Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T10H4_11
(1092 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559066|ref|NP_506790.1| cysteine PRotease related, cathepsi... 723 0.0
gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhab... 604 e-171
gi|39582887|emb|CAE71663.1| Hypothetical protein CBG18635 [Caeno... 520 e-146
gi|39582397|emb|CAE74781.1| Hypothetical protein CBG22612 [Caeno... 378 e-103
gi|39582907|emb|CAE71683.1| Hypothetical protein CBG18657 [Caeno... 378 e-103
gi|39582904|emb|CAE71680.1| Hypothetical protein CBG18654 [Caeno... 357 4e-97
gi|39592833|emb|CAE62447.1| Hypothetical protein CBG06539 [Caeno... 355 1e-96
gi|39592139|emb|CAE75359.1| Hypothetical protein CBG23343 [Caeno... 353 3e-96
gi|32566081|ref|NP_506002.2| cysteine PRotease related (35.4 kD)... 351 1e-95
gi|7497829|pir||T20148 probable cysteine proteinase (EC 3.4.22.-... 351 1e-95
gi|39584563|emb|CAE74641.1| Hypothetical protein CBG22436 [Caeno... 320 3e-86
gi|39581137|emb|CAE70994.1| Hypothetical protein CBG17826 [Caeno... 317 2e-85
gi|39579201|emb|CAE56994.1| Hypothetical protein CBG24861 [Caeno... 317 2e-85
gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103 [Caeno... 292 1e-77
gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsi... 291 2e-77
gi|25153428|ref|NP_507186.2| predicted CDS, cathepsin B family m... 286 4e-76
gi|7500618|pir||T21856 probable cysteine proteinase (EC 3.4.22.-... 283 5e-75
gi|39594338|emb|CAE71916.1| Hypothetical protein CBG18978 [Caeno... 274 3e-72
gi|14582897|gb|AAK69705.1| procathepsin B [Oncorhynchus mykiss] 271 3e-71
gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)... 270 4e-71
gi|27806671|ref|NP_776456.1| cathepsin B [Bos taurus] >gnl|BL_OR... 268 2e-70
gi|1168789|sp|P07688|CATB_BOVIN Cathepsin B precursor 268 2e-70
gi|50745158|ref|XP_429301.1| PREDICTED: hypothetical protein XP_... 267 4e-70
gi|39588507|emb|CAE58030.1| Hypothetical protein CBG01104 [Caeno... 266 5e-70
gi|115711|sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin ... 265 1e-69
gi|28302291|gb|AAH46667.1| Cg10992-prov protein [Xenopus laevis] 265 1e-69
gi|4503139|ref|NP_001899.1| cathepsin B preproprotein; APP secre... 265 2e-69
gi|39592835|emb|CAE62449.1| Hypothetical protein CBG06541 [Caeno... 265 2e-69
gi|17565162|ref|NP_503382.1| cathepsin B precursor family member... 265 2e-69
gi|16307393|gb|AAH10240.1| Cathepsin B, preproprotein [Homo sapi... 264 2e-69
gi|30583753|gb|AAP36125.1| Homo sapiens cathepsin B [synthetic c... 264 2e-69
gi|2982114|pdb|1PBH| Crystal Structure Of Human Recombinant Pro... 264 3e-69
gi|9955277|pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine... 264 3e-69
gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heter... 263 7e-69
gi|28373366|pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bo... 262 9e-69
gi|25146613|ref|NP_741818.1| cysteine PRotease related (42.4 kD)... 258 1e-67
gi|24158605|pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipep... 258 1e-67
gi|21392648|gb|AAM51519.1| Cysteine protease related protein 6, ... 258 1e-67
gi|34874087|ref|XP_346478.1| hypothetical protein XP_346477 [Rat... 257 3e-67
gi|12018262|ref|NP_072119.1| cathepsin B preproprotein [Rattus n... 257 3e-67
gi|25988674|gb|AAN76202.1| lysosomal cysteine proteinase catheps... 257 3e-67
gi|28277314|gb|AAH44689.1| MGC53360 protein [Xenopus laevis] 257 3e-67
gi|6681079|ref|NP_031824.1| cathepsin B preproprotein [Mus muscu... 257 4e-67
gi|45361295|ref|NP_989225.1| hypothetical protein MGC75969 [Xeno... 257 4e-67
gi|41055001|ref|NP_957349.1| similar to cathepsin B [Danio rerio... 257 4e-67
gi|1181143|emb|CAA93278.1| cysteine proteinase [Haemonchus conto... 257 4e-67
gi|50540542|ref|NP_998501.1| cathepsin B [Danio rerio] >gnl|BL_O... 256 8e-67
gi|1311050|pdb|1CPJ|A Chain A, Thiol Protease Mol_id: 1; Molecul... 255 1e-66
gi|46195455|ref|NP_990702.1| cathepsin B [Gallus gallus] >gnl|BL... 255 1e-66
gi|2134308|pir||S58770 cathepsin B (EC 3.4.22.1) precursor - chi... 255 1e-66
gi|1127275|pdb|1CTE|A Chain A, Molecule: Cathepsin B; Ec: 3.4.22... 255 1e-66
gi|17561570|ref|NP_506011.1| cathepsin B family member (5M483) [... 255 1e-66
gi|203648|gb|AAA40993.1| cathepsin (EC 3.4.22.1) 255 1e-66
gi|1942645|pdb|1MIR|A Chain A, Rat Procathepsin B >gnl|BL_ORD_ID... 253 4e-66
gi|309202|gb|AAA37494.1| mouse preprocathepsin B 253 4e-66
gi|1777779|gb|AAB40605.1| cathepsin B-like cysteine proteinase 253 4e-66
gi|39586718|emb|CAE65760.1| Hypothetical protein CBG10849 [Caeno... 253 4e-66
gi|34979797|gb|AAQ83887.1| cathepsin B [Branchiostoma belcheri t... 253 7e-66
gi|39592147|emb|CAE75367.1| Hypothetical protein CBG23351 [Caeno... 252 1e-65
gi|31872149|gb|AAP59456.1| cathepsin B precursor [Araneus ventri... 251 2e-65
gi|1169189|sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine protei... 249 1e-64
gi|984960|gb|AAC46878.1| cathepsin B proteinase 247 4e-64
