Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= T13C5_7
         (1290 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25147567|ref|NP_741808.1| beta Carbonic Anhydrase (bca-1) [Ca...   811   0.0
gi|25147564|ref|NP_741809.1| beta Carbonic Anhydrase (30.7 kD) (...   550   e-155
gi|39598198|emb|CAE68890.1| Hypothetical protein CBG14861 [Caeno...   409   e-112
gi|7507781|pir||T16869 hypothetical protein T13C5.6 - Caenorhabd...   263   5e-69
gi|39585216|emb|CAE57459.1| Hypothetical protein CBG00424 [Caeno...   244   3e-63
gi|7509370|pir||T31522 hypothetical protein Y116A8C.28 - Caenorh...   242   2e-62
gi|24645213|ref|NP_649849.1| CG11967-PA [Drosophila melanogaster...   239   8e-62
gi|31205891|ref|XP_311897.1| ENSANGP00000017560 [Anopheles gambi...   238   2e-61
gi|39598199|emb|CAE68891.1| Hypothetical protein CBG14862 [Caeno...   196   8e-49
gi|41053465|ref|NP_956980.1| hypothetical protein MGC63910 [Dani...   138   2e-31
gi|19572988|emb|CAD28128.1| putative protein [Anopheles gambiae]...   138   3e-31
gi|6624131|gb|AAF19257.1|AC004832_2 similar to T13C5.6 gene prod...   137   4e-31
gi|27696864|ref|XP_214075.1| similar to hypothetical protein HSP...   137   6e-31
gi|31242139|ref|XP_321500.1| ENSANGP00000018160 [Anopheles gambi...   136   1e-30
gi|48097027|ref|XP_393669.1| similar to Ras-related GTP-binding ...   136   1e-30
gi|31980939|ref|NP_080719.2| RIKEN cDNA 2610507A21 [Mus musculus...   133   8e-30
gi|12848562|dbj|BAB27999.1| unnamed protein product [Mus musculus]    133   1e-29
gi|48094984|ref|XP_394322.1| similar to beta Carbonic Anhydrase ...   130   5e-29
gi|32565971|ref|NP_503031.2| putative cytoplasmic protein family...   129   2e-28
gi|47223582|emb|CAF99191.1| unnamed protein product [Tetraodon n...   125   2e-27
gi|46446564|ref|YP_007929.1| putative carbonic anhydrase [Parach...   124   4e-27
gi|47200126|emb|CAF89369.1| unnamed protein product [Tetraodon n...   117   5e-25
gi|48769978|ref|ZP_00274322.1| COG0288: Carbonic anhydrase [Rals...   115   2e-24
gi|18859915|ref|NP_573257.1| CG7772-PA [Drosophila melanogaster]...   108   4e-22
gi|34497336|ref|NP_901551.1| carbonate dehydratase [Chromobacter...   106   1e-21
gi|46314452|ref|ZP_00215038.1| COG0288: Carbonic anhydrase [Burk...   106   1e-21
gi|28872367|ref|NP_794986.1| carbonic anhydrase [Pseudomonas syr...   105   3e-21
gi|46188644|ref|ZP_00124959.2| COG0288: Carbonic anhydrase [Pseu...   105   3e-21
gi|48733582|ref|ZP_00267325.1| COG0288: Carbonic anhydrase [Pseu...   104   5e-21
gi|20151391|gb|AAM11055.1| GH10821p [Drosophila melanogaster]         104   5e-21
gi|46324033|ref|ZP_00224395.1| COG0288: Carbonic anhydrase [Burk...   102   2e-20
gi|32565973|ref|NP_872092.1| putative cytoplasmic protein family...   102   2e-20
gi|46315937|ref|ZP_00216518.1| COG0288: Carbonic anhydrase [Burk...   102   2e-20
gi|49082084|gb|AAT50442.1| PA0102 [synthetic construct]               102   3e-20
