Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T10B5_4
(903 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17564186|ref|NP_503517.1| lipase family like precursor (33.8 ... 634 0.0
gi|39584048|emb|CAE66454.1| Hypothetical protein CBG11730 [Caeno... 490 e-137
gi|7504603|pir||T33811 hypothetical protein F58B6.1 - Caenorhabd... 270 3e-71
gi|39593756|emb|CAE62049.1| Hypothetical protein CBG06065 [Caeno... 247 3e-64
gi|17560334|ref|NP_505743.1| lipase, class 3 family member (5L23... 244 2e-63
gi|39593409|emb|CAE64879.1| Hypothetical protein CBG09691 [Caeno... 242 7e-63
gi|17538234|ref|NP_502123.1| lipase, class 3 precursor family me... 236 7e-61
gi|17564540|ref|NP_503389.1| lipase, class 3 precursor family me... 222 1e-56
gi|39588500|emb|CAE58023.1| Hypothetical protein CBG01095 [Caeno... 220 3e-56
gi|39584065|emb|CAE66471.1| Hypothetical protein CBG11750 [Caeno... 218 1e-55
gi|17556062|ref|NP_499621.1| lipase, class 3 precursor family me... 216 7e-55
gi|30145767|emb|CAB11554.2| Hypothetical protein Y49E10.18 [Caen... 208 2e-52
gi|17543518|ref|NP_502962.1| predicted CDS, lipase, class 3 fami... 206 6e-52
gi|39588496|emb|CAE58019.1| Hypothetical protein CBG01090 [Caeno... 199 7e-50
gi|39584011|emb|CAE66417.1| Hypothetical protein CBG11685 [Caeno... 193 5e-48
gi|17556066|ref|NP_499623.1| lipase, class 3 family member (3N53... 189 6e-47
gi|17552572|ref|NP_497511.1| predicted CDS, lipase, class 3 fami... 177 4e-43
gi|39585933|emb|CAE68222.1| Hypothetical protein CBG13893 [Caeno... 176 6e-43
gi|39585932|emb|CAE68221.1| Hypothetical protein CBG13892 [Caeno... 175 1e-42
gi|17541214|ref|NP_500090.1| lipase, class 3 family member (30.6... 169 1e-40
gi|39590871|emb|CAE65245.1| Hypothetical protein CBG10128 [Caeno... 160 3e-38
gi|29603328|emb|CAC35885.2| Hypothetical protein C40H1.7 [Caenor... 149 6e-35
gi|17556080|ref|NP_499630.1| predicted CDS, lipase Complexed Wit... 145 9e-34
gi|25150926|ref|NP_491528.2| lipase family like precursor (1F699... 136 6e-31
gi|17566826|ref|NP_507603.1| lipase, class 3 family member (5S89... 136 7e-31
gi|33300000|emb|CAE17740.1| Hypothetical protein C40H1.8 [Caenor... 135 1e-30
gi|32565385|ref|NP_497335.2| lipase, class 3 family member (3C20... 134 2e-30
gi|32565780|ref|NP_871707.1| lipase, class 3 precursor family me... 134 4e-30
gi|39583640|emb|CAE65744.1| Hypothetical protein CBG10829 [Caeno... 134 4e-30
gi|39590873|emb|CAE65247.1| Hypothetical protein CBG10131 [Caeno... 130 5e-29
gi|34146954|gb|AAB52257.2| Hypothetical protein K08B12.1 [Caenor... 128 2e-28
gi|39594276|emb|CAE71854.1| Hypothetical protein CBG18898 [Caeno... 126 6e-28
gi|17562352|ref|NP_504600.1| lipase, class 3 precursor family me... 126 8e-28
gi|39589549|emb|CAE66784.1| Hypothetical protein CBG12141 [Caeno... 126 8e-28
gi|17552594|ref|NP_499052.1| lipase, class 3 family member (3K41... 125 1e-27
gi|17566824|ref|NP_507602.1| lipase precursor family member (5S8... 124 2e-27