gi|7537454|gb|AAF35867.2| cathepsin B-like cysteine proteinase [... 247 4e-64
gi|227293|prf||1701299A cathepsin B 246 9e-64
gi|31209737|ref|XP_313835.1| ENSANGP00000003981 [Anopheles gambi... 246 9e-64
gi|47217183|emb|CAG11019.1| unnamed protein product [Tetraodon n... 246 9e-64
gi|984958|gb|AAC46877.1| cathepsin B-like proteinase 244 3e-63
gi|14141821|gb|AAK07477.2| probable cathepsin B-like cysteine pr... 243 7e-63
gi|50657025|emb|CAH04630.1| cathepsin B [Suberites domuncula] 243 7e-63
gi|18181863|emb|CAC85211.2| cathepsin B endopeptidase [Schistoso... 242 1e-62
gi|45822203|emb|CAE47498.1| cathepsin B-like proteinase [Diabrot... 240 4e-62
gi|30995341|gb|AAO59414.2| cathepsin B endopeptidase [Schistosom... 239 6e-62
gi|22531389|emb|CAD44625.1| cathepsin B1 isotype 2 [Schistosoma ... 239 1e-61
gi|22531387|emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma ... 238 1e-61
gi|21930117|gb|AAM82155.1| cysteine proteinase [Ancylostoma ceyl... 237 4e-61
gi|13548667|dbj|BAB40804.1| cathepsin B [Bombyx mori] 237 4e-61
gi|118153|sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine protein... 236 5e-61
gi|19526442|gb|AAL89717.1| cathepsin B [Apriona germari] 236 5e-61
gi|38373697|gb|AAR19103.1| cathepsin B [Uronema marinum] 235 1e-60
gi|481614|pir||S38939 probable cathepsin B-like cysteine protein... 235 1e-60
gi|3087801|emb|CAA93277.1| cysteine proteinase [Haemonchus conto... 234 2e-60
gi|29374027|gb|AAO73004.1| cathepsin B [Fasciola gigantica] 234 3e-60
gi|29374025|gb|AAO73003.1| cathepsin B [Fasciola gigantica] 233 4e-60
gi|18921171|ref|NP_572920.1| CG10992-PA [Drosophila melanogaster... 233 8e-60
gi|27526823|emb|CAD32937.1| pro-cathepsin B2 [Fasciola hepatica] 233 8e-60
gi|1008858|gb|AAA79004.1| cathepsin B-like thiol protease 231 2e-59
gi|4325188|gb|AAD17297.1| cysteine proteinase [Ancylostoma ceyla... 229 1e-58
gi|478099|pir||D48435 cysteine proteinase AC-3 - nematode (Haemo... 227 4e-58
gi|345308|pir||S31909 cathepsin B-like cysteine proteinase (EC 3... 226 7e-58
gi|39594884|emb|CAE70752.1| Hypothetical protein CBG17499 [Caeno... 225 1e-57
gi|5031250|gb|AAD38132.1| vitellogenic cathepsin-B like protease... 225 1e-57
gi|29374023|gb|AAO73002.1| cathepsin B [Fasciola gigantica] 224 4e-57
gi|118118|sp|P19092|CYS1_HAECO Cathepsin B-like cysteine protein... 223 6e-57
gi|5764077|emb|CAB53367.1| necpain [Necator americanus] 223 8e-57
gi|3912916|gb|AAC78691.1| thiol protease [Trichuris suis] 222 1e-56
gi|2944340|gb|AAC05262.1| cathepsin B-like cysteine protease GCP... 221 2e-56
gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrot... 221 2e-56
gi|118122|sp|P25793|CYS2_HAECO Cathepsin B-like cysteine protein... 221 3e-56
gi|17560488|ref|NP_506310.1| cathepsin precursor family member (... 220 4e-56
gi|4204370|gb|AAD11445.1| cathepsin B protease [Fasciola hepatica] 220 5e-56
gi|477253|pir||A48454 cathepsin B-like cysteine proteinase (EC 3... 217 3e-55
gi|31209739|ref|XP_313836.1| ENSANGP00000012227 [Anopheles gambi... 217 4e-55
gi|477808|pir||B48435 cysteine proteinase AC-5 - nematode (Haemo... 217 4e-55
gi|28932700|gb|AAO60044.1| midgut cysteine proteinase 1 [Rhipice... 216 1e-54
gi|31209729|ref|XP_313831.1| ENSANGP00000012222 [Anopheles gambi... 213 6e-54
gi|1345924|sp|P25802|CYS1_OSTOS Cathepsin B-like cysteine protei... 210 4e-53
gi|38639325|gb|AAR25800.1| cathepsin B-like cysteine proteinase ... 210 5e-53
gi|22535408|emb|CAC87118.1| cathepsin B-like protease [Nilaparva... 209 1e-52
gi|478007|pir||C48435 cysteine proteinase AC-4 - nematode (Haemo... 208 2e-52
gi|18378947|ref|NP_563648.1| cathepsin B-like cysteine protease,... 206 1e-51
gi|28971815|dbj|BAC65419.1| cathepsin B [Pandalus borealis] 202 1e-50
gi|48762493|dbj|BAD23816.1| cathepsin B-N [Tuberaphis coreana] 201 2e-50
gi|48762485|dbj|BAD23812.1| cathepsin B-N [Tuberaphis styraci] 201 2e-50
gi|39588505|emb|CAE58028.1| Hypothetical protein CBG01102 [Caeno... 200 5e-50
gi|44965401|gb|AAS49537.1| cathepsin B [Latimeria chalumnae] 200 5e-50
gi|17565158|ref|NP_503384.1| cathepsin precursor family member (... 200 5e-50
gi|44965462|gb|AAS49538.1| cathepsin B [Protopterus dolloi] 199 1e-49
gi|2129942|pir||S60479 cathepsin B-like cysteine proteinase (EC ... 199 1e-49
gi|18411686|ref|NP_567215.1| cathepsin B-like cysteine protease,... 198 2e-49
gi|609175|emb|CAA57522.1| cathepsin B-like cysteine proteinase [... 197 3e-49
gi|44968648|gb|AAS49594.1| cathepsin B [Scyliorhinus canicula] 197 5e-49
gi|30678927|ref|NP_849281.1| cathepsin B-like cysteine protease,... 195 1e-48
gi|12005276|gb|AAG44365.1| cathepsin B-like cysteine protease [L... 195 2e-48
gi|728602|emb|CAA88490.1| cathepsin B-like enzyme [Leishmania me... 195 2e-48
gi|17384033|emb|CAD12394.1| cysteine proteinase [Leishmania infa... 195 2e-48
gi|14582576|gb|AAK69541.1| cathepsin B-like cysteine proteinase ... 194 3e-48
