypothetical ... 206 1e-51
gi|15030091|gb|AAH11293.1| 5730438N18Rik protein [Mus musculus] 205 1e-51
gi|47228784|emb|CAG07516.1| unnamed protein product [Tetraodon n... 205 1e-51
gi|20270293|ref|NP_620095.1| RIKEN cDNA C330005L02 [Mus musculus... 205 1e-51
gi|34784032|gb|AAH56716.1| Zgc:65787 protein [Danio rerio] >gnl|... 205 1e-51
gi|34865800|ref|XP_236557.2| similar to RIKEN cDNA C330005L02 [R... 205 1e-51
gi|14150082|ref|NP_115691.1| mitochondrial carrier protein MGC43... 204 2e-51
gi|41200918|ref|XP_370619.1| similar to mitochondrial carrier pr... 204 4e-51
gi|8922551|ref|NP_060625.1| hypothetical protein FLJ10618 [Homo ... 203 5e-51
gi|34872487|ref|XP_216577.2| similar to 5730438N18Rik protein [R... 200 6e-50
gi|50729450|ref|XP_416521.1| PREDICTED: similar to mitochondrial... 196 7e-49
gi|50759281|ref|XP_417600.1| PREDICTED: similar to mitochondrial... 194 2e-48
gi|50555253|ref|XP_505035.1| hypothetical protein [Yarrowia lipo... 161 3e-38
gi|6319669|ref|NP_009751.1| Protein of the mitochondrial carrier... 156 8e-37
gi|45190354|ref|NP_984608.1| AEL253Wp [Eremothecium gossypii] >g... 154 3e-36
gi|50424283|ref|XP_460728.1| unnamed protein product [Debaryomyc... 154 5e-36
gi|50310009|ref|XP_455018.1| unnamed protein product [Kluyveromy... 152 1e-35
gi|49084592|ref|XP_404483.1| hypothetical protein AN0346.2 [Aspe... 149 9e-35
gi|50294323|ref|XP_449573.1| unnamed protein product [Candida gl... 147 3e-34
gi|46434312|gb|EAK93725.1| hypothetical protein CaO19.11975 [Can... 147 5e-34
gi|46130654|ref|XP_389107.1| hypothetical protein FG08931.1 [Gib... 145 2e-33
gi|26329931|dbj|BAC28704.1| unnamed protein product [Mus musculus] 142 1e-32
gi|46436245|gb|EAK95611.1| hypothetical protein CaO19.8971 [Cand... 141 3e-32
gi|46436144|gb|EAK95512.1| hypothetical protein CaO19.1393 [Cand... 140 4e-32
gi|21312602|ref|NP_081736.1| RIKEN cDNA 5730438N18 [Mus musculus... 140 6e-32
gi|32417256|ref|XP_329106.1| hypothetical protein [Neurospora cr... 140 6e-32
gi|38100630|gb|EAA47731.1| hypothetical protein MG02974.4 [Magna... 137 6e-31
gi|19114979|ref|NP_594067.1| putative mitochondrial carrier prot... 136 1e-30
gi|18395659|ref|NP_564233.1| mitochondrial substrate carrier fam... 134 3e-30
gi|50553226|ref|XP_504023.1| hypothetical protein [Yarrowia lipo... 134 5e-30
gi|18407372|ref|NP_566102.1| mitochondrial substrate carrier fam... 131 3e-29
gi|12007321|gb|AAG45135.1| RIM [Dictyostelium discoideum] 131 3e-29
gi|48141294|ref|XP_393549.1| similar to CG8026-PA [Apis mellifera] 128 2e-28
gi|7487567|pir||T00435 probable mitochondrial carrier protein [i... 127 4e-28
gi|34914648|ref|NP_918671.1| OSJNBa0054L14.23 [Oryza sativa (jap... 127 5e-28
gi|11067279|gb|AAG28807.1| unknown protein [Arabidopsis thaliana] 125 2e-27
gi|50258844|gb|EAL21529.1| hypothetical protein CNBD2230 [Crypto... 125 2e-27
gi|49069642|ref|XP_399110.1| hypothetical protein UM01495.1 [Ust... 124 4e-27
gi|48101126|ref|XP_392647.1| similar to CG18317-PA [Apis mellifera] 123 7e-27
gi|6322185|ref|NP_012260.1| Pvruvate transporter of the mitochon... 122 1e-26
gi|45187865|ref|NP_984088.1| ADL009Wp [Eremothecium gossypii] >g... 121 4e-26
gi|28829745|gb|AAO52248.1| hypothetical protein [Dictyostelium d... 120 6e-26
gi|50414031|ref|XP_457354.1| unnamed protein product [Debaryomyc... 120 8e-26
gi|50257198|gb|EAL19911.1| hypothetical protein CNBG0540 [Crypto... 116 1e-24
gi|50731821|ref|XP_425937.1| PREDICTED: similar to mitochondrial... 114 6e-24
gi|46137559|ref|XP_390471.1| hypothetical protein FG10295.1 [Gib... 113 7e-24
gi|50290719|ref|XP_447792.1| unnamed protein product [Candida gl... 113 1e-23
gi|48374379|gb|AAT42021.1| mitochondrial folate transporter [Cri... 112 1e-23
gi|6320831|ref|NP_010910.1| Hypothetical ORF; Yel006wp [Saccharo... 112 2e-23
gi|27369517|ref|NP_765990.1| mitochondrial folate transporter/ca... 112 2e-23
gi|50307419|ref|XP_453688.1| unnamed protein product [Kluyveromy... 111 3e-23
gi|14042724|dbj|BAB55368.1| unnamed protein product [Homo sapiens] 111 4e-23
gi|47218543|emb|CAF98075.1| unnamed protein product [Tetraodon n... 111 4e-23
gi|34222668|sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporte... 111 4e-23
gi|38106800|gb|EAA53065.1| hypothetical protein MG06193.4 [Magna... 110 5e-23
gi|11545417|gb|AAG37834.1| folate transporter/carrier [Homo sapi... 110 6e-23
gi|21314739|ref|NP_110407.2| mitochondrial folate transporter/ca... 110 6e-23
gi|24652037|ref|NP_724769.1| CG8026-PA [Drosophila melanogaster]... 110 6e-23
gi|34222684|sp|Q95J75|MFTC_MACFA Mitochondrial folate transporte... 110 8e-23
gi|13676520|dbj|BAB41176.1| hypothetical protein [Macaca fascicu... 110 8e-23
gi|18425065|ref|NP_569032.1| mitochondrial substrate carrier fam... 110 8e-23
gi|34866087|ref|XP_235359.2| similar to mitochondrial folate tra... 110 8e-23
gi|21537040|gb|AAM61381.1| contains similarity to peroxisomal me... 109 1e-22
gi|31198539|ref|XP_308217.1| ENSANGP00000009305 [Anopheles gambi... 109 1e-22