gi|17567773|ref|NP_510221.1| lipase family member (37.8 kD) (XN9... 116 8e-25
gi|17565792|ref|NP_503510.1| lipase, class 3 family member (5C28... 115 1e-24
gi|33300001|emb|CAE17741.1| Hypothetical protein C40H1.9 [Caenor... 113 7e-24
gi|39581807|emb|CAE74180.1| Hypothetical protein CBG21853 [Caeno... 111 3e-23
gi|39596749|emb|CAE63368.1| Hypothetical protein CBG07778 [Caeno... 108 1e-22
gi|17560104|ref|NP_503390.1| lipase, class 3 family member (5B65... 107 3e-22
gi|33300486|emb|CAA16389.2| Hypothetical protein Y51A2B.4 [Caeno... 105 1e-21
gi|15238889|ref|NP_197365.1| lipase class 3 family protein [Arab... 101 3e-20
gi|39590874|emb|CAE65248.1| Hypothetical protein CBG10132 [Caeno... 101 3e-20
gi|18418946|ref|NP_568366.1| lipase class 3 family protein [Arab... 99 1e-19
gi|42570528|ref|NP_850848.2| lipase class 3 family protein [Arab... 99 1e-19
gi|39579511|emb|CAE56202.1| Hypothetical protein CBG23826 [Caeno... 99 1e-19
gi|7511474|pir||T30894 lipase hommolog T08B1.4 - Caenorhabditis ... 96 8e-19
gi|39590865|emb|CAE65239.1| Hypothetical protein CBG10122 [Caeno... 93 9e-18
gi|34907212|ref|NP_914953.1| P0492G09.26 [Oryza sativa (japonica... 89 1e-16
gi|49328134|gb|AAT58832.1| 'putative triglyceride lipase, PF0176... 85 2e-15
gi|39590870|emb|CAE65244.1| Hypothetical protein CBG10127 [Caeno... 85 3e-15
gi|21166167|gb|AAM43784.1| similar to Oryza sativa (japonica cul... 84 4e-15
gi|34899296|ref|NP_910994.1| putative triacylglycerol lipase [Or... 84 4e-15
gi|42573417|ref|NP_974805.1| lipase class 3 family protein [Arab... 84 6e-15
gi|21425569|emb|CAD32695.1| triacylglycerol Lipase [Triticum aes... 84 6e-15
gi|21425571|emb|CAD32696.1| triacylglycerol lipase [Triticum aes... 83 1e-14
gi|34395192|dbj|BAC83592.1| putative triacylglycerol lipase [Ory... 82 2e-14
gi|32404656|ref|XP_322941.1| hypothetical protein ( (AL513444) p... 80 8e-14
gi|38176020|gb|AAC26305.2| Hypothetical protein H41C03.2 [Caenor... 79 1e-13
gi|50550815|ref|XP_502880.1| hypothetical protein [Yarrowia lipo... 79 2e-13
gi|17565964|ref|NP_507596.1| lipase family (5S858) [Caenorhabdit... 79 2e-13
gi|50550259|ref|XP_502602.1| hypothetical protein [Yarrowia lipo... 77 7e-13
gi|13751830|emb|CAC37232.1| possible lipase precursor [Leishmani... 76 9e-13
gi|417256|sp|P19515|LIP_RHIMI Lipase precursor (Triacylglycerol ... 75 2e-12
gi|82777|pir||A34959 triacylglycerol lipase (EC 3.1.1.3) precurs... 75 2e-12
gi|17534733|ref|NP_495167.1| lipase family member (2G140) [Caeno... 75 3e-12
gi|443485|pdb|3TGL| Triacylglycerol Acylhydrolase (E.C.3.1.1.3) 74 4e-12
gi|443509|pdb|4TGL| Triacylglycerol Acylhydrolase (E.C.3.1.1.3)... 74 4e-12
gi|230348|pdb|1TGL| Triacylglycerol Acylhydrolase (E.C.3.1.1.3) 74 4e-12
gi|494918|pdb|5TGL| Lipase (E.C.3.1.1.3) (Triacylglycerol Hydro... 74 4e-12
gi|39596982|emb|CAE59209.1| Hypothetical protein CBG02522 [Caeno... 74 4e-12
gi|49070874|ref|XP_399726.1| hypothetical protein UM02111.1 [Ust... 72 2e-11
gi|17550392|ref|NP_508336.1| lipase family member (XC440) [Caeno... 70 5e-11