gi|7435783|pir||T06413 cathepsin B-like cysteine proteinase (EC ... 193 5e-48
gi|2317912|gb|AAC24376.1| cathepsin B-like cysteine proteinase [... 193 7e-48
gi|12004577|gb|AAG44098.1| cathepsin B cysteine protease [Leishm... 192 1e-47
gi|1848229|gb|AAB48119.1| cathepsin B-like protease [Leishmania ... 192 1e-47
gi|40643250|emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. ... 192 1e-47
gi|6165885|gb|AAF04727.1| cathepsin B-like cysteine proteinase [... 192 1e-47
gi|1644295|emb|CAB03627.1| cysteine proteinase [Haemonchus conto... 191 3e-47
gi|3087797|emb|CAA93275.1| cysteine proteinase [Haemonchus conto... 188 2e-46
gi|38074689|ref|XP_140905.2| similar to Cathepsin B precursor (C... 187 4e-46
gi|3929733|emb|CAA77178.1| cathepsin B [Homo sapiens] 186 6e-46
gi|181178|gb|AAA52125.1| lysosomal proteinase cathepsin B 186 6e-46
gi|999909|pdb|1HUC|B Chain B, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 186 8e-46
gi|39581140|emb|CAE70997.1| Hypothetical protein CBG17829 [Caeno... 186 1e-45
gi|48762476|dbj|BAD23809.1| cathepsin B-S [Tuberaphis styraci] 185 1e-45
gi|7435782|pir||T06466 cathepsin B-like cysteine proteinase (EC ... 185 2e-45
gi|3087803|emb|CAA93279.1| cysteine protease [Haemonchus contortus] 185 2e-45
gi|3087799|emb|CAA93276.1| cysteine proteinase [Haemonchus conto... 185 2e-45
gi|48425700|pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In C... 184 2e-45
gi|18378945|ref|NP_563647.1| cathepsin B-like cysteine protease,... 184 2e-45
gi|3929817|emb|CAA77181.1| cathepsin B [Mus musculus] 183 7e-45
gi|39581138|emb|CAE70995.1| Hypothetical protein CBG17827 [Caeno... 182 9e-45
gi|48762491|dbj|BAD23815.1| cathepsin B-S [Tuberaphis coreana] 180 5e-44
gi|40557577|gb|AAR88085.1| cathepsin B-like cysteine protease [T... 180 5e-44
gi|729283|sp|Q06544|CYS3_OSTOS Cathepsin B-like cysteine protein... 178 2e-43
gi|21700775|gb|AAL60053.1| cysteine proteinase [Toxoplasma gondii] 177 3e-43
gi|10803454|emb|CAB97366.2| putative cathepsin B.3 [Ostertagia o... 174 4e-42
gi|39592834|emb|CAE62448.1| Hypothetical protein CBG06540 [Caeno... 173 6e-42
gi|10803452|emb|CAB97365.2| putative cathepsin B.2 [Ostertagia o... 171 2e-41
gi|10803437|emb|CAC13131.1| putative cathepsin B.5 [Ostertagia o... 169 8e-41
gi|3088522|gb|AAD03404.1| cathepsin B-like protease precursor [T... 169 8e-41
gi|28974200|gb|AAO61484.1| cathepsin B [Sterkiella histriomuscorum] 164 4e-39
gi|10803443|emb|CAC13134.1| putative cathepsin B.8 [Ostertagia o... 161 2e-38
gi|29840882|gb|AAP05883.1| similar to GenBank Accession Number X... 161 3e-38
gi|741376|prf||2007265A cathepsin B 160 4e-38
gi|17510377|ref|NP_490763.1| cathepsin B family member (48.2 kD)... 160 6e-38
gi|39585894|emb|CAE61308.1| Hypothetical protein CBG05143 [Caeno... 157 4e-37
gi|10803441|emb|CAC13133.1| putative cathepsin B.7 [Ostertagia o... 156 7e-37
gi|21695|emb|CAA46812.1| cathepsin B [Triticum aestivum] 154 5e-36
gi|10803450|emb|CAB97364.2| putative cathepsin B.1 [Ostertagia o... 151 2e-35
gi|162813|gb|AAA30434.1| cathepsin B 146 7e-34
gi|22653678|sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precurso... 144 4e-33
gi|10803435|emb|CAC13130.1| putative cathepsin B.4 [Ostertagia o... 144 5e-33
gi|603044|gb|AAA96832.1| cysteine protease homolog 144 5e-33
gi|6562772|emb|CAB62590.1| putative cathepsin B-like protease [P... 142 1e-32
gi|10803439|emb|CAC13132.1| putative cathepsin B.6 [Ostertagia o... 142 1e-32
gi|32129435|sp|P92133|CAL3_GIALA Cathepsin B-like CP3 precursor ... 140 4e-32
gi|15150360|gb|AAK85411.1| cathepsin B-like protease [Trypanosom... 140 7e-32
gi|29245813|gb|EAA37433.1| GLP_442_4888_3992 [Giardia lamblia AT... 139 2e-31
gi|496968|gb|AAA96831.1| cysteine protease homologue 137 3e-31
gi|17933077|gb|AAL48195.1| cathepsin C [Homo sapiens] 137 4e-31
gi|1582221|prf||2118248A prepro-cathepsin C 137 6e-31
gi|17933069|gb|AAL48191.1| cathepsin C [Homo sapiens] 137 6e-31
gi|33327024|gb|AAQ08887.1| cathepsin C [Homo sapiens] 137 6e-31
gi|4503141|ref|NP_001805.1| cathepsin C isoform a preproprotein;... 137 6e-31
gi|15723276|gb|AAL06326.1| cathepsin B-like protease [Trypanosom... 136 1e-30
gi|17933071|gb|AAL48192.1| cathepsin C [Homo sapiens] 135 2e-30
gi|15723280|gb|AAL06328.1| cathepsin B-like protease [Trypanosom... 135 2e-30
gi|29248113|gb|EAA39655.1| GLP_217_11853_10927 [Giardia lamblia ... 135 2e-30
gi|508264|gb|AAA96833.1| cysteine protease 135 2e-30
gi|29248841|gb|EAA40365.1| GLP_567_6496_7413 [Giardia lamblia AT... 135 2e-30
gi|30038325|dbj|BAC75711.1| cathepsin C [Bos taurus] 135 2e-30
gi|15723274|gb|AAL06325.1| cathepsin B-like protease [Trypanosom... 134 4e-30
gi|33417162|gb|AAH56109.1| Ctsc-prov protein [Xenopus laevis] 133 8e-30
gi|47212965|emb|CAF93376.1| unnamed protein product [Tetraodon n... 133 8e-30
gi|31560607|ref|NP_034112.2| cathepsin C preproprotein; dipeptid... 133 8e-30