gi|15595300|ref|NP_248792.1| probable carbonic anhydrase [Pseudo...   102   3e-20
gi|15791609|ref|NP_281432.1| carbonic anyhydrase [Campylobacter ...   101   4e-20
gi|46317325|ref|ZP_00217903.1| COG0288: Carbonic anhydrase [Burk...   100   6e-20
gi|46140735|ref|ZP_00152387.2| COG0288: Carbonic anhydrase [Dech...    99   2e-19
gi|29831143|ref|NP_825777.1| putative membrane protein [Streptom...    99   3e-19
gi|32265539|ref|NP_859571.1| carbonic anhydrase [Helicobacter he...    98   5e-19
gi|49078574|gb|AAT49798.1| PA2053 [synthetic construct]                97   6e-19
gi|7705531|ref|NP_057582.1| hypothetical protein HSPC242 [Homo s...    97   8e-19
gi|37524137|ref|NP_927481.1| carbonic anhydrase [Photorhabdus lu...    97   1e-18
gi|15800068|ref|NP_286080.1| carbonic anhydrase [Escherichia col...    97   1e-18
gi|48728561|ref|ZP_00262318.1| COG0288: Carbonic anhydrase [Pseu...    97   1e-18
gi|50756737|ref|XP_415297.1| PREDICTED: similar to Hypothetical ...    97   1e-18
gi|15597249|ref|NP_250743.1| carbonate dehydratase [Pseudomonas ...    95   4e-18
gi|21242330|ref|NP_641912.1| carbonic anhydrase [Xanthomonas axo...    94   5e-18
gi|21221981|ref|NP_627760.1| putative integral membrane transpor...    94   5e-18
gi|15829646|ref|NP_308419.1| carbonic anhydrase [Escherichia col...    94   7e-18
gi|46129892|ref|ZP_00164522.2| COG0288: Carbonic anhydrase [Syne...    93   2e-17
gi|34556729|ref|NP_906544.1| CARBONIC ANYHYDRASE [Wolinella succ...    92   3e-17
gi|23104336|ref|ZP_00090802.1| COG0288: Carbonic anhydrase [Azot...    92   3e-17
gi|21230984|ref|NP_636901.1| carbonic anhydrase [Xanthomonas cam...    91   8e-17
gi|15611075|ref|NP_222726.1| Carbonic anhydrase [Helicobacter py...    91   8e-17
gi|26986845|ref|NP_742270.1| carbonic anhydrase [Pseudomonas put...    90   1e-16
gi|16330758|ref|NP_441486.1| carbonic anhydrase [Synechocystis s...    90   1e-16
gi|23128982|ref|ZP_00110818.1| COG0288: Carbonic anhydrase [Nost...    89   2e-16
gi|48785863|ref|ZP_00282072.1| COG0288: Carbonic anhydrase [Burk...    89   2e-16
gi|145642|gb|AAA23625.1| cyanate permease                              89   2e-16
gi|32043255|ref|ZP_00140517.1| COG0288: Carbonic anhydrase [Pseu...    88   5e-16
gi|2493490|sp|Q54735|CYNT_SYNY3 Carbonic anhydrase >gnl|BL_ORD_I...    87   1e-15
gi|48772106|ref|ZP_00276448.1| COG0288: Carbonic anhydrase [Rals...    87   1e-15
gi|39997405|ref|NP_953356.1| carbonic anhydrase [Geobacter sulfu...    86   1e-15
gi|45525442|ref|ZP_00176676.1| COG0288: Carbonic anhydrase [Croc...    86   2e-15
gi|29832200|ref|NP_826834.1| putative carbonic anhydrase [Strept...    85   4e-15
gi|15610409|ref|NP_217790.1| hypothetical protein Rv3273 [Mycoba...    85   4e-15
gi|15644638|ref|NP_206806.1| carbonic anhydrase (icfA) [Helicoba...    84   7e-15
gi|48847813|ref|ZP_00302062.1| COG0288: Carbonic anhydrase [Novo...    83   1e-14
gi|48731408|ref|ZP_00265153.1| COG0288: Carbonic anhydrase [Pseu...    83   1e-14