gi|49096908|ref|XP_409914.1| hypothetical protein AN5777.2 [Aspe... 70 8e-11
gi|50551985|ref|XP_503467.1| YlLIP5 [Yarrowia lipolytica] >gnl|B... 69 2e-10
gi|38104188|gb|EAA50796.1| hypothetical protein MG04555.4 [Magna... 68 2e-10
gi|25090324|sp|Q9P979|FAEA_ASPAW Feruloyl esterase A precursor (... 68 2e-10
gi|48428990|sp|P61871|LIP_RHINI Lipase precursor (Triacylglycero... 68 3e-10
gi|3299795|dbj|BAA31548.1| lipase [Rhizopus niveus] 68 3e-10
gi|11990253|emb|CAC19602.1| extracellular lipase [Nectria haemat... 68 3e-10
gi|999874|pdb|1TIC|A Chain A, Lipase (E.C.3.1.1.3) (Triacylglyce... 68 3e-10
gi|82786|pir||JT0604 triacylglycerol lipase (EC 3.1.1.3) - Rhizo... 68 3e-10
gi|14335466|gb|AAK60631.1| cinnamoyl esterase FAEA [Aspergillus ... 67 5e-10
gi|49259398|pdb|1UWC|A Chain A, Feruloyl Esterase From Aspergill... 67 5e-10
gi|17366177|sp|O42807|FAEA_ASPNG Feruloyl esterase A precursor (... 67 7e-10
gi|48425840|pdb|1USW|A Chain A, Crystal Structure Of Ferulic Aci... 67 7e-10
gi|1083954|pir||JX0343 triacylglycerol lipase (EC 3.1.1.3) precu... 66 9e-10
gi|16331783|ref|NP_442511.1| hypothetical protein [Synechocystis... 66 9e-10
gi|6942320|gb|AAF32408.1| lipase precursor [Rhizopus oryzae] 65 2e-09
gi|50545489|ref|XP_500282.1| YlLIP2 [Yarrowia lipolytica] >gnl|B... 65 3e-09
gi|32488294|emb|CAE03360.1| OSJNBb0065L13.3 [Oryza sativa (japon... 64 5e-09
gi|7487740|pir||T06657 hypothetical protein T6G15.100 - Arabidop... 64 5e-09
gi|46913007|emb|CAG19796.1| Hypothetical protein [Photobacterium... 64 5e-09
gi|30682521|ref|NP_193091.2| lipase class 3 family protein [Arab... 64 5e-09
gi|31872092|gb|AAP59844.1| lipase [Penicillium allii] 64 6e-09
gi|27803361|emb|CAD21428.1| triacylglycerol lipase [Candida defo... 64 6e-09
gi|13959402|sp|O59952|LIP_THELA Lipase precursor (Triacylglycero... 62 1e-08
gi|999873|pdb|1TIB| Lipase (E.C.3.1.1.3) (Triacylglycerol Acylh... 62 1e-08
gi|38107745|gb|EAA53876.1| hypothetical protein MG09839.4 [Magna... 62 2e-08
gi|28373292|pdb|1GT6|A Chain A, S146a Mutant Of Thermomyces (Hum... 61 3e-08
gi|298949|gb|AAB26004.1| lipase [Penicillium camembertii, Peptid... 59 1e-07
gi|48429006|sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase... 59 1e-07
gi|999872|pdb|1TIA| Lipase (E.C.3.1.1.3) (Triacylglycerol Acylh... 59 1e-07
gi|50555758|ref|XP_505287.1| hypothetical protein [Yarrowia lipo... 59 1e-07
gi|46123057|ref|XP_386082.1| hypothetical protein FG05906.1 [Gib... 58 3e-07
gi|33621223|gb|AAQ23181.1| extracellular lipase [Gibberella zeae] 58 3e-07
gi|49095046|ref|XP_408984.1| hypothetical protein AN4847.2 [Aspe... 58 3e-07
gi|48729045|ref|ZP_00262797.1| COG3675: Predicted lipase [Pseudo... 57 4e-07
gi|17366179|sp|O42815|FAEA_ASPTU Feruloyl esterase A precursor (... 57 4e-07
gi|28830057|gb|AAO52547.1| hypothetical protein [Dictyostelium d... 57 7e-07
gi|49117149|ref|XP_412183.1| hypothetical protein AN8046.2 [Aspe... 56 1e-06