gi|3023454|sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor... 132 1e-29
gi|8393218|ref|NP_058793.1| cathepsin C; Cathepsin C (dipeptidyl... 132 1e-29
gi|29249541|gb|EAA41050.1| GLP_447_16146_15244 [Giardia lamblia ... 132 1e-29
gi|47550737|ref|NP_999887.1| cathepsin C; ik:tdsubc_1h2 [Danio r... 130 4e-29
gi|15723272|gb|AAL06324.1| cathepsin B-like protease [Trypanosom... 130 4e-29
gi|16768502|gb|AAL28470.1| GM06507p [Drosophila melanogaster] 130 4e-29
gi|32129434|sp|P92132|CAL2_GIALA Cathepsin B-like CP2 precursor ... 130 5e-29
gi|24657813|ref|NP_726176.1| CG3074-PA [Drosophila melanogaster]... 130 7e-29
gi|115716|sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (D... 129 9e-29
gi|24987409|pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsi... 129 9e-29
gi|50731191|ref|XP_417207.1| PREDICTED: similar to Dipeptidyl-pe... 129 9e-29
gi|45708820|gb|AAH67941.1| LOC407938 protein [Xenopus tropicalis] 129 9e-29
gi|39595196|emb|CAE60233.1| Hypothetical protein CBG03805 [Caeno... 129 1e-28
gi|17506871|ref|NP_492593.1| tubulointerstitial nephritis antige... 128 3e-28
gi|29246290|gb|EAA37893.1| GLP_449_32565_31567 [Giardia lamblia ... 128 3e-28
gi|50744850|ref|XP_419905.1| PREDICTED: similar to tubulointerst... 127 3e-28
gi|32129433|sp|P92131|CAL1_GIALA Cathepsin B-like CP1 precursor ... 125 1e-27
gi|11545918|ref|NP_071447.1| P3ECSL; glucocorticoid-inducible pr... 124 3e-27
gi|4929827|gb|AAD34171.1| tubulo-interstitial nephritis antigen ... 124 4e-27
gi|31981314|ref|NP_036163.2| tubulointerstitial nephritis antige... 124 4e-27
gi|29248531|gb|EAA40062.1| GLP_162_1114_2025 [Giardia lamblia AT... 124 4e-27
gi|11691656|emb|CAC18646.1| cathepsin B-like protease 1 [Giardia... 124 4e-27
gi|1763659|gb|AAB58258.1| cysteine protease [Giardia intestinalis] 124 4e-27
gi|29245436|gb|EAA37074.1| GLP_113_4299_5381 [Giardia lamblia AT... 123 7e-27
gi|34864376|ref|XP_236424.2| similar to tubulo-interstitial neph... 123 7e-27
gi|12658201|gb|AAK01061.1| cysteine proteinase [Metagonimus yoko... 123 7e-27
gi|13543125|gb|AAH05738.1| Lcn7 protein [Mus musculus] >gnl|BL_O... 123 9e-27
gi|12963691|ref|NP_075965.1| lipocalin 7; androgen-regulated gen... 123 9e-27
gi|16758354|ref|NP_446034.1| lipocalin 7; glucocorticoid-inducib... 122 1e-26
gi|12330244|gb|AAG52659.1| cysteine proteinase [Metagonimus yoko... 122 1e-26
gi|47271446|ref|NP_055279.2| tubulointerstitial nephritis antige... 120 4e-26
gi|11360328|pir||JC7189 tubulointerstitial nephritis antigen - h... 120 4e-26
gi|12330246|gb|AAG52660.1| cysteine proteinase [Metagonimus yoko... 120 6e-26
gi|37905530|gb|AAO64478.1| cathepsin C precursor [Fundulus heter... 119 9e-26
gi|2330009|gb|AAB66719.1| cysteine protease [Giardia muris] 119 2e-25
gi|28804799|dbj|BAC57943.1| cathepsin C [Marsupenaeus japonicus] 117 4e-25
gi|159950|gb|AAA29435.1| cathepsin B-like cysteine protease 117 6e-25
gi|29247428|gb|EAA38990.1| GLP_542_3431_1206 [Giardia lamblia AT... 116 8e-25
gi|34098755|sp|Q9UJW2|TNAG_HUMAN Tubulointerstitial nephritis an... 116 1e-24
gi|1363085|pir||A57480 tubulointerstitial nephritis antigen prec... 115 2e-24
gi|12832450|dbj|BAB22112.1| unnamed protein product [Mus musculus] 114 5e-24
gi|13469701|gb|AAK27318.1| cysteine proteinase [Clonorchis sinen... 113 9e-24
gi|312266|emb|CAA51531.1| cathepsin B-like enzyme [Gallus gallus] 112 1e-23
gi|31198479|ref|XP_308187.1| ENSANGP00000020785 [Anopheles gambi... 112 2e-23
gi|2499875|sp|Q26563|CATC_SCHMA Cathepsin C precursor >gnl|BL_OR... 110 6e-23
gi|1584943|prf||2123443A cathepsin C 110 6e-23
gi|48762481|dbj|BAD23810.1| cathepsin B-S [Tuberaphis taiwana] 107 5e-22
gi|2599293|gb|AAC32040.1| preprocathepsin C [Schistosoma japonicum] 105 1e-21
gi|48762483|dbj|BAD23811.1| cathepsin B-S [Tuberaphis takenouchii] 103 5e-21
gi|552159|gb|AAA29434.1| cathepsin B-like cysteine protease 103 7e-21
gi|552158|gb|AAA29433.1| cathepsin B-like cysteine protease 103 7e-21
gi|39584558|emb|CAE74636.1| Hypothetical protein CBG22431 [Caeno... 102 2e-20
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 102 2e-20
gi|15419587|gb|AAK97078.1| encystation-specific protease [Giardi... 101 3e-20
gi|1763661|gb|AAB58259.1| cysteine protease [Giardia intestinalis] 100 5e-20
gi|29245258|gb|EAA36907.1| GLP_41_8294_9919 [Giardia lamblia ATC... 100 6e-20
gi|29246183|gb|EAA37790.1| GLP_549_24108_24914 [Giardia lamblia ... 100 6e-20
gi|9635308|ref|NP_059206.1| ORF58 [Xestia c-nigrum granulovirus]... 99 1e-19
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 99 2e-19
gi|23344736|gb|AAN28681.1| cathepsin B [Theromyzon tessulatum] 99 2e-19
gi|7494569|pir||T37284 cysteine proteinase (EC 3.4.22.-) - Caeno... 98 3e-19
gi|4099305|gb|AAD00577.1| cysteine proteinase [Clonorchis sinensis] 97 9e-19
gi|29249287|gb|EAA40802.1| GLP_29_33036_32140 [Giardia lamblia A... 96 1e-18
gi|17507081|ref|NP_491023.1| cathepsin Z (1D256) [Caenorhabditis... 95 2e-18