gi|46580187|ref|YP_010995.1| carbonic anhydrase [Desulfovibrio v...    79   2e-13
gi|29828752|ref|NP_823386.1| putative carbonic anhydrase [Strept...    78   4e-13
gi|30678347|ref|NP_850490.1| carbonic anhydrase 1, chloroplast /...    77   9e-13
gi|30678353|ref|NP_850491.1| carbonic anhydrase 1, chloroplast /...    77   9e-13
gi|45451864|gb|AAS65454.1| chloroplast carbonic anhydrase precur...    77   9e-13
gi|30678350|ref|NP_186799.2| carbonic anhydrase 1, chloroplast /...    77   9e-13
gi|48769555|ref|ZP_00273900.1| COG0288: Carbonic anhydrase [Rals...    76   2e-12
gi|45518361|ref|ZP_00169912.1| COG0288: Carbonic anhydrase [Rals...    75   3e-12
gi|13473511|ref|NP_105078.1| similar to carbonic anhydrase [Meso...    74   6e-12
gi|7489810|pir||T02080 probable carbonate dehydratase (EC 4.2.1....    72   3e-11
gi|30685030|ref|NP_568303.2| carbonic anhydrase 2 / carbonate de...    71   5e-11
gi|34911604|ref|NP_917149.1| carbonic anhydrase [Oryza sativa (j...    71   5e-11
gi|7436816|pir||T03254 probable carbonate dehydratase (EC 4.2.1....    71   5e-11
gi|42573371|ref|NP_974782.1| carbonic anhydrase 2 / carbonate de...    71   5e-11
gi|46322517|ref|ZP_00222886.1| COG0288: Carbonic anhydrase [Burk...    71   5e-11
gi|29653497|ref|NP_819189.1| carbonic anhydrase [Coxiella burnet...    71   6e-11
gi|21224385|ref|NP_630164.1| probable carbonic anhydrase [Strept...    71   6e-11
gi|39933309|ref|NP_945585.1| putative carbonic anhydrase [Rhodop...    71   6e-11
gi|22550386|gb|AAL51055.2| beta-carbonic anhydrase [Nicotiana ta...    70   8e-11
gi|7436815|pir||T02886 carbonate dehydratase (EC 4.2.1.1), chlor...    70   8e-11
gi|28625017|emb|CAD66064.1| carbonic anhydrase [Lotus corniculat...    70   8e-11
gi|47571703|ref|ZP_00241752.1| COG0288: Carbonic anhydrase [Rubr...    70   8e-11
gi|48855748|ref|ZP_00309906.1| COG0288: Carbonic anhydrase [Cyto...    70   8e-11
gi|3061271|dbj|BAA25639.1| NPCA1 [Nicotiana paniculata]                70   8e-11
gi|49476257|ref|YP_034298.1| Carbonic anhydrase protein [Bartone...    70   1e-10
gi|115473|sp|P27141|CAHC_TOBAC Carbonic anhydrase, chloroplast p...    70   1e-10
gi|438449|gb|AAA50156.1| carbonic anhydrase                            70   1e-10
gi|7436820|pir||T09797 carbonate dehydratase (EC 4.2.1.1) 1b - P...    70   1e-10
gi|882246|gb|AAA69027.1| carbonic anhydrase 2                          70   1e-10
gi|7489809|pir||T02079 probable carbonate dehydratase (EC 4.2.1....    70   1e-10
gi|15220853|ref|NP_173785.1| carbonic anhydrase, putative / carb...    69   2e-10
gi|7436819|pir||T09793 carbonate dehydratase (EC 4.2.1.1) 1a - P...    69   2e-10
gi|46446692|ref|YP_008057.1| putative carbonate dehydratase, cyn...    69   2e-10
gi|45916910|ref|ZP_00197675.1| COG0288: Carbonic anhydrase [Meso...    69   3e-10
gi|1168738|sp|P46512|CAH1_FLALI Carbonic anhydrase 1 (Carbonate ...    68   4e-10
gi|23502682|ref|NP_698809.1| carbonic anhydrase, putative [Bruce...    68   4e-10