gi|19921888|ref|NP_610468.1| CG8026-PB [Drosophila melanogaster]... 108 3e-22
gi|32421779|ref|XP_331333.1| hypothetical protein [Neurospora cr... 106 9e-22
gi|39587208|emb|CAE57676.1| Hypothetical protein CBG00670 [Caeno... 105 2e-21
gi|49079022|ref|XP_403203.1| hypothetical protein UM05588.1 [Ust... 105 3e-21
gi|41053768|ref|NP_956550.1| hypothetical protein MGC55610 [Dani... 103 6e-21
gi|49074840|ref|XP_401526.1| hypothetical protein UM03911.1 [Ust... 103 6e-21
gi|25403521|pir||G86383 probable mitochondrial carrier protein [... 102 2e-20
gi|17534823|ref|NP_495746.1| mitochondrial carrier (2I565) [Caen... 102 2e-20
gi|49094126|ref|XP_408524.1| hypothetical protein AN4387.2 [Aspe... 101 3e-20
gi|50310545|ref|XP_455292.1| unnamed protein product [Kluyveromy... 100 8e-20
gi|50582710|gb|AAT78780.1| mitochondrial carrier protein-like pr... 100 1e-19
gi|34851696|ref|XP_344759.1| similar to hypothetical protein FLJ... 97 7e-19
gi|45190968|ref|NP_985222.1| AER366Wp [Eremothecium gossypii] >g... 97 9e-19
gi|15227718|ref|NP_180577.1| mitochondrial substrate carrier fam... 96 2e-18
gi|42733677|gb|AAS38623.1| hypothetical protein [Dictyostelium d... 95 4e-18
gi|21553549|gb|AAM62642.1| putative mitochondrial carrier protei... 95 4e-18
gi|50260360|gb|EAL23019.1| hypothetical protein CNBA7860 [Crypto... 93 1e-17
gi|25406950|pir||A86205 hypothetical protein [imported] - Arabid... 93 1e-17
gi|46442747|gb|EAL02034.1| hypothetical protein CaO19.13885 [Can... 92 2e-17
gi|50545545|ref|XP_500310.1| hypothetical protein [Yarrowia lipo... 92 2e-17
gi|38103530|gb|EAA50215.1| hypothetical protein MG03974.4 [Magna... 91 4e-17
gi|30687297|ref|NP_181325.2| mitochondrial substrate carrier fam... 91 4e-17
gi|49098358|ref|XP_410639.1| hypothetical protein AN6502.2 [Aspe... 91 5e-17
gi|46125927|ref|XP_387517.1| hypothetical protein FG07341.1 [Gib... 91 7e-17
gi|50545217|ref|XP_500146.1| hypothetical protein [Yarrowia lipo... 91 7e-17
gi|31215685|ref|XP_316075.1| ENSANGP00000022876 [Anopheles gambi... 90 9e-17
gi|15222270|ref|NP_172184.1| mitochondrial substrate carrier fam... 90 9e-17
gi|19112333|ref|NP_595541.1| MC FAD transporter [Schizosaccharom... 89 3e-16
gi|50405851|ref|XP_456566.1| unnamed protein product [Debaryomyc... 88 4e-16
gi|9651152|dbj|BAB03581.1| hypothetical protein [Macaca fascicul... 87 7e-16
gi|14388376|dbj|BAB60743.1| hypothetical protein [Macaca fascicu... 87 1e-15
gi|15225602|ref|NP_181526.1| peroxisomal membrane protein (PMP36... 87 1e-15
gi|21593883|gb|AAM65850.1| putative peroxisomal membrane carrier... 87 1e-15
gi|13278624|gb|AAH04098.1| C330005L02Rik protein [Mus musculus] 85 4e-15
gi|47085863|ref|NP_998284.1| zgc:64212 [Danio rerio] >gnl|BL_ORD... 84 5e-15
gi|25295875|pir||D84798 probable mitochondrial carrier protein [... 84 5e-15
gi|27662946|ref|XP_216993.1| similar to PMP34 protein [Rattus no... 84 6e-15
gi|17158033|ref|NP_080607.2| mitochondrial solute carrier protei... 84 6e-15
gi|29789024|ref|NP_035529.1| solute carrier family 25 (mitochond... 84 8e-15
gi|19114613|ref|NP_593701.1| putative mitochondrial carrier prot... 83 1e-14
gi|50292295|ref|XP_448580.1| unnamed protein product [Candida gl... 83 1e-14
gi|31198821|ref|XP_308358.1| ENSANGP00000019092 [Anopheles gambi... 83 1e-14
gi|5453918|ref|NP_006349.1| solute carrier family 25 (mitochondr... 83 1e-14
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam... 83 1e-14
gi|6322057|ref|NP_012132.1| Protein required for transport of fl... 82 2e-14
gi|34874384|ref|XP_224361.2| similar to mitochondrial solute car... 82 2e-14
gi|50547439|ref|XP_501189.1| hypothetical protein [Yarrowia lipo... 82 2e-14
gi|10177519|dbj|BAB10914.1| unnamed protein product [Arabidopsis... 82 2e-14
gi|21357737|ref|NP_651600.1| CG4963-PA [Drosophila melanogaster]... 82 2e-14
gi|50759536|ref|XP_417682.1| PREDICTED: similar to mitochondrial... 82 2e-14
gi|50288641|ref|XP_446750.1| unnamed protein product [Candida gl... 82 2e-14
gi|15220023|ref|NP_178108.1| mitochondrial substrate carrier fam... 82 2e-14
gi|50728698|ref|XP_416242.1| PREDICTED: similar to Peroxisomal m... 82 3e-14
gi|34901996|ref|NP_912344.1| unknown protein [Oryza sativa (japo... 81 4e-14
gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21 ... 81 4e-14
gi|10946712|ref|NP_067351.1| peroxisomal integral membrane prote... 81 5e-14
gi|11277067|pir||T45934 hypothetical protein F5K20.240 - Arabido... 81 5e-14
gi|28703800|gb|AAH47312.1| SLC25A28 protein [Homo sapiens] 80 7e-14
gi|12666720|emb|CAC27996.1| mitochondrial RNA splicing protein 3... 80 7e-14
gi|50419543|ref|XP_458298.1| unnamed protein product [Debaryomyc... 80 7e-14
gi|24657533|ref|NP_728982.1| CG32250-PA [Drosophila melanogaster... 80 9e-14
gi|32412508|ref|XP_326734.1| hypothetical protein ( (AL513442) p... 79 2e-13
gi|25012556|gb|AAN71379.1| RE36975p [Drosophila melanogaster] 79 2e-13
gi|21553115|ref|NP_660138.1| solute carrier family 25, member 28... 79 2e-13