gi|39595452|emb|CAE60490.1| Hypothetical protein CBG04105 [Caeno... 95 2e-18
gi|47270758|gb|AAB54210.2| Cathepsin z protein 1 [Caenorhabditis... 95 2e-18
gi|6449324|gb|AAF08932.1| tubulointerstitial nephritis antigen i... 95 3e-18
gi|203341|gb|AAA63484.1| cathepsin H 93 1e-17
gi|1185459|gb|AAA87849.1| preprocathepsin cathepsin L 93 1e-17
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 93 1e-17
gi|1680720|gb|AAC47348.1| cysteine protease precursor [Onchocerc... 92 3e-17
gi|12958837|gb|AAK09441.1| cathepsin b-like precursor protein [A... 91 4e-17
gi|50758927|ref|XP_417483.1| PREDICTED: similar to cathepsin Y [... 91 6e-17
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 91 6e-17
gi|14290553|gb|AAH09048.1| LCN7 protein [Homo sapiens] 91 6e-17
gi|32399065|emb|CAD98305.1| cryptopain precursor [Cryptosporidiu... 90 8e-17
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 90 8e-17
gi|46561115|gb|AAT00789.1| cathepsin Z precursor [Onchocerca vol... 90 8e-17
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 90 1e-16
gi|14042811|dbj|BAB55403.1| unnamed protein product [Homo sapiens] 89 2e-16
gi|48762489|dbj|BAD23814.1| cathepsin B-N [Tuberaphis takenouchii] 89 2e-16
gi|50657031|emb|CAH04633.1| cathepsin X/O [Suberites domuncula] 88 3e-16
gi|29150712|gb|AAO64444.1| cathepsin Z-like cysteine proteinase ... 88 3e-16
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 88 3e-16
gi|37907340|gb|AAO64476.1| cathepsin Z precursor [Fundulus heter... 88 3e-16
gi|19698257|dbj|BAB86771.1| cathepsin L-like [Engraulis japonicus] 88 4e-16
gi|46948158|gb|AAT07061.1| cathepsin Z-like cysteine proteinase ... 87 5e-16
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 87 5e-16
gi|19698255|dbj|BAB86770.1| cathepsin L-like [Engraulis japonicus] 87 5e-16
gi|33242865|gb|AAQ01137.1| cathepsin [Branchiostoma lanceolatum] 87 5e-16
gi|1594287|gb|AAC48340.1| cathepsin L-like cysteine proteinase [... 87 5e-16
gi|47227517|emb|CAG04665.1| unnamed protein product [Tetraodon n... 87 5e-16
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 87 7e-16
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 87 9e-16
gi|47939805|gb|AAH72275.1| MGC82409 protein [Xenopus laevis] 87 9e-16
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 87 9e-16
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 86 1e-15
gi|47222865|emb|CAF96532.1| unnamed protein product [Tetraodon n... 86 2e-15
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 86 2e-15
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 86 2e-15
gi|4809232|gb|AAD30154.1| cathepsin Z1 preproprotein [Toxocara c... 86 2e-15
gi|48425699|pdb|1SP4|A Chain A, Crystal Structure Of Ns-134 In C... 85 3e-15
gi|39579200|emb|CAE56993.1| Hypothetical protein CBG24860 [Caeno... 85 3e-15
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n... 85 3e-15
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter... 84 4e-15
gi|452264|emb|CAA80449.1| cathepsin B-like protease [Fasciola he... 84 4e-15
gi|38014481|gb|AAH60424.1| MGC68723 protein [Xenopus laevis] 84 4e-15
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 84 4e-15
gi|33242886|gb|AAQ01147.1| cathepsin [Paralabidochromis chilotes] 84 4e-15
gi|48762487|dbj|BAD23813.1| cathepsin B-N [Tuberaphis taiwana] 84 6e-15
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 84 6e-15
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 84 6e-15
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu... 84 8e-15
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 84 8e-15
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 83 1e-14
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 83 1e-14
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 83 1e-14
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 83 1e-14
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 83 1e-14
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 83 1e-14
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 83 1e-14
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 83 1e-14
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 83 1e-14
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 83 1e-14
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter... 83 1e-14
gi|2118132|pir||JC4848 cysteine proteinase (EC 3.4.22.-) - Dougl... 83 1e-14
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 83 1e-14
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 83 1e-14
gi|14602252|ref|NP_148795.1| ORF11 cathepsin [Cydia pomonella gr... 82 2e-14
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]... 82 2e-14
gi|48762495|dbj|BAD23817.1| cathepsin B-S [Tuberaphis styraci] 82 2e-14
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 82 2e-14
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs... 82 2e-14
gi|33333694|gb|AAQ11965.1| putative gut cathepsin L-like cystein... 82 2e-14