gi|50546415|ref|XP_500677.1| YlLIP8 [Yarrowia lipolytica] >gnl|B... 56 1e-06
gi|46435558|gb|EAK94937.1| hypothetical protein CaO19.7747 [Cand... 56 1e-06
gi|45528152|ref|ZP_00179351.1| COG3675: Predicted lipase [Crocos... 55 2e-06
gi|50551785|ref|XP_503367.1| hypothetical protein [Yarrowia lipo... 55 3e-06
gi|32420587|ref|XP_330737.1| hypothetical protein [Neurospora cr... 55 3e-06
gi|46435864|gb|EAK95237.1| hypothetical protein CaO19.100 [Candi... 54 4e-06
gi|28950522|emb|CAD70715.1| lipase [Yarrowia lipolytica] 54 6e-06
gi|50551093|ref|XP_503020.1| YlLIP7 [Yarrowia lipolytica] >gnl|B... 54 6e-06
gi|50554735|ref|XP_504776.1| hypothetical protein [Yarrowia lipo... 53 8e-06
gi|15220732|ref|NP_174326.1| lipase class 3 family protein [Arab... 53 1e-05
gi|27803363|emb|CAD21429.1| triacylglycerol lipase [Candida defo... 53 1e-05
gi|48861093|ref|ZP_00314998.1| COG3675: Predicted lipase [Microb... 53 1e-05
gi|46108716|ref|XP_381416.1| hypothetical protein FG01240.1 [Gib... 52 1e-05
gi|42568828|ref|NP_201506.2| lipase class 3 family protein [Arab... 52 2e-05
gi|30022930|ref|NP_834561.1| Lipase [Bacillus cereus ATCC 14579]... 52 2e-05
gi|10177592|dbj|BAB10939.1| unnamed protein product [Arabidopsis... 52 2e-05
gi|1772352|dbj|BAA12912.1| diacylglycerol lipase [Aspergillus or... 52 2e-05
gi|27525626|gb|AAO17920.1| lipase [Aspergillus parasiticus] 52 2e-05
gi|38109496|gb|EAA55359.1| hypothetical protein MG07016.4 [Magna... 52 2e-05
gi|28870646|ref|NP_793265.1| lipase family protein [Pseudomonas ... 52 2e-05
gi|46805614|dbj|BAD17027.1| putative DEFECTIVE IN ANTHER DEHISCE... 51 4e-05
gi|42784068|ref|NP_981315.1| lipase family protein [Bacillus cer... 50 5e-05
gi|21402911|ref|NP_658896.1| Lipase_3, Lipase (class 3) [Bacillu... 50 5e-05
gi|48891151|ref|ZP_00324714.1| COG3675: Predicted lipase [Tricho... 50 7e-05
gi|27803365|emb|CAD21430.1| triacylglycerol lipase [Candida defo... 50 9e-05
gi|50543556|ref|XP_499944.1| hypothetical protein [Yarrowia lipo... 50 9e-05
gi|50547325|ref|XP_501132.1| hypothetical protein [Yarrowia lipo... 49 1e-04
gi|46120342|ref|XP_384994.1| hypothetical protein FG04818.1 [Gib... 49 1e-04
gi|15224963|ref|NP_182008.1| defective in anther dehiscence1 (DA... 49 1e-04
gi|16215706|dbj|BAB69954.1| DEFECTIVE IN ANTHER DEHISCENCE1 [Ara... 49 1e-04
gi|17552584|ref|NP_499050.1| putative mitochondrial protein fami... 49 1e-04
gi|34911832|ref|NP_917263.1| lipase-like protein [Oryza sativa (... 49 2e-04
gi|46806075|dbj|BAD17323.1| lipase class 3-like [Oryza sativa (j... 49 2e-04
gi|24898901|dbj|BAC23081.1| DAD1 [Brassica rapa] 48 3e-04
gi|50552830|ref|XP_503825.1| hypothetical protein [Yarrowia lipo... 48 3e-04
gi|7488220|pir||E71435 probable triacylglycerol lipase - Arabido... 48 3e-04
gi|50552574|ref|XP_503697.1| YlLIP4 [Yarrowia lipolytica] >gnl|B... 48 3e-04
gi|28950518|emb|CAD70713.1| lipase [Yarrowia lipolytica] 48 3e-04
gi|15810243|gb|AAL07239.1| unknown protein [Arabidopsis thaliana] 48 3e-04