gi|21309945|gb|AAM46110.1| MRS3/4 [Mus musculus] 79 2e-13
gi|21593041|gb|AAM64990.1| putative carnitine/acylcarnitine tran... 79 2e-13
gi|4138581|emb|CAA67107.1| mitochondrial energy transfer protein... 79 3e-13
gi|34394749|dbj|BAC84113.1| putative mitochondrial carrier prote... 79 3e-13
gi|31206027|ref|XP_311965.1| ENSANGP00000011014 [Anopheles gambi... 79 3e-13
gi|38105554|gb|EAA51969.1| hypothetical protein MG03564.4 [Magna... 78 3e-13
gi|47223331|emb|CAF98715.1| unnamed protein product [Tetraodon n... 78 3e-13
gi|47086479|ref|NP_997947.1| solute carrier family 25 (mitochond... 78 3e-13
gi|47211393|emb|CAF90629.1| unnamed protein product [Tetraodon n... 78 4e-13
gi|32405814|ref|XP_323520.1| related to FAD carrier protein FLX1... 78 4e-13
gi|34895726|ref|NP_909212.1| putative peroxisomal Ca-dependent s... 78 4e-13
gi|49250385|gb|AAH74516.1| Unknown (protein for MGC:69279) [Xeno... 78 4e-13
gi|6325278|ref|NP_015346.1| Mitochondrial transporter, acts both... 77 6e-13
gi|15241360|ref|NP_199918.1| mitochondrial substrate carrier fam... 77 6e-13
gi|11360341|pir||T50686 peroxisomal Ca-dependent solute carrier ... 77 6e-13
gi|33598954|ref|NP_037518.2| solute carrier family 25 member 24 ... 77 8e-13
gi|27369581|ref|NP_766024.1| solute carrier family 25 (mitochond... 77 1e-12
gi|47458041|ref|NP_998816.1| solute carrier family 25 member 24 ... 76 1e-12
gi|46125507|ref|XP_387307.1| hypothetical protein FG07131.1 [Gib... 76 1e-12
gi|46249805|gb|AAH68561.1| Solute carrier family 25 member 24, i... 76 1e-12
gi|45710075|gb|AAH14519.1| Solute carrier family 25 member 24, i... 76 1e-12
gi|50309099|ref|XP_454555.1| unnamed protein product [Kluyveromy... 76 1e-12
gi|33417112|gb|AAH56033.1| MGC68982 protein [Xenopus laevis] 76 2e-12
gi|21361103|ref|NP_003696.2| solute carrier family 25 (mitochond... 76 2e-12
gi|50809127|ref|XP_429004.1| PREDICTED: similar to mitochondrial... 76 2e-12
gi|32421511|ref|XP_331199.1| hypothetical protein [Neurospora cr... 76 2e-12
gi|34902034|ref|NP_912363.1| putative peroxisomal Ca-dependent s... 76 2e-12
gi|15228163|ref|NP_191123.1| mitochondrial substrate carrier fam... 76 2e-12
gi|50259074|gb|EAL21751.1| hypothetical protein CNBC4530 [Crypto... 76 2e-12
gi|48843809|gb|AAT47068.1| putative peroxisomal Ca-dependent sol... 76 2e-12
gi|34866642|ref|XP_217295.2| similar to hypothetical protein MGC... 75 2e-12
gi|50749663|ref|XP_421702.1| PREDICTED: similar to Solute carrie... 75 2e-12
gi|1518458|gb|AAB19037.1| mitochondrial solute carrier 75 2e-12
gi|46445003|gb|EAL04274.1| hypothetical protein CaO19.13347 [Can... 75 2e-12
gi|27803005|emb|CAD60708.1| unnamed protein product [Podospora a... 75 2e-12
gi|47156872|gb|AAT12275.1| plastidial ADP-glucose transporter [H... 75 3e-12
gi|28828299|gb|AAO50963.1| similar to Mus musculus (Mouse). Calc... 75 3e-12
gi|3378495|emb|CAA07568.1| Mitochondrial carrier protein [Ribes ... 75 3e-12
gi|45387539|ref|NP_991112.1| Unknown (protein for MGC:77742); wu... 75 3e-12
gi|21554682|gb|AAM63657.1| Ca-dependent solute carrier-like prot... 74 5e-12
gi|32414381|ref|XP_327670.1| hypothetical protein [Neurospora cr... 74 5e-12
gi|50293227|ref|XP_449025.1| unnamed protein product [Candida gl... 74 5e-12
gi|47218016|emb|CAG11421.1| unnamed protein product [Tetraodon n... 74 5e-12
gi|24650120|ref|NP_651415.1| CG4743-PA [Drosophila melanogaster]... 74 6e-12
gi|6325268|ref|NP_015336.1| Hypothetical ORF; Ypr011cp [Saccharo... 74 6e-12
gi|38083666|ref|XP_111757.2| mutant ornithine transporter 2 [Mus... 74 6e-12
gi|13124050|sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial c... 74 6e-12
gi|48139350|ref|XP_396995.1| similar to ENSANGP00000019092 [Apis... 74 6e-12
gi|27369998|ref|NP_766273.1| calcium-binding transporter; solute... 74 6e-12
gi|33286910|gb|AAH55369.1| Calcium-binding transporter [Mus musc... 74 6e-12
gi|48102809|ref|XP_395435.1| similar to kelch-like 10 [Apis mell... 74 6e-12
gi|13445630|gb|AAK26321.1| mutant ornithine transporter 2 [Mus m... 74 6e-12
gi|1469543|gb|AAC49383.1| peroxisome membrane protein 47 74 6e-12
gi|2497991|sp|Q00319|P47B_CANBO Peroxisomal membrane protein PMP... 74 6e-12
gi|22034628|gb|AAL13117.1| putative inner membrane solute transp... 74 8e-12
gi|25152391|ref|NP_510081.2| solute carrier (XN17) [Caenorhabdit... 74 8e-12
gi|15240999|ref|NP_195770.1| mitochondrial substrate carrier fam... 74 8e-12
gi|21592525|gb|AAM64475.1| putative carrier protein [Arabidopsis... 74 8e-12
gi|48096652|ref|XP_392496.1| similar to ENSANGP00000018542 [Apis... 73 1e-11
gi|50291791|ref|XP_448328.1| unnamed protein product [Candida gl... 73 1e-11
gi|47086085|ref|NP_998422.1| zgc:77454 [Danio rerio] >gnl|BL_ORD... 73 1e-11
gi|50419171|ref|XP_458108.1| unnamed protein product [Debaryomyc... 73 1e-11
gi|50257137|gb|EAL19852.1| hypothetical protein CNBG1450 [Crypto... 73 1e-11
gi|26331858|dbj|BAC29659.1| unnamed protein product [Mus musculu... 73 1e-11
gi|8132784|gb|AAF73387.1| unknown [Drosophila melanogaster] 73 1e-11