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 82 2e-14
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 82 2e-14
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein... 82 2e-14
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein... 82 2e-14
gi|42744610|gb|AAH66625.1| Zgc:66267 protein [Danio rerio] 82 2e-14
gi|41055337|ref|NP_956720.1| hypothetical protein MGC66267 [Dani... 82 2e-14
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]... 82 2e-14
gi|29708|emb|CAA30428.1| cathepsin H [Homo sapiens] 82 2e-14
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 82 2e-14
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ... 82 2e-14
gi|33333702|gb|AAQ11969.1| putative gut cathepsin L-like cystein... 82 2e-14
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 82 3e-14
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno... 82 3e-14
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 82 3e-14
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 82 3e-14
gi|33333698|gb|AAQ11967.1| putative gut cathepsin L-like cystein... 82 3e-14
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 81 4e-14
gi|11968166|ref|NP_071720.1| cathepsin Z preproprotein; cathepsi... 81 4e-14
gi|48762497|dbj|BAD23818.1| cathepsin B-S [Tuberaphis coreana] 81 4e-14
gi|81542|pir||S02728 actinidain (EC 3.4.22.14) precursor (clone ... 81 4e-14
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 81 5e-14
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 81 5e-14
gi|34328540|ref|NP_899159.1| cathepsin Y [Rattus norvegicus] >gn... 81 5e-14
gi|118127|sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precurs... 81 5e-14
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae] 80 6e-14
gi|255032|gb|AAB23155.1| COT44=cysteine proteinase homolog [Bras... 80 6e-14
gi|11066226|gb|AAG28507.1| cathepsin Z [Mus musculus] 80 8e-14
gi|7245728|pdb|1DEU|A Chain A, Crystal Structure Of Human Procat... 80 1e-13
gi|999908|pdb|1HUC|A Chain A, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 80 1e-13
gi|17566486|ref|NP_507904.1| cathepsin H family member (5U698) [... 80 1e-13
gi|3719219|gb|AAC63141.1| preprocathepsin P [Homo sapiens] 80 1e-13
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 80 1e-13
gi|33333712|gb|AAQ11974.1| putative gut cathepsin L-like cystein... 80 1e-13
gi|33333706|gb|AAQ11971.1| putative gut cathepsin L-like cystein... 80 1e-13
gi|33333704|gb|AAQ11970.1| putative gut cathepsin L-like cystein... 80 1e-13
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 80 1e-13
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 80 1e-13
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ... 80 1e-13
gi|22538442|ref|NP_001327.2| cathepsin Z preproprotein; cathepsi... 80 1e-13
gi|3294548|gb|AAC39839.1| cathepsin Z precursor; CTSZ [Homo sapi... 80 1e-13
gi|38048307|gb|AAR10056.1| similar to Drosophila melanogaster CG... 79 1e-13
gi|945081|gb|AAC49361.1| P21 79 1e-13
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 79 2e-13
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 79 2e-13
gi|15234557|ref|NP_195406.1| cysteine proteinase, putative [Arab... 79 2e-13
gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thal... 79 2e-13
gi|118145|sp|P20721|CYSL_LYCES Low-temperature-induced cysteine ... 79 2e-13
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 79 2e-13
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ... 79 2e-13
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste... 78 3e-13
gi|1841466|emb|CAA71892.1| putative pre-pro-cysteine proteinase ... 78 3e-13
gi|33333700|gb|AAQ11968.1| putative gut cathepsin L-like cystein... 78 3e-13
gi|33333710|gb|AAQ11973.1| putative gut cathepsin L-like cystein... 78 3e-13
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 78 3e-13
gi|3650498|gb|AAC61477.1| cathepsin X precursor [Homo sapiens] 78 3e-13
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 78 4e-13
gi|37747900|gb|AAH59142.1| Ctss protein [Rattus norvegicus] 78 4e-13
gi|33333714|gb|AAQ11975.1| putative gut cathepsin L-like cystein... 78 4e-13
gi|27372529|gb|AAO03565.1| cysteine protease 8 [Entamoeba histol... 78 4e-13
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis] 78 4e-13
gi|7546545|pdb|1EF7|A Chain A, Crystal Structure Of Human Cathep... 78 4e-13
gi|12643318|sp|O70370|CATS_MOUSE Cathepsin S precursor >gnl|BL_O... 77 5e-13
gi|10946582|ref|NP_067256.1| cathepsin S preproprotein; Cat S [M... 77 5e-13
gi|12805315|gb|AAH02125.1| Ctss protein [Mus musculus] 77 5e-13
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami... 77 5e-13
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 77 5e-13
gi|20150649|pdb|1K3B|B Chain B, Crystal Structure Of Human Dipep... 77 5e-13
gi|38639319|gb|AAR25797.1| cathepsin B-like cysteine proteinase ... 77 5e-13
gi|5777889|emb|CAB53515.1| cysteine protease [Solanum tuberosum] 77 5e-13