gi|23297781|gb|AAN13024.1| unknown protein [Arabidopsis thaliana] 48 3e-04
gi|18414755|ref|NP_567515.1| lipase class 3 family protein [Arab... 48 3e-04
gi|42571769|ref|NP_973975.1| lipase class 3 family protein [Arab... 48 3e-04
gi|42564151|ref|NP_566484.2| lipase class 3 family protein [Arab... 48 3e-04
gi|9279583|dbj|BAB01041.1| unnamed protein product [Arabidopsis ... 48 3e-04
gi|46444895|gb|EAL04167.1| hypothetical protein CaO19.12147 [Can... 47 6e-04
gi|37536870|ref|NP_922737.1| putative lipase [Oryza sativa (japo... 47 8e-04
gi|34911830|ref|NP_917262.1| lipase-like protein [Oryza sativa (... 47 8e-04
gi|50551029|ref|XP_502988.1| hypothetical protein [Yarrowia lipo... 46 0.001
gi|50421569|ref|XP_459337.1| unnamed protein product [Debaryomyc... 46 0.001
gi|31043805|emb|CAA94157.2| Hypothetical protein K11E4.1 [Caenor... 46 0.001
gi|50421453|ref|XP_459277.1| unnamed protein product [Debaryomyc... 46 0.001
gi|46444740|gb|EAL04013.1| hypothetical protein CaO19.4678 [Cand... 45 0.002
gi|32474016|ref|NP_867010.1| probable lipase [Pirellula sp. 1] >... 45 0.002
gi|50551433|ref|XP_503190.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|15641429|ref|NP_231061.1| hypothetical protein VC1418 [Vibrio... 45 0.003
gi|28897400|ref|NP_797005.1| hypothetical protein VP0626 [Vibrio... 45 0.003
gi|47568042|ref|ZP_00238748.1| lipase [Bacillus cereus G9241] >g... 45 0.003
gi|32417226|ref|XP_329091.1| hypothetical protein [Neurospora cr... 45 0.003
gi|28830058|gb|AAO52548.1| hypothetical protein [Dictyostelium d... 44 0.005
gi|14140134|emb|CAC39051.1| lipase-like protein [Oryza sativa] 44 0.006
gi|34907694|ref|NP_915194.1| P0035F12.7 [Oryza sativa (japonica ... 44 0.006
gi|49387523|dbj|BAD24988.1| putative defective in anther dehisce... 43 0.008
gi|42569869|ref|NP_181773.2| lipase class 3 family protein [Arab... 43 0.008
gi|25408795|pir||A84854 hypothetical protein At2g42450 [imported... 43 0.008
gi|37675874|ref|NP_936270.1| predicted lipase [Vibrio vulnificus... 43 0.008
gi|30684625|ref|NP_850148.1| lipase class 3 family protein [Arab... 43 0.011
gi|45191053|ref|NP_985307.1| AER452Cp [Eremothecium gossypii] >g... 43 0.011
gi|15239111|ref|NP_199107.1| lipase class 3 family protein [Arab... 43 0.011
gi|50285919|ref|XP_445388.1| unnamed protein product [Candida gl... 43 0.011
gi|18402385|ref|NP_565701.1| lipase class 3 family protein [Arab... 43 0.011
gi|34911870|ref|NP_917282.1| lipase-like protein [Oryza sativa (... 43 0.011
gi|25408087|pir||G84709 probable lipase [imported] - Arabidopsis... 43 0.011
gi|38683784|gb|AAR26956.1| FirrV-1-F2 precursor [Feldmannia irre... 42 0.014
gi|46130682|ref|XP_389121.1| hypothetical protein FG08945.1 [Gib... 42 0.014
gi|34907690|ref|NP_915192.1| putative triacylglycerol lipase [Or... 42 0.014
gi|30679836|ref|NP_849603.1| lipase class 3 family protein [Arab... 42 0.019
gi|18390691|ref|NP_563772.1| lipase class 3 family protein [Arab... 42 0.019
gi|11357468|pir||T47960 hypothetical protein F15G16.70 - Arabido... 42 0.024