gi|47222529|emb|CAG02894.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|34860155|ref|XP_227597.2| similar to calcium-binding transpor... 73 1e-11
gi|45187824|ref|NP_984047.1| ADL049Wp [Eremothecium gossypii] >g... 72 2e-11
gi|27369824|ref|NP_766165.1| solute carrier family 25 (mitochond... 72 2e-11
gi|49079746|ref|XP_403484.1| hypothetical protein UM05869.1 [Ust... 72 2e-11
gi|15231063|ref|NP_190755.1| mitochondrial substrate carrier fam... 72 2e-11
gi|31216089|ref|XP_316164.1| ENSANGP00000020391 [Anopheles gambi... 72 2e-11
gi|130357|sp|P21245|P47A_CANBO Peroxisomal membrane protein PMP4... 72 2e-11
gi|19113869|ref|NP_592957.1| MC transporter of unknown specifici... 72 2e-11
gi|49129632|ref|XP_412922.1| hypothetical protein AN8785.2 [Aspe... 72 2e-11
gi|15234063|ref|NP_192019.1| mitochondrial substrate carrier fam... 72 2e-11
gi|37748220|gb|AAH59349.1| MGC69168 protein [Xenopus laevis] 72 2e-11
gi|48734648|gb|AAH72270.1| Unknown (protein for IMAGE:4408521) [... 72 2e-11
gi|50307493|ref|XP_453726.1| unnamed protein product [Kluyveromy... 72 2e-11
gi|50732673|ref|XP_425987.1| PREDICTED: similar to Calcium-bindi... 72 2e-11
gi|46435410|gb|EAK94792.1| hypothetical protein CaO19.4447 [Cand... 72 2e-11
gi|49068770|ref|XP_398674.1| hypothetical protein UM01059.1 [Ust... 72 2e-11
gi|39592080|emb|CAE75300.1| Hypothetical protein CBG23270 [Caeno... 72 3e-11
gi|1518456|gb|AAB19036.1| mitochondrial solute carrier 72 3e-11
gi|19920986|ref|NP_609270.1| CG9582-PA [Drosophila melanogaster]... 72 3e-11
gi|50405213|ref|YP_054305.1| Mitochondrial carrier protein, puta... 72 3e-11
gi|50304167|ref|XP_452033.1| unnamed protein product [Kluyveromy... 72 3e-11
gi|15240756|ref|NP_196349.1| mitochondrial substrate carrier fam... 72 3e-11
gi|50757414|ref|XP_415513.1| PREDICTED: similar to mitochondrial... 71 4e-11
gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697) [Caenorhab... 71 4e-11
gi|38111079|gb|EAA56711.1| hypothetical protein MG07066.4 [Magna... 71 4e-11
gi|46105360|ref|XP_380484.1| hypothetical protein FG00308.1 [Gib... 71 4e-11
gi|27682801|ref|XP_226032.1| similar to mutant ornithine transpo... 71 4e-11
gi|12849571|dbj|BAB28397.1| unnamed protein product [Mus musculu... 71 5e-11
gi|7657583|ref|NP_056644.1| solute carrier family 25 (mitochondr... 71 5e-11
gi|45185946|ref|NP_983662.1| ACR260Wp [Eremothecium gossypii] >g... 71 5e-11
gi|6321533|ref|NP_011610.1| Tpc1p is a transporter that catalyze... 71 5e-11
gi|50750910|ref|XP_422180.1| PREDICTED: similar to Solute carrie... 71 5e-11
gi|50554903|ref|XP_504860.1| hypothetical protein [Yarrowia lipo... 71 5e-11
gi|16741519|gb|AAH16571.1| Slc25a13 protein [Mus musculus] 71 5e-11
gi|7657581|ref|NP_055066.1| solute carrier family 25, member 13 ... 70 7e-11
gi|22002963|emb|CAD43091.1| mitochondrial aspartate-glutamate ca... 70 7e-11
gi|12833101|dbj|BAB22390.1| unnamed protein product [Mus musculus] 70 7e-11
gi|18424512|ref|NP_568940.1| mitochondrial substrate carrier fam... 70 7e-11
gi|46329911|gb|AAH68966.1| LOC398157 protein [Xenopus laevis] 70 7e-11
gi|21728406|ref|NP_663710.1| mitochondrial Ca2+-dependent solute... 70 9e-11
gi|39930485|ref|NP_443133.1| solute carrier family 25 (mitochond... 70 9e-11
gi|48290293|emb|CAF04495.1| small calcium-binding mitochondrial ... 70 9e-11
gi|48290299|emb|CAF04498.1| small calcium-binding mitochondrial ... 70 9e-11
gi|50290697|ref|XP_447781.1| unnamed protein product [Candida gl... 70 9e-11
gi|38197071|gb|AAH05163.2| SLC25A25 protein [Homo sapiens] 70 9e-11
gi|15620851|dbj|BAB67789.1| KIAA1896 protein [Homo sapiens] 70 9e-11
gi|47109344|emb|CAF04060.1| mitochondrial ATP-Mg/Pi carrier [Hom... 70 9e-11
gi|24638958|ref|NP_569856.2| CG5254-PA [Drosophila melanogaster]... 70 9e-11
gi|48290295|emb|CAF04496.1| small calcium-binding mitochondrial ... 70 9e-11
gi|15236140|ref|NP_194348.1| mitochondrial substrate carrier fam... 70 1e-10
gi|47228316|emb|CAG07711.1| unnamed protein product [Tetraodon n... 70 1e-10
gi|39596351|emb|CAE69989.1| Hypothetical protein CBG16392 [Caeno... 70 1e-10
gi|46108312|ref|XP_381214.1| hypothetical protein FG01038.1 [Gib... 70 1e-10
gi|27694811|gb|AAH43993.1| LOC398474 protein [Xenopus laevis] 70 1e-10
gi|18490466|gb|AAH22637.1| Slc25a24 protein [Mus musculus] 70 1e-10
gi|6523256|emb|CAB62206.1| aralar2 [Homo sapiens] 70 1e-10
gi|50554181|ref|XP_504499.1| hypothetical protein [Yarrowia lipo... 69 2e-10
gi|28830044|gb|AAO52534.1| similar to Plasmodium falciparum (iso... 69 2e-10
gi|50292577|ref|XP_448721.1| unnamed protein product [Candida gl... 69 2e-10
gi|34903084|ref|NP_912889.1| unnamed protein product [Oryza sati... 69 2e-10
gi|47221229|emb|CAG13165.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|13994341|ref|NP_114153.1| solute carrier family 25 member 2; ... 69 2e-10
gi|6322905|ref|NP_012978.1| Mitochondrial iron transporter of th... 69 2e-10
gi|6322328|ref|NP_012402.1| Mitochondrial iron transporter of th... 69 2e-10