gi|17986506|ref|NP_539140.1| CARBONIC ANHYDRASE [Brucella melite...    68   4e-10
gi|4754913|gb|AAD29049.1| carbonic anhydrase isoform 1 [Gossypiu...    68   5e-10
gi|15889755|ref|NP_355436.1| AGR_C_4521p [Agrobacterium tumefaci...    67   7e-10
gi|4754915|gb|AAD29050.1| carbonic anhydrase isoform 2 [Gossypiu...    67   7e-10
gi|20502881|gb|AAM22683.1| carbonic anhydrase [Gossypium hirsutum]     67   7e-10
gi|42523716|ref|NP_969096.1| cah [Bdellovibrio bacteriovorus HD1...    67   9e-10
gi|882248|gb|AAA69028.1| carbonic anhydrase 1                          67   1e-09
gi|1168746|sp|P46511|CAHX_FLABR Carbonic anhydrase (Carbonate de...    66   2e-09
gi|47606728|sp|P46510|CAHX_FLABI Carbonic anhydrase (Carbonate d...    66   2e-09
gi|1084443|pir||S48675 carbonate dehydratase (EC 4.2.1.1) precur...    66   2e-09
gi|39995178|ref|NP_951129.1| carbonic anhydrase [Geobacter sulfu...    66   2e-09
gi|1168747|sp|P46281|CAHX_FLAPR Carbonic anhydrase (Carbonate de...    66   2e-09
gi|729003|sp|P40880|CAHC_HORVU Carbonic anhydrase, chloroplast p...    65   5e-09
gi|33594307|ref|NP_881951.1| putative carbonic anhydrase [Bordet...    64   6e-09
gi|15967071|ref|NP_387424.1| PUTATIVE CARBONIC ANHYDRASE PROTEIN...    64   6e-09
gi|50725202|dbj|BAD33953.1| putative carbonic anhydrase [Oryza s...    64   8e-09
gi|27652184|gb|AAO17573.1| carbonic anhydrase 2 [Flaveria bidentis]    64   8e-09
gi|19113304|ref|NP_596512.1| carbonic anhydrase [Schizosaccharom...    64   1e-08
gi|115471|sp|P17067|CAHC_PEA Carbonic anhydrase, chloroplast pre...    63   1e-08
gi|8569250|pdb|1EKJ|A Chain A, The X-Ray Crystallographic Struct...    63   1e-08
gi|33595113|ref|NP_882756.1| putative carbonic anhydrase [Bordet...    63   1e-08
gi|32416722|ref|XP_328839.1| hypothetical protein [Neurospora cr...    63   1e-08
gi|30696223|ref|NP_176114.2| carbonic anhydrase family protein /...    63   2e-08
gi|48846355|ref|ZP_00300619.1| COG0288: Carbonic anhydrase [Geob...    63   2e-08
gi|8954289|gb|AAD27876.2| carbonic anhydrase [Vigna radiata]           62   2e-08
gi|1168740|sp|P46513|CAH2_FLALI Carbonic anhydrase 2 (Carbonate ...    62   3e-08
gi|169057|gb|AAA33652.1| carbonic anhydrase >gnl|BL_ORD_ID|13439...    62   3e-08
gi|48833898|ref|ZP_00290914.1| COG0288: Carbonic anhydrase [Magn...    62   4e-08
gi|24213279|ref|NP_710760.1| Carbonic anhydrase [Leptospira inte...    62   4e-08
gi|30698715|ref|NP_849872.1| carbonic anhydrase, putative / carb...    62   4e-08
gi|15223141|ref|NP_177198.1| carbonic anhydrase, putative / carb...    62   4e-08
gi|170102|gb|AAA34026.1| carbonic anhydrase precursor                  61   5e-08
gi|227613|prf||1707317A carbonic anhydrase                             61   7e-08
gi|115472|sp|P16016|CAHC_SPIOL Carbonic anhydrase, chloroplast p...    61   7e-08
gi|1395172|dbj|BAA12981.1| carbonic anhydrase [Porphyridium purp...    61   7e-08
gi|7245350|pdb|1DDZ|A Chain A, X-Ray Structure Of A Beta-Carboni...    60   9e-08