gi|50423285|ref|XP_460224.1| unnamed protein product [Debaryomyc... 42 0.024
gi|42566124|ref|NP_191727.2| lipase class 3 family protein [Arab... 42 0.024
gi|6691519|dbj|BAA89335.1| EEF53 [Solanum melongena] 42 0.024
gi|34912720|ref|NP_917707.1| B1040D09.8 [Oryza sativa (japonica ... 42 0.024
gi|50546615|ref|XP_500777.1| hypothetical protein [Yarrowia lipo... 41 0.032
gi|9022417|gb|AAF82375.1| alkaline lipase; triacylglycerol acylh... 41 0.032
gi|49067192|ref|XP_397886.1| hypothetical protein UM00271.1 [Ust... 41 0.032
gi|45185390|ref|NP_983107.1| ABR159Cp [Eremothecium gossypii] >g... 41 0.042
gi|25404138|pir||A96608 hypothetical protein F25P12.93 [imported... 41 0.042
gi|10764567|gb|AAG22769.1| lipase precursor [Penicillium expansum] 41 0.042
gi|49128944|ref|XP_412880.1| hypothetical protein AN8743.2 [Aspe... 41 0.042
gi|27366558|ref|NP_762085.1| Predicted lipase [Vibrio vulnificus... 40 0.055
gi|15231461|ref|NP_187396.1| lipase class 3 family protein [Arab... 40 0.055
gi|13751793|emb|CAC37195.1| hypothetical protein P883.01 [Leishm... 40 0.055
gi|15228337|ref|NP_190392.1| disease resistance protein (EDS1) [... 40 0.071
gi|19114100|ref|NP_593188.1| conserved hypothetical protein [Sch... 40 0.071
gi|21537306|gb|AAM61647.1| lipase-like protein [Arabidopsis thal... 40 0.093
gi|15221426|ref|NP_172115.1| lipase class 3 family protein [Arab... 40 0.093
gi|34911842|ref|NP_917268.1| lipase-like protein [Oryza sativa (... 40 0.093
gi|29244950|gb|EAA36623.1| GLP_7_6041_4755 [Giardia lamblia ATCC... 39 0.12
gi|1527001|gb|AAB07724.1| Ipomoea nil Pn47p 39 0.12
gi|29250571|gb|EAA42063.1| GLP_68_89088_90299 [Giardia lamblia A... 39 0.12
gi|39596474|emb|CAE63093.1| Hypothetical protein CBG07383 [Caeno... 39 0.16
gi|45191055|ref|NP_985309.1| AER454Cp [Eremothecium gossypii] >g... 39 0.16
gi|11282599|pir||T48859 disease resistance protein EDS1 [validat... 39 0.21
gi|28900852|ref|NP_800507.1| lipase-related protein [Vibrio para... 39 0.21
gi|49389224|dbj|BAD26534.1| putative EDS1 [Oryza sativa (japonic... 39 0.21
gi|15227978|ref|NP_181797.1| lipase, putative [Arabidopsis thali... 38 0.27
gi|45185574|ref|NP_983290.1| ACL114Wp [Eremothecium gossypii] >g... 38 0.35
gi|21040277|ref|NP_631918.1| KCCR13L [Homo sapiens] >gnl|BL_ORD_... 38 0.35
gi|22760385|dbj|BAC11175.1| unnamed protein product [Homo sapiens] 38 0.35
gi|46255720|gb|AAH27603.1| KCCR13L [Homo sapiens] 38 0.35
gi|4103627|gb|AAD01804.1| lipase [Dianthus caryophyllus] 38 0.35
gi|9757980|dbj|BAB08316.1| calmodulin-binding heat-shock protein... 37 0.46
gi|47848616|dbj|BAD22465.1| lipase class 3-like [Oryza sativa (j... 37 0.46
gi|15240318|ref|NP_198587.1| lipase class 3 family protein / cal... 37 0.46
gi|47847721|dbj|BAD21500.1| lipase class 3-like [Oryza sativa (j... 37 0.60
gi|29249640|gb|EAA41147.1| GLP_38_8946_6349 [Giardia lamblia ATC... 37 0.60
gi|37527045|ref|NP_930389.1| pdl [Photorhabdus luminescens subsp... 37 0.60