gi|49079674|ref|XP_403456.1| hypothetical protein UM05841.1 [Ust... 69 2e-10
gi|32405390|ref|XP_323308.1| hypothetical protein [Neurospora cr... 69 2e-10
gi|3994|emb|CAA39830.1| MRS3 protein [Saccharomyces cerevisiae] 69 2e-10
gi|49070216|ref|XP_399397.1| hypothetical protein UM01782.1 [Ust... 69 2e-10
gi|50309281|ref|XP_454647.1| unnamed protein product [Kluyveromy... 69 3e-10
gi|26340134|dbj|BAC33730.1| unnamed protein product [Mus musculu... 69 3e-10
gi|18043565|gb|AAH19978.1| Slc25a25 protein [Mus musculus] >gnl|... 69 3e-10
gi|24651387|ref|NP_733364.1| CG2139-PC [Drosophila melanogaster]... 69 3e-10
gi|31560754|ref|NP_666230.2| mitochondrial Ca2+-dependent solute... 69 3e-10
gi|19424330|ref|NP_598298.1| solute carrier family 25 (mitochond... 69 3e-10
gi|231654|sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast pre... 69 3e-10
gi|39979123|emb|CAE85498.1| probable succinate-fumarate transpor... 69 3e-10
gi|23574792|dbj|BAC20608.1| solute carrier family 25 member 13 [... 69 3e-10
gi|10048462|ref|NP_065266.1| carnitine/acylcarnitine translocase... 69 3e-10
gi|32418256|ref|XP_329606.1| hypothetical protein [Neurospora cr... 69 3e-10
gi|34904170|ref|NP_913432.1| putative carnitine/acylcarnitine tr... 69 3e-10
gi|45552009|ref|NP_733366.2| CG2139-PB [Drosophila melanogaster]... 69 3e-10
gi|28972868|dbj|BAC65850.1| mKIAA1896 protein [Mus musculus] 69 3e-10
gi|28571261|ref|NP_788934.1| CG33075-PA [Drosophila melanogaster... 69 3e-10
gi|38101933|gb|EAA48831.1| hypothetical protein MG00489.4 [Magna... 69 3e-10
gi|24651389|ref|NP_651795.2| CG2139-PA [Drosophila melanogaster]... 69 3e-10
gi|44890495|gb|AAH66998.1| Slc25a25 protein [Mus musculus] 69 3e-10
gi|31238945|ref|XP_319886.1| ENSANGP00000010634 [Anopheles gambi... 68 4e-10
gi|50288141|ref|XP_446499.1| unnamed protein product [Candida gl... 68 4e-10
gi|46227631|gb|EAK88566.1| mitochondrial carrier protein, Flx1p ... 68 4e-10
gi|50551655|ref|XP_503302.1| hypothetical protein [Yarrowia lipo... 68 4e-10
gi|27694786|gb|AAH43827.1| Slc25a20-prov protein [Xenopus laevis] 68 4e-10
gi|22266728|gb|AAM94902.1| ornithine transporter 2 [Homo sapiens] 68 4e-10
gi|31208625|ref|XP_313279.1| ENSANGP00000011068 [Anopheles gambi... 68 4e-10
gi|31127297|gb|AAH52871.1| Carnitine/acylcarnitine translocase [... 68 4e-10
gi|15341990|gb|AAH13194.1| Hypothetical protein FLJ20551 [Homo s... 68 4e-10
gi|49092732|ref|XP_407827.1| hypothetical protein AN3690.2 [Aspe... 68 4e-10
gi|17554004|ref|NP_497274.1| solute carrier family 25 member 13 ... 68 5e-10
gi|21450145|ref|NP_659042.1| cDNA sequence BC010801 [Mus musculu... 68 5e-10
gi|19173788|ref|NP_596909.1| solute carrier family 25 (mitochond... 68 5e-10
gi|15238315|ref|NP_201302.1| mitochondrial substrate carrier fam... 68 5e-10
gi|38372886|sp|Q9BXI2|ORT2_HUMAN Mitochondrial ornithine transpo... 68 5e-10
gi|46440543|gb|EAK99848.1| hypothetical protein CaO19.13633 [Can... 68 5e-10
gi|46444126|gb|EAL03403.1| hypothetical protein CaO19.4966 [Cand... 68 5e-10
gi|17561410|ref|NP_505970.1| solute carrier (5M253) [Caenorhabdi... 68 5e-10
gi|39597270|emb|CAE59498.1| Hypothetical protein CBG02884 [Caeno... 67 6e-10
gi|16758854|ref|NP_446417.1| solute carrier family 25 (carnitine... 67 6e-10
gi|46136699|ref|XP_390041.1| conserved hypothetical protein [Gib... 67 6e-10
gi|47223313|emb|CAF98697.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|31200401|ref|XP_309148.1| ENSANGP00000018542 [Anopheles gambi... 67 8e-10
gi|50302945|ref|XP_451410.1| unnamed protein product [Kluyveromy... 67 8e-10
gi|24663279|ref|NP_729803.1| CG32103-PC [Drosophila melanogaster... 67 8e-10
gi|50428213|ref|XP_459760.1| unnamed protein product [Debaryomyc... 67 8e-10
gi|16549529|dbj|BAB70825.1| unnamed protein product [Homo sapiens] 67 8e-10
gi|31217942|ref|XP_316535.1| ENSANGP00000009995 [Anopheles gambi... 67 8e-10
gi|45360847|ref|NP_989099.1| carnitine/acylcarnitine translocase... 67 8e-10
gi|46437495|gb|EAK96840.1| hypothetical protein CaO19.417 [Candi... 67 8e-10
gi|48476342|ref|NP_077008.2| solute carrier family 25 (mitochond... 67 8e-10
gi|39588024|emb|CAE57255.1| Hypothetical protein CBG00135 [Caeno... 67 8e-10
gi|41053632|ref|NP_957153.1| hypothetical protein MGC77760 [Dani... 67 8e-10
gi|12056127|emb|CAC21237.1| peroxisomal membrane protein PMP34 [... 67 8e-10
gi|50310411|ref|XP_455225.1| unnamed protein product [Kluyveromy... 67 8e-10
gi|24663275|ref|NP_729802.1| CG32103-PB [Drosophila melanogaster... 67 8e-10
gi|49095890|ref|XP_409406.1| hypothetical protein AN5269.2 [Aspe... 67 8e-10
gi|6523177|emb|CAB62169.1| ARALAR 1 protein [Drosophila melanoga... 67 8e-10
gi|8923520|ref|NP_060345.1| hypothetical protein FLJ20551 [Homo ... 67 1e-09
gi|45361479|ref|NP_989316.1| hypothetical protein MGC76123 [Xeno... 67 1e-09
gi|32416224|ref|XP_328590.1| hypothetical protein [Neurospora cr... 67 1e-09
gi|45198665|ref|NP_985694.1| AFR147Cp [Eremothecium gossypii] >g... 67 1e-09