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 77 5e-13
gi|3850787|emb|CAA05360.1| cathepsin S [Mus musculus] 77 5e-13
gi|26390492|dbj|BAC25906.1| unnamed protein product [Mus musculus] 77 5e-13
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana... 77 7e-13
gi|115747|sp|P25326|CATS_BOVIN Cathepsin S >gnl|BL_ORD_ID|168691... 77 7e-13
gi|11863537|emb|CAC18798.1| cathepsin Z [Cricetulus griseus] 77 7e-13
gi|463046|gb|AAA49207.1| cysteine proteinase 77 9e-13
gi|284028|pir||A42482 cathepsin S (EC 3.4.22.27) precursor - hum... 77 9e-13
gi|21264393|sp|P25774|CATS_HUMAN Cathepsin S precursor 77 9e-13
gi|30749675|pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin ... 77 9e-13
gi|1141745|gb|AAB04163.1| putative cysteine proteinase 77 9e-13
gi|442619|pdb|1AEC| Actinidin (E.C.3.4.22.14) Complex With The ... 77 9e-13
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 77 9e-13
gi|544090|sp|Q06964|CPP3_ENTHI Cysteine proteinase 3 precursor (... 76 1e-12
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 76 1e-12
gi|50657027|emb|CAH04631.1| cathepsin H [Suberites domuncula] 76 1e-12
gi|10798513|emb|CAC12807.1| procathepsin L3 [Fasciola hepatica] 76 1e-12
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 76 1e-12
gi|49115269|gb|AAH73266.1| Unknown (protein for MGC:80629) [Xeno... 76 2e-12
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi... 76 2e-12
gi|102197|pir||B23705 cysteine proteinase (EC 3.4.22.-) - Entamo... 76 2e-12
gi|179957|gb|AAC37592.1| cathepsin S [Homo sapiens] 76 2e-12
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap... 76 2e-12
gi|30749499|pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Boun... 76 2e-12
gi|46227982|gb|EAK88902.1| secreted papain like protease, signal... 76 2e-12
gi|33417128|gb|AAH56059.1| Ctss-prov protein [Xenopus laevis] 76 2e-12
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana... 76 2e-12
gi|23577865|ref|NP_703114.1| viral cathepsin [Rachiplusia ou mul... 76 2e-12
gi|543765|sp|P36185|ACP2_ENTHI Cysteine proteinase ACP2 precurso... 76 2e-12
gi|47230018|emb|CAG10432.1| unnamed protein product [Tetraodon n... 76 2e-12
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 76 2e-12
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 76 2e-12
gi|27497536|gb|AAO13008.1| cathepsin S preproprotein [Saimiri bo... 76 2e-12
gi|9627870|ref|NP_054157.1| viral cathepsin-like protein [Autogr... 75 2e-12
gi|33622213|ref|NP_891858.1| cathepsin [Cryptophlebia leucotreta... 75 3e-12
gi|1666270|emb|CAA49713.1| envelope glycoprotein [Autographa cal... 75 3e-12
gi|10798509|emb|CAC12805.1| procathepsin L3 [Fasciola hepatica] 75 3e-12
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 75 3e-12
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 75 3e-12
gi|102196|pir||A23705 cysteine proteinase (EC 3.4.22.-) - Entamo... 74 5e-12
gi|25188148|dbj|BAC24764.1| cathepsin L-like cysteine proteinase... 74 5e-12
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 74 5e-12
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste... 74 5e-12
gi|230417|pdb|2ACT| Actinidin (Sulfhydryl Proteinase) (E.C. Num... 74 5e-12
gi|15320768|ref|NP_203280.1| V-CATH [Epiphyas postvittana nucleo... 74 5e-12
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 74 6e-12
gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727 [Caeno... 74 6e-12
gi|544089|sp|Q01958|CPP2_ENTHI Cysteine proteinase 2 precursor >... 74 6e-12
gi|544088|sp|Q01957|CPP1_ENTHI Cysteine proteinase 1 precursor >... 74 6e-12
gi|577617|gb|AAC37213.1| cysteine proteinase 74 6e-12
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 74 8e-12
gi|25188150|dbj|BAC24765.1| cathepsin L-like cysteine proteinase... 74 8e-12
gi|5917765|gb|AAD56028.1| cysteine protease CYP1 [Solanum chacoe... 74 8e-12
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 74 8e-12
gi|18407678|ref|NP_566867.1| cysteine proteinase, putative [Arab... 73 1e-11
gi|21593501|gb|AAM65468.1| cysteine proteinase [Arabidopsis thal... 73 1e-11
gi|6562768|emb|CAB62588.1| putative cathepsin B-like protease [P... 73 1e-11
gi|6562770|emb|CAB62589.1| putative cathepsin B-like protease [P... 73 1e-11
gi|11055|emb|CAA45129.1| cysteine proteinase preproenzyme [Homar... 73 1e-11
gi|321019|pir||S19651 cysteine proteinase (EC 3.4.22.-) precurso... 73 1e-11
gi|27819101|gb|AAO23117.1| cysteine proteinase [Bombyx mori nucl... 73 1e-11
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 73 1e-11
gi|16506723|gb|AAL23917.1| cathepsin L [Fasciola gigantica] 73 1e-11
gi|118125|sp|P25784|CYS3_HOMAM Digestive cysteine proteinase 3 p... 73 1e-11
gi|25513565|pir||D89588 protein R09F10.1 [imported] - Caenorhabd... 73 1e-11
gi|1246519|emb|CAA62834.1| cysteine proteinase [Entamoeba dispar] 73 1e-11
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 73 1e-11