gi|6322567|ref|NP_012641.1| Hypothetical ORF; Yjr107wp [Saccharo... 37 0.60
gi|50080246|gb|AAT69581.1| putative lipase [Oryza sativa (japoni... 37 0.60
gi|48862615|ref|ZP_00316511.1| COG3675: Predicted lipase [Microb... 37 0.79
gi|23003085|ref|ZP_00046754.1| hypothetical protein [Lactobacill... 37 0.79
gi|39545741|emb|CAE75967.1| OSJNBa0071I13.19 [Oryza sativa (japo... 37 0.79
gi|21752923|dbj|BAC04258.1| unnamed protein product [Homo sapiens] 37 0.79
gi|46912688|emb|CAG19478.1| conserved hypothetical protein [Phot... 37 0.79
gi|50555333|ref|XP_505075.1| hypothetical protein [Yarrowia lipo... 37 0.79
gi|16416934|gb|AAL18491.1| Pdl1; putative lipase [Photorhabdus l... 36 1.0
gi|25372762|pir||F86156 hypothetical protein T14P4.6 - Arabidops... 36 1.0
gi|22655024|gb|AAM98103.1| At1g02660/T14P4_9 [Arabidopsis thaliana] 36 1.0
gi|50307141|ref|XP_453549.1| unnamed protein product [Kluyveromy... 36 1.0
gi|15081707|gb|AAK82508.1| At1g02660/T14P4_9 [Arabidopsis thaliana] 36 1.0
gi|18378994|ref|NP_563660.1| lipase class 3 family protein [Arab... 36 1.0
gi|18403524|ref|NP_564590.1| lipase class 3 family protein [Arab... 36 1.0
gi|37674271|ref|NP_932782.1| neural stem cell-derived dendrite r... 36 1.0
gi|7489928|pir||S32492 lipase - Rhizopus javanicus 36 1.0
gi|23125756|ref|ZP_00107677.1| hypothetical protein [Nostoc punc... 36 1.0
gi|34861602|ref|XP_219575.2| similar to chromosome 11 open readi... 36 1.0
gi|15601509|ref|NP_233140.1| lipase-related protein [Vibrio chol... 36 1.3
gi|2330582|emb|CAA74888.1| pSI-7 protein [Cladosporium fulvum] 36 1.3
gi|20521123|dbj|BAA31634.2| KIAA0659 protein [Homo sapiens] 36 1.3
gi|18412427|ref|NP_567131.1| lipase class 3 family protein [Arab... 36 1.3
gi|15231218|ref|NP_190811.1| phytoalexin-deficient 4 protein (PA... 36 1.3
gi|11357674|pir||T48048 hypothetical protein F26K9.20 - Arabidop... 36 1.3
gi|37525470|ref|NP_928814.1| hypothetical protein [Photorhabdus ... 36 1.3
gi|27262632|ref|NP_006124.1| chromosome 11 open reading frame 11... 36 1.3
gi|50557426|ref|XP_506121.1| hypothetical protein [Yarrowia lipo... 36 1.3
gi|32411621|ref|XP_326291.1| hypothetical protein [Neurospora cr... 35 1.8
gi|50287413|ref|XP_446136.1| unnamed protein product [Candida gl... 35 1.8
gi|50080245|gb|AAT69580.1| putative lipase [Oryza sativa (japoni... 35 1.8
gi|42518099|ref|NP_964029.1| hypothetical protein LJ0014 [Lactob... 35 1.8
gi|15233922|ref|NP_193590.1| lipase class 3 family protein [Arab... 35 1.8
gi|13242655|ref|NP_077670.1| EsV-1-185 [Ectocarpus siliculosus v... 35 2.3
gi|34907688|ref|NP_915191.1| P0035F12.4 [Oryza sativa (japonica ... 35 2.3
gi|50258895|gb|EAL21576.1| hypothetical protein CNBC6140 [Crypto... 35 3.0
gi|50794489|ref|XP_423696.1| PREDICTED: similar to chromosome 11... 35 3.0
gi|15228336|ref|NP_190391.1| lipase class 3 family protein / dis... 35 3.0
gi|34910484|ref|NP_916589.1| putative lipase [Oryza sativa (japo... 35 3.0
gi|48856152|ref|ZP_00310310.1| hypothetical protein Chut02001393... 34 3.9