gi|27694792|gb|AAH43834.1| Mcsc-pending-prov protein [Xenopus la... 67 1e-09
gi|46390391|dbj|BAD15855.1| putative Mcsc-pending-prov protein [... 66 1e-09
gi|46390080|dbj|BAD15497.1| putative Brittle-1 protein, chloropl... 66 2e-09
gi|46437608|gb|EAK96951.1| hypothetical protein CaO19.9724 [Cand... 65 2e-09
gi|50748440|ref|XP_421247.1| PREDICTED: similar to solute carrie... 65 2e-09
gi|47210853|emb|CAF89719.1| unnamed protein product [Tetraodon n... 65 3e-09
gi|2226436|gb|AAB61765.1| LA-MSC [Oxytricha fallax] 65 3e-09
gi|50754473|ref|XP_414400.1| PREDICTED: similar to Slc25a20-prov... 65 3e-09
gi|15241291|ref|NP_196908.1| mitochondrial phosphate transporter... 65 3e-09
gi|49274632|ref|NP_080153.2| RIKEN cDNA 2310067G05 [Mus musculus... 65 3e-09
gi|49093912|ref|XP_408417.1| hypothetical protein AN4280.2 [Aspe... 65 3e-09
gi|34867789|ref|XP_234550.2| similar to chromosome 14 open readi... 65 3e-09
gi|11358614|pir||T51595 phosphate transport protein, mitochondri... 65 3e-09
gi|20149598|ref|NP_036272.2| solute carrier family 25 (mitochond... 65 4e-09
gi|6322729|ref|NP_012802.1| Mitochondrial inner membrane transpo... 65 4e-09
gi|31340019|sp|Q8N8R3|CACL_HUMAN Mitchondrial carnitine/acylcarn... 65 4e-09
gi|4557403|ref|NP_000378.1| carnitine/acylcarnitine translocase;... 65 4e-09
gi|5851675|emb|CAB55356.1| carnitine/acylcarnitine translocase [... 65 4e-09
gi|25513705|pir||G89667 protein F17E5.2 [imported] - Caenorhabdi... 65 4e-09
gi|7499323|pir||T21074 hypothetical protein F17E5.2 - Caenorhabd... 65 4e-09
gi|28193150|emb|CAD62317.1| unnamed protein product [Homo sapiens] 65 4e-09
gi|49899706|gb|AAH76734.1| Unknown (protein for MGC:81365) [Xeno... 65 4e-09
gi|47229664|emb|CAG06860.1| unnamed protein product [Tetraodon n... 65 4e-09
gi|31044469|ref|NP_851845.1| solute carrier family 25, member 29... 64 5e-09
gi|13879465|gb|AAH06711.1| Solute carrier family 25 (mitochondri... 64 5e-09
gi|30424808|ref|NP_780403.1| solute carrier family 25 (mitochond... 64 5e-09
gi|19115553|ref|NP_594641.1| agpet8 protein. [Schizosaccharomyce... 64 5e-09
gi|50732900|ref|XP_418818.1| PREDICTED: similar to Hypothetical ... 64 5e-09
gi|17536687|ref|NP_496447.1| mitochondrial solute carrier (34.1 ... 64 7e-09
gi|39586413|emb|CAE74071.1| Hypothetical protein CBG21724 [Caeno... 64 7e-09
gi|20130387|ref|NP_611977.1| CG2857-PA [Drosophila melanogaster]... 64 7e-09
gi|45201049|ref|NP_986619.1| AGL047Cp [Eremothecium gossypii] >g... 64 7e-09
gi|50748698|ref|XP_421367.1| PREDICTED: similar to AI132487 prot... 64 7e-09
gi|13449279|ref|NP_085134.1| solute carrier family 25 (mitochond... 64 7e-09
gi|47123004|gb|AAH70665.1| MGC82285 protein [Xenopus laevis] 64 9e-09
gi|42563311|ref|NP_565171.3| mitochondrial substrate carrier fam... 64 9e-09
gi|23574715|dbj|BAC20586.1| mitochondrial carnitine/acylcarnitin... 64 9e-09
gi|27807213|ref|NP_777097.1| solute carrier family 25, member 16... 64 9e-09
gi|50251364|dbj|BAD28391.1| mitochondrial substrate carrier prot... 64 9e-09
gi|34852478|ref|XP_342130.1| similar to solute carrier family 25... 64 9e-09
gi|49109931|ref|XP_411706.1| hypothetical protein AN7569.2 [Aspe... 64 9e-09
gi|399538|sp|P16260|GDC_HUMAN Grave's disease carrier protein (G... 64 9e-09
gi|50730839|ref|XP_417040.1| PREDICTED: hypothetical protein XP_... 64 9e-09
gi|25406546|pir||B96811 hypothetical protein T11I11.12 [imported... 64 9e-09
gi|50289063|ref|XP_446961.1| unnamed protein product [Candida gl... 63 1e-08
gi|6179584|emb|CAB59892.1| dicarboxylate carrier protein [Homo s... 63 1e-08
gi|46443782|gb|EAL03061.1| hypothetical protein CaO19.3931 [Cand... 63 1e-08
gi|19115195|ref|NP_594283.1| mitochondial carrier protein; putat... 63 1e-08
gi|18399114|ref|NP_564436.1| mitochondrial substrate carrier fam... 63 1e-08
gi|50285479|ref|XP_445168.1| unnamed protein product [Candida gl... 63 1e-08
gi|46124377|ref|XP_386742.1| conserved hypothetical protein [Gib... 63 1e-08
gi|7522500|pir||T39385 probable mitochondrial carrier protein - ... 63 1e-08
gi|19112744|ref|NP_595952.1| putative mitochondrial carrier prot... 63 1e-08
gi|49096956|ref|XP_409938.1| hypothetical protein AN5801.2 [Aspe... 63 1e-08
gi|49084384|ref|XP_404394.1| hypothetical protein AN0257.2 [Aspe... 63 1e-08
gi|32414543|ref|XP_327751.1| hypothetical protein [Neurospora cr... 63 1e-08
gi|49093852|ref|XP_408387.1| hypothetical protein AN4250.2 [Aspe... 63 1e-08
gi|6323818|ref|NP_013889.1| Hypothetical ORF; Ymr166cp [Saccharo... 63 1e-08
gi|6746567|gb|AAF27626.1| hydrogenosomal membrane protein 31 pre... 63 1e-08
gi|34863024|ref|XP_215249.2| similar to putative mitochondrial s... 63 1e-08
gi|12061241|gb|AAG45489.1| 36I5.1 [Oryza sativa (japonica cultiv... 63 1e-08
gi|50259176|gb|EAL21851.1| hypothetical protein CNBC4240 [Crypto... 62 2e-08
gi|50552474|ref|XP_503647.1| hypothetical protein [Yarrowia lipo... 62 2e-08
gi|50294652|ref|XP_449737.1| unnamed protein product [Candida gl... 62 2e-08