gi|1395170|dbj|BAA12980.1| carbonic anhydrase [Porphyridium purp...    60   9e-08
gi|46192995|ref|ZP_00005607.2| COG0288: Carbonic anhydrase [Rhod...    60   1e-07
gi|45508227|ref|ZP_00160567.1| COG0288: Carbonic anhydrase [Anab...    60   1e-07
gi|25404198|pir||B96615 probable carbonic anhydrase T18I24.9 [im...    60   1e-07
gi|32407071|ref|XP_324135.1| hypothetical protein [Neurospora cr...    59   2e-07
gi|4902525|emb|CAB43571.1| carbonic anhydrase [Glycine max]            59   2e-07
gi|38104258|gb|EAA50852.1| hypothetical protein MG04611.4 [Magna...    59   2e-07
gi|27375611|ref|NP_767140.1| carbonate dehydratase [Bradyrhizobi...    59   3e-07
gi|27652186|gb|AAO17574.1| carbonic anhydrase 3 [Flaveria bidentis]    59   3e-07
gi|12001986|gb|AAG43136.1| My022 protein [Homo sapiens]                58   6e-07
gi|50875826|emb|CAG35666.1| probable carbonic anhydrase [Desulfo...    57   7e-07
gi|15778654|gb|AAL07493.1| intracellular beta-type carbonic anhy...    57   9e-07
gi|23130016|ref|ZP_00111837.1| COG0288: Carbonic anhydrase [Nost...    57   9e-07
gi|50556600|ref|XP_505708.1| hypothetical protein [Yarrowia lipo...    57   9e-07
gi|7436818|pir||T09570 carbonate dehydratase (EC 4.2.1.1) - alfa...    57   1e-06
gi|18418245|ref|NP_567928.1| carbonic anhydrase family protein /...    57   1e-06
gi|32476768|ref|NP_869762.1| probable sulfate transporter [Pirel...    56   2e-06
gi|48849318|ref|ZP_00303561.1| COG0288: Carbonic anhydrase [Novo...    56   2e-06
gi|1663720|gb|AAC33484.1| beta-type carbonic anhydrase beta-CA1 ...    55   3e-06
gi|30696219|ref|NP_849823.1| carbonic anhydrase family protein /...    55   5e-06
gi|21539555|gb|AAM53330.1| putative carbonic anhydrase [Arabidop...    55   5e-06
gi|23466702|ref|ZP_00122289.1| COG0288: Carbonic anhydrase [Haem...    55   5e-06
gi|49096576|ref|XP_409748.1| hypothetical protein AN5611.2 [Aspe...    54   6e-06
gi|28899288|ref|NP_798893.1| putative carbonic anhydrase [Vibrio...    54   6e-06
gi|16273213|ref|NP_439452.1| carbonic anhydrase [Haemophilus inf...    54   1e-05
gi|15640607|ref|NP_230236.1| carbonic anhydrase, putative [Vibri...    54   1e-05
gi|32394562|gb|AAM93979.1| carbonic anhydrase [Griffithsia japon...    54   1e-05
gi|18314239|ref|NP_560906.1| carbonic anhydrase part 1, authenti...    53   1e-05
gi|46359649|dbj|BAD15329.1| carbonic anhydrase [Hydrogenovibrio ...    53   2e-05
gi|42629533|ref|ZP_00155079.1| COG0288: Carbonic anhydrase [Haem...    52   2e-05
gi|33866997|ref|NP_898556.1| carbonic anhydrase [Synechococcus s...    52   2e-05
gi|21231010|ref|NP_636927.1| carbonic anhydrase [Xanthomonas cam...    52   3e-05
gi|17548333|ref|NP_521673.1| PUTATIVE CARBONIC ANHYDRASE PROTEIN...    52   3e-05
gi|46117432|ref|XP_384734.1| hypothetical protein FG04558.1 [Gib...    52   3e-05
gi|37524862|ref|NP_928206.1| hypothetical protein [Photorhabdus ...    52   4e-05