gi|42567068|ref|NP_567686.2| cysteine proteinase, putative [Arab... 73 1e-11
gi|452268|emb|CAA80451.1| cathepsin B-like protease [Fasciola he... 73 1e-11
gi|228244|prf||1801240B Cys protease 2 73 1e-11
gi|9630927|ref|NP_047524.1| Cystein Protease= Cathepsin=AcMNPV o... 73 1e-11
gi|228245|prf||1801240C Cys protease 3 73 1e-11
gi|11265608|pir||T46630 cysteine proteinase (EC 3.4.22.-) 1 prec... 73 1e-11
gi|23489458|gb|EAA21580.1| Homo sapiens P3ECSL-related [Plasmodi... 72 2e-11
gi|23480960|gb|EAA17381.1| cathepsin c precursor [Plasmodium yoe... 72 2e-11
gi|37655265|gb|AAQ96835.1| cysteine proteinase [Glycine max] 72 2e-11
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 72 2e-11
gi|81543|pir||S02729 actinidain (EC 3.4.22.14) precursor (clone ... 72 2e-11
gi|23200070|pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mu... 72 2e-11
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ... 72 2e-11
gi|118123|sp|P25782|CYS2_HOMAM Digestive cysteine proteinase 2 p... 72 2e-11
gi|47779249|gb|AAT38521.1| cysteine protease [Bombyx mori nucleo... 72 2e-11
gi|42408029|dbj|BAD09165.1| putative cysteine proteinase [Oryza ... 72 3e-11
gi|1246523|emb|CAA62833.1| cysteine proteinase [Entamoeba histol... 72 3e-11
gi|9630063|ref|NP_046281.1| cathepsin [Orgyia pseudotsugata mult... 72 3e-11
gi|7542602|gb|AAF63517.1| putative cystein proteinase [Capsicum ... 72 3e-11
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 72 3e-11
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 72 3e-11
gi|7435794|pir||T12039 cysteine proteinase (EC 3.4.22.-) 1 precu... 72 3e-11
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 71 4e-11
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 71 4e-11
gi|629651|pir||S47312 cysteine proteinase (EC 3.4.22.-) precurso... 71 4e-11
gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N... 71 4e-11
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 71 5e-11
gi|20150650|pdb|1K3B|C Chain C, Crystal Structure Of Human Dipep... 71 5e-11
gi|23508365|ref|NP_701034.1| hypothetical protein [Plasmodium fa... 71 5e-11
gi|50753298|ref|XP_413946.1| PREDICTED: similar to RASGRF1 prote... 70 7e-11
gi|50657029|emb|CAH04632.1| cathepsin L [Suberites domuncula] 70 7e-11
gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase ... 70 9e-11
gi|542419|pir||S41427 cysteine proteinase (EC 3.4.22.-) CP1 prec... 70 9e-11
gi|29840885|gb|AAP05886.1| similar to GenBank Accession Number A... 70 9e-11
gi|26353396|dbj|BAC40328.1| unnamed protein product [Mus musculus] 69 1e-10
gi|20069912|ref|NP_613116.1| cathepsin [Mamestra configurata nuc... 69 1e-10
gi|50251130|dbj|BAD27582.1| cathepsin S [Oryzias latipes] 69 2e-10
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 69 2e-10
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 69 2e-10
>gi|17559066|ref|NP_506790.1| cysteine PRotease related, cathepsin
B-like (40.8 kD) (cpr-3) [Caenorhabditis elegans]
gi|1169083|sp|P43507|CPR3_CAEEL Cathepsin B-like cysteine proteinase
3 precursor (Cysteine protease related 3)
gi|7511540|pir||T37282 probable cathepsin B (EC 3.4.22.1) cpr-3 -
Caenorhabditis elegans
gi|675494|gb|AAA98788.1| cathepsin B-like cysteine proteinase
gi|675496|gb|AAA98782.1| cathepsin B-like cysteine proteinase
gi|14530554|emb|CAB61032.2| Hypothetical protein T10H4.12
[Caenorhabditis elegans]
gi|14530573|emb|CAB61024.2| C. elegans CPR-3 protein (corresponding
sequence T10H4.12) [Caenorhabditis elegans]
Length = 370
Score = 723 bits (1866), Expect = 0.0
Identities = 350/363 (96%), Positives = 350/363 (96%)
Frame = -1
Query: 1092 ALFLAGCSAFVLDEIRGINIGQSPQKVLVDHVNTVQTSWVAEHNEISEFEMKFKVMDVKF 913
ALFLAGCSAFVLDEIRGINIGQSPQKVLVDHVNTVQTSWVAEHNEISEFEMKFKVMDVKF
Sbjct: 8 ALFLAGCSAFVLDEIRGINIGQSPQKVLVDHVNTVQTSWVAEHNEISEFEMKFKVMDVKF 67
Query: 912 AEPLEKDSDVASELFVRGEIVPEPLPDTFDAREKWPDCNTIKLIRNQATCGSCWAFGAAE 733
AEPLEKDSDVASELFVRGEIVPEPLPDTFDAREKWPDCNTIKLIRNQATCGSCWAFGAAE
Sbjct: 68 AEPLEKDSDVASELFVRGEIVPEPLPDTFDAREKWPDCNTIKLIRNQATCGSCWAFGAAE 127
Query: 732 VISDRVCIQSNGTQQPVISVEDILSXXXXXXXXXXXXXYSIEALRFWASSGAVTGGDYGG 553
VISDRVCIQSNGTQQPVISVEDILS YSIEALRFWASSGAVTGGDYGG
Sbjct: 128 VISDRVCIQSNGTQQPVISVEDILSCCGTTCGYGCKGGYSIEALRFWASSGAVTGGDYGG 187
Query: 552 HGCMPYSFAPCTKNCPESTTPSCKTTCQSSYKTEEYKKDKHYGASAYKVTTTKSVTEIQT 373
HGCMPYSFAPCTKNCPESTTPSCKTTCQSSYKTEEYKKDKHYGASAYKVTTTKSVTEIQT
Sbjct: 188 HGCMPYSFAPCTKNCPESTTPSCKTTCQSSYKTEEYKKDKHYGASAYKVTTTKSVTEIQT 247
Query: 372 EIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIANSWG 193
EIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIANSWG
Sbjct: 248 EIYHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKIIGWGVENGVDYWLIANSWG 307
Query: 192 TSFGEKGFFKIRRGTNECQIEGNVVAGIAKLGTHSETYEDDGGAATSCSFIMCTLMVLTY 13
TSFGEKGFFKIRRGTNECQIEGNVVAGIAKLGTHSETYEDDGGAATSCSFIMCTLMVLTY
Sbjct: 308 TSFGEKGFFKIRRGTNECQIEGNVVAGIAKLGTHSETYEDDGGAATSCSFIMCTLMVLTY 367
Query: 12 YFV 4
YFV
Sbjct: 368 YFV 370