gi|38100558|gb|EAA47670.1| hypothetical protein MG02913.4 [Magna... 34 3.9
gi|29348321|ref|NP_811824.1| putative glycosyslhydrolase [Bacter... 34 3.9
gi|27479681|gb|AAO17208.1| Pdl2 [Photorhabdus luminescens] 34 3.9
gi|49097192|ref|XP_410056.1| hypothetical protein AN5919.2 [Aspe... 34 3.9
gi|15224613|ref|NP_180668.1| lipase, putative [Arabidopsis thali... 34 5.1
gi|48826302|ref|ZP_00287524.1| COG1609: Transcriptional regulato... 34 5.1
gi|23003641|ref|ZP_00047297.1| hypothetical protein [Lactobacill... 33 6.7
gi|38078321|ref|XP_143768.3| similar to fibronectin type 3 and S... 33 6.7
gi|34868502|ref|XP_232950.2| similar to fibronectin type 3 and S... 33 6.7
gi|29249782|gb|EAA41287.1| GLP_190_48722_47349 [Giardia lamblia ... 33 6.7
gi|22537199|ref|NP_688050.1| conserved domain protein [Streptoco... 33 6.7
gi|40974921|emb|CAF06583.1| EDS1-like protein [Brassica oleracea] 33 6.7
gi|22164290|gb|AAM93650.1| putative secreted carboxypeptidase [I... 33 8.7
gi|50290851|ref|XP_447858.1| unnamed protein product [Candida gl... 33 8.7
gi|50305255|ref|XP_452587.1| unnamed protein product [Kluyveromy... 33 8.7
gi|50591821|ref|ZP_00333123.1| COG5153: Putative lipase essentia... 33 8.7
gi|34905942|ref|NP_914318.1| lipase-like protein [Oryza sativa (... 33 8.7
gi|46518526|ref|NP_997530.1| similar to fibronectin type 3 and S... 33 8.7
gi|15223573|ref|NP_176056.1| lipase class 3 family protein [Arab... 33 8.7
gi|28828858|gb|AAO51453.1| similar to Plasmodium falciparum. Hyp... 33 8.7
>gi|17564186|ref|NP_503517.1| lipase family like precursor (33.8 kD)
(5C325) [Caenorhabditis elegans]
gi|7507586|pir||T33232 hypothetical protein T10B5.7 -
Caenorhabditis elegans
gi|3193203|gb|AAC19230.1| Hypothetical protein T10B5.7
[Caenorhabditis elegans]
Length = 300
Score = 634 bits (1635), Expect = 0.0
Identities = 300/300 (100%), Positives = 300/300 (100%)
Frame = +1
Query: 1 MRQHCLLFLLCLGVFRAQGAPTGDDNASSFSDTFVRSHFPIIFASTEAPNATNCLDKVFT 180
MRQHCLLFLLCLGVFRAQGAPTGDDNASSFSDTFVRSHFPIIFASTEAPNATNCLDKVFT
Sbjct: 1 MRQHCLLFLLCLGVFRAQGAPTGDDNASSFSDTFVRSHFPIIFASTEAPNATNCLDKVFT 60
Query: 181 NYELKRHVNVKCDEADGLDRCSGLTLVSHDDKAIIIAFRGTKGVLQLLVESDEIMYRNKT 360
NYELKRHVNVKCDEADGLDRCSGLTLVSHDDKAIIIAFRGTKGVLQLLVESDEIMYRNKT
Sbjct: 61 NYELKRHVNVKCDEADGLDRCSGLTLVSHDDKAIIIAFRGTKGVLQLLVESDEIMYRNKT 120
Query: 361 AWFGGGNVGFYFARSYNLLWNAGMKEDFNTLKHAYPGYEIWVGGHSLGGSMAALASNYLV 540
AWFGGGNVGFYFARSYNLLWNAGMKEDFNTLKHAYPGYEIWVGGHSLGGSMAALASNYLV
Sbjct: 121 AWFGGGNVGFYFARSYNLLWNAGMKEDFNTLKHAYPGYEIWVGGHSLGGSMAALASNYLV 180
Query: 541 ANGLATSSNLKMITFGEPRTGDKAFADAHDKMVTYSYRIVHHKDIVPHIPLNGMAEFHHH 720
ANGLATSSNLKMITFGEPRTGDKAFADAHDKMVTYSYRIVHHKDIVPHIPLNGMAEFHHH
Sbjct: 181 ANGLATSSNLKMITFGEPRTGDKAFADAHDKMVTYSYRIVHHKDIVPHIPLNGMAEFHHH 240
Query: 721 RNEVWYDNDMLKAVFKECDAQESPFCSDSHLDYEIEDHHRYFGMFISFYGRRNCTGDPSN 900
RNEVWYDNDMLKAVFKECDAQESPFCSDSHLDYEIEDHHRYFGMFISFYGRRNCTGDPSN
Sbjct: 241 RNEVWYDNDMLKAVFKECDAQESPFCSDSHLDYEIEDHHRYFGMFISFYGRRNCTGDPSN 300