gi|41406568|ref|NP_959404.1| hypothetical protein MAP0470 [Mycob...    51   7e-05
gi|21242354|ref|NP_641936.1| carbonic anhydrase [Xanthomonas axo...    50   9e-05
gi|40218045|gb|AAR82947.1| chloroplast beta carbonic anhydrase [...    50   9e-05
gi|38234543|ref|NP_940310.1| Putative carbonic anhydrase [Coryne...    50   9e-05
gi|15895747|ref|NP_349096.1| Carbonic anhydrase [Clostridium ace...    50   1e-04
gi|21242214|ref|NP_641796.1| carbonic anhydrase [Xanthomonas axo...    50   1e-04
gi|46914708|emb|CAG21485.1| putative Carbonic anhydrase [Photoba...    50   2e-04
gi|21230875|ref|NP_636792.1| carbonic anhydrase [Xanthomonas cam...    50   2e-04
gi|46311350|ref|ZP_00211958.1| COG0288: Carbonic anhydrase [Burk...    50   2e-04
gi|49067052|ref|XP_397816.1| hypothetical protein UM00201.1 [Ust...    49   2e-04
gi|33152436|ref|NP_873789.1| probable carbonic anhydrase [Haemop...    49   2e-04
gi|15602440|ref|NP_245512.1| unknown [Pasteurella multocida Pm70...    49   2e-04
gi|15610724|ref|NP_218105.1| hypothetical protein Rv3588c [Mycob...    49   2e-04
gi|22996066|ref|ZP_00040339.1| COG0288: Carbonic anhydrase [Xyle...    49   3e-04
gi|28199671|ref|NP_779985.1| carbonic anhydrase [Xylella fastidi...    49   3e-04
gi|48863509|ref|ZP_00317403.1| COG0288: Carbonic anhydrase [Micr...    49   3e-04
gi|45521603|ref|ZP_00173121.1| COG0288: Carbonic anhydrase [Meth...    49   3e-04
gi|48854751|ref|ZP_00308912.1| COG0288: Carbonic anhydrase [Cyto...    49   3e-04
gi|19553866|ref|NP_601868.1| carbonic anhydrase [Corynebacterium...    49   3e-04
gi|15029386|gb|AAK81867.1| putative carbonic anhydrase [Streptoc...    49   3e-04
gi|38100190|gb|EAA47356.1| hypothetical protein MG02599.4 [Magna...    49   3e-04
gi|48866613|ref|ZP_00320404.1| COG0288: Carbonic anhydrase [Haem...    49   3e-04
gi|24374018|ref|NP_718061.1| carbonic anhydrase family protein [...    49   3e-04
gi|46319555|ref|ZP_00219959.1| COG0288: Carbonic anhydrase [Burk...    48   4e-04
gi|28868548|ref|NP_791167.1| carbonic anhydrase [Pseudomonas syr...    48   4e-04
gi|22994211|ref|ZP_00038724.1| COG0288: Carbonic anhydrase [Xyle...    48   6e-04
gi|50258427|gb|EAL21116.1| hypothetical protein CNBD4920 [Crypto...    48   6e-04
gi|31794765|ref|NP_857258.1| CARBONIC ANHYDRASE (CARBONATE DEHYD...    48   6e-04
gi|48784240|ref|ZP_00280606.1| COG0288: Carbonic anhydrase [Burk...    48   6e-04
gi|23014103|ref|ZP_00053939.1| COG0288: Carbonic anhydrase [Magn...    47   8e-04
gi|22124692|ref|NP_668115.1| putative carbonic anhdrase [Yersini...    47   0.001
gi|45440138|ref|NP_991677.1| putative carbonic anhdrase [Yersini...    47   0.001
gi|37680952|ref|NP_935561.1| carbonic anhydrase [Vibrio vulnific...    47   0.001
gi|16123556|ref|NP_406869.1| putative carbonic anhydrase [Yersin...    47   0.001
gi|15799810|ref|NP_285822.1| putative carbonic anhdrase (EC 4.2....    47   0.001
gi|23465200|ref|NP_695803.1| probable carbonic anhydrase [Bifido...    47   0.001
gi|46190352|ref|