gi|39589858|emb|CAE60856.1| Hypothetical protein CBG04567 [Caeno... 62 2e-08
gi|6322555|ref|NP_012629.1| Mitochondrial succinate-fumarate tra... 62 2e-08
gi|6325123|ref|NP_015191.1| Mitochondrial inner membrane transpo... 62 2e-08
gi|27544933|ref|NP_689920.1| solute carrier family 25, member 16... 62 2e-08
gi|50754517|ref|XP_414419.1| PREDICTED: similar to S-adenosylmet... 62 2e-08
gi|12854235|dbj|BAB29969.1| unnamed protein product [Mus musculu... 62 3e-08
gi|49069166|ref|XP_398872.1| hypothetical protein UM01257.1 [Ust... 62 3e-08
gi|7305501|ref|NP_038798.1| solute carrier family 25 (mitochondr... 62 3e-08
gi|20137668|sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carr... 62 3e-08
gi|31200787|ref|XP_309341.1| ENSANGP00000008222 [Anopheles gambi... 62 3e-08
gi|27673563|ref|XP_224969.1| similar to ornithine transporter [R... 62 3e-08
gi|3991|emb|CAA29582.1| unnamed protein product [Saccharomyces c... 62 3e-08
gi|47218453|emb|CAG03725.1| unnamed protein product [Tetraodon n... 62 3e-08
gi|19920862|ref|NP_609093.1| CG3476-PA [Drosophila melanogaster]... 62 3e-08
gi|50305677|ref|XP_452799.1| unnamed protein product [Kluyveromy... 62 3e-08
gi|33086456|gb|AAP92540.1| Ab1-114 [Rattus norvegicus] 62 3e-08
gi|19310377|gb|AAL84928.1| At2g46320/F11C10.1 [Arabidopsis thali... 62 3e-08
gi|30690323|ref|NP_850451.1| mitochondrial substrate carrier fam... 62 3e-08
gi|34394981|dbj|BAC84529.1| mitochondrial aspartate-glutamate ca... 62 3e-08
gi|50287747|ref|XP_446303.1| unnamed protein product [Candida gl... 62 3e-08
gi|47718004|gb|AAH70918.1| Unknown (protein for MGC:91476) [Ratt... 62 3e-08
gi|7657585|ref|NP_055067.1| solute carrier family 25 (mitochondr... 62 3e-08
gi|6754952|ref|NP_035147.1| solute carrier family 25 (mitochondr... 62 3e-08
gi|10503963|gb|AAG17977.1| unknown [Homo sapiens] >gnl|BL_ORD_ID... 62 3e-08
gi|50260452|gb|EAL23109.1| hypothetical protein CNBA6340 [Crypto... 62 3e-08
gi|50427049|ref|XP_462129.1| unnamed protein product [Debaryomyc... 62 3e-08
gi|38344833|emb|CAD40869.2| OSJNBa0064H22.14 [Oryza sativa (japo... 62 3e-08
gi|6321696|ref|NP_011773.1| Hypothetical ORF; Mtm1p [Saccharomyc... 62 3e-08
gi|20806141|ref|NP_620800.1| solute carrier family 25 (mitochond... 62 3e-08
gi|17137310|ref|NP_477221.1| CG3057-PA [Drosophila melanogaster]... 62 3e-08
gi|1944534|emb|CAA73099.1| colt [Drosophila melanogaster] 62 3e-08
gi|13385736|ref|NP_080508.1| solute carrier family 25, member 30... 62 3e-08
gi|27807185|ref|NP_777082.1| solute carrier family 25 (mitochond... 61 4e-08
gi|627754|pir||D53737 phosphate carrier protein precursor, mitoc... 61 4e-08
gi|38107122|gb|EAA53339.1| hypothetical protein MG07616.4 [Magna... 61 4e-08
gi|30315255|gb|AAP30846.1| hydrogenosomal carrier protein [Trich... 61 4e-08
gi|50730921|ref|XP_417080.1| PREDICTED: similar to Mitochondrial... 61 4e-08
gi|49071084|ref|XP_399831.1| hypothetical protein UM02216.1 [Ust... 61 4e-08
gi|49096066|ref|XP_409493.1| hypothetical protein AN5356.2 [Aspe... 61 4e-08
gi|49131161|ref|XP_413018.1| hypothetical protein AN8881.2 [Aspe... 61 4e-08
gi|7706150|ref|NP_057696.1| mitochondrial solute carrier protein... 61 4e-08
gi|6031192|ref|NP_005879.1| solute carrier family 25 member 3 is... 61 6e-08
gi|22760412|dbj|BAC11187.1| unnamed protein product [Homo sapiens] 61 6e-08
gi|4505775|ref|NP_002626.1| solute carrier family 25 member 3 is... 61 6e-08
gi|24059753|dbj|BAC21621.1| hypothetical protein [Macaca fascicu... 61 6e-08
gi|39581897|emb|CAE72859.1| Hypothetical protein CBG20158 [Caeno... 61 6e-08
gi|30802109|gb|AAH51367.1| SLC25A3 protein [Homo sapiens] 61 6e-08
gi|20161078|dbj|BAB90009.1| putative mitochondrial carrier [Oryz... 61 6e-08
gi|34783216|gb|AAH15379.2| SLC25A3 protein [Homo sapiens] 61 6e-08
gi|50414715|gb|AAH77266.1| Unknown (protein for MGC:80014) [Xeno... 61 6e-08
gi|21357261|ref|NP_648501.1| CG7314-PB [Drosophila melanogaster]... 60 7e-08
gi|19526818|ref|NP_598429.1| solute carrier family 25 (mitochond... 60 7e-08
gi|21358315|ref|NP_649731.1| CG2616-PA [Drosophila melanogaster]... 60 7e-08
gi|50304305|ref|XP_452102.1| unnamed protein product [Kluyveromy... 60 7e-08
gi|50554747|ref|XP_504782.1| hypothetical protein [Yarrowia lipo... 60 7e-08
gi|18417093|ref|NP_567790.1| mitochondrial substrate carrier fam... 60 7e-08
gi|46442822|gb|EAL02108.1| hypothetical protein CaO19.804 [Candi... 60 7e-08
gi|34882294|ref|XP_217311.2| similar to hypothetical protein MGC... 60 7e-08
gi|42569598|ref|NP_180938.2| mitochondrial substrate carrier fam... 60 1e-07
gi|27482410|ref|XP_170736.2| similar to hypothetical protein [Ho... 60 1e-07
gi|49116948|gb|AAH72926.1| Unknown (protein for MGC:80420) [Xeno... 60 1e-07
gi|50408682|ref|XP_456803.1| unnamed protein product [Debaryomyc... 60 1e-07
gi|49388534|dbj|BAD25656.1| putative mitochondrial solute carrie... 60 1e-07
gi|32403578|ref|XP_322402.1| hypothetical protein [Neurospora cr... 60 1e-07
gi|38105635|gb|EAA52036.1| hypothetical protein MG03631.4 [Magna... 60 1e-07
gi|396595|emb|CAA80973.1| ACR1-protein [Saccharomyces cerevisiae] 60 1e-07
gi|28207755|gb|AAO32620.1| CR057 protein [Chlamydomonas reinhard... 60 1e-07
gi|34905862|ref|NP_914278.1| P0458E05.7 [Oryza sativa (japonica ... 60 1e-07
gi|47219162|emb|CAG01825.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|50552772|ref|XP_503796.1| hypothetical protein [Yarrowia lipo... 60 1e-07
gi|6324796|ref|NP_014865.1| Mitochondrial inner membrane transpo... 60 1e-07
gi|50256826|gb|EAL19544.1| hypothetical protein CNBG1730 [Crypto... 60 1e-07
gi|30690327|ref|NP_850452.1| mitochondrial substrate carrier fam... 60 1e-07
gi|47225418|emb|CAG11901.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|50549063|ref|XP_502002.1| hypothetical protein [Yarrowia lipo... 60 1e-07
gi|31226914|ref|XP_317791.1| ENSANGP00000018102 [Anopheles gambi... 60 1e-07
gi|45184810|ref|NP_982528.1| AAL014Cp [Eremothecium gossypii] >g... 60 1e-07
gi|21483338|gb|AAM52644.1| GH25190p [Drosophila melanogaster] 60 1e-07
gi|5050969|emb|CAB44752.1| dJ362J20.1 (PEROXISOMAL INTEGRAL MEMB... 60 1e-07
gi|12841977|dbj|BAB25425.1| unnamed protein product [Mus musculus] 60 1e-07
gi|45200786|ref|NP_986356.1| AGL311Cp [Eremothecium gossypii] >g... 59 2e-07
gi|19112610|ref|NP_595818.1| putative mitochondrial carrier prot... 59 2e-07
gi|41055124|ref|NP_957466.1| similar to solute carrier family 25... 59 2e-07
gi|31199199|ref|XP_308547.1| ENSANGP00000015935 [Anopheles gambi... 59 2e-07
gi|47222526|emb|CAG02891.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|38104109|gb|EAA50724.1| hypothetical protein MG04483.4 [Magna... 59 2e-07
gi|38969885|gb|AAH63207.1| LOC394840 protein [Xenopus tropicalis] 59 2e-07
gi|7488693|pir||T05707 phosphate transport protein G7, mitochond... 59 2e-07
gi|48098509|ref|XP_394090.1| similar to CG5805-PA [Apis mellifera] 59 2e-07
gi|18252510|gb|AAL66293.1| phosphate transporter [Glycine max] 59 2e-07
gi|7688677|gb|AAF67479.1| mitochondrial solute carrier [Homo sap... 59 2e-07
gi|46442238|gb|EAL01529.1| hypothetical protein CaO19.7082 [Cand... 59 2e-07
gi|50259254|gb|EAL21927.1| hypothetical protein CNBC0670 [Crypto... 59 2e-07
gi|34857703|ref|XP_342727.1| similar to RIKEN cDNA 4930433D19 [R... 59 3e-07
gi|31240529|ref|XP_320678.1| ENSANGP00000020014 [Anopheles gambi... 59 3e-07
gi|50308145|ref|XP_454073.1| unnamed protein product [Kluyveromy... 59 3e-07
gi|49250406|gb|AAH74600.1| Unknown (protein for MGC:69323) [Xeno... 59 3e-07
gi|50308143|ref|XP_454072.1| unnamed protein product [Kluyveromy... 59 3e-07
gi|23619607|ref|NP_705569.1| mitochondrial carrier protein, puta... 59 3e-07
gi|4580727|gb|AAD24490.1| phosphate transporter precursor [Droso... 59 3e-07
gi|1842188|emb|CAA69726.1| mitochondrial phosphate translocator ... 59 3e-07
gi|27754081|ref|NP_080531.2| solute carrier family 25 (mitochond... 59 3e-07
gi|50427443|ref|XP_462334.1| unnamed protein product [Debaryomyc... 59 3e-07
gi|16769102|gb|AAL28770.1| LD16544p [Drosophila melanogaster] 58 4e-07
gi|50728534|ref|XP_416165.1| PREDICTED: similar to phosphate car... 58 4e-07
gi|25010055|gb|AAN71193.1| GH24658p [Drosophila melanogaster] 58 4e-07
>gi|17536171|ref|NP_496236.1| mitochondrial carrier protein c2 (42.1
kD) (2K683) [Caenorhabditis elegans]
gi|627101|pir||S44092 probable carrier protein c2 - Caenorhabditis
elegans
gi|472900|emb|CAA53722.1| carrier protein (c2) [Caenorhabditis
elegans]
gi|3879669|emb|CAA88869.1| Hypothetical protein T09F3.2
[Caenorhabditis elegans]
Length = 384
Score = 632 bits (1630), Expect = e-180
Identities = 320/384 (83%), Positives = 320/384 (83%)
Frame = +1
Query: 1 MFVDREAAIHFXXXXXXXXXXXXXXCPLEVVKTRMQSSRGLDAQXXXXXXXXXXXXXXXX 180
MFVDREAAIHF CPLEVVKTRMQSSRGLDAQ
Sbjct: 1 MFVDREAAIHFIGGAVGGTTGTAITCPLEVVKTRMQSSRGLDAQSGPSTSSGSNSSKSST 60
Query: 181 XXXXXXXXXIFKSVVSQRNGFGSNFRGGQLALERIFNNGSLAALSKANLFNQFQNPSTTS 360
IFKSVVSQRNGFGSNFRGGQLALERIFNNGSLAALSKANLFNQFQNPSTTS
Sbjct: 61 SSSSTKSNGIFKSVVSQRNGFGSNFRGGQLALERIFNNGSLAALSKANLFNQFQNPSTTS 120
Query: 361 LVQYCVRNLXXXXXXXXXXXAARRGTIVIKYITQVIKTEGIGALYKGLIPNLVGVAPSKA 540
LVQYCVRNL AARRGTIVIKYITQVIKTEGIGALYKGLIPNLVGVAPSKA
Sbjct: 121 LVQYCVRNLSTSSTPPQPPTAARRGTIVIKYITQVIKTEGIGALYKGLIPNLVGVAPSKA 180
Query: 541 VYFYTYSTSKRFWNESEVLIPNSAIVHMXXXXXXXXXXXXXXNPIWLVKTRLQLHQGHIG 720
VYFYTYSTSKRFWNESEVLIPNSAIVHM NPIWLVKTRLQLHQGHIG
Sbjct: 181 VYFYTYSTSKRFWNESEVLIPNSAIVHMVSAGSAGFVAASAVNPIWLVKTRLQLHQGHIG 240
Query: 721 IWQMIKRVYHREGFKGFYKGVTASYAGVSETMIQFCIYEYFRGVLLSDANEMDKRKMDFL 900
IWQMIKRVYHREGFKGFYKGVTASYAGVSETMIQFCIYEYFRGVLLSDANEMDKRKMDFL
Sbjct: 241 IWQMIKRVYHREGFKGFYKGVTASYAGVSETMIQFCIYEYFRGVLLSDANEMDKRKMDFL 300
Query: 901 NFMVAGGSAKFIACVVAYPHEVVRTRLREETGKSRGFFKTLYQLYKEGYPAMYRGLSVQL 1080
NFMVAGGSAKFIACVVAYPHEVVRTRLREETGKSRGFFKTLYQLYKEGYPAMYRGLSVQL
Sbjct: 301 NFMVAGGSAKFIACVVAYPHEVVRTRLREETGKSRGFFKTLYQLYKEGYPAMYRGLSVQL 360
Query: 1081 MRTVPNTAITMGTYEFVVYMLHHL 1152
MRTVPNTAITMGTYEFVVYMLHHL
Sbjct: 361 MRTVPNTAITMGTYEFVVYMLHHL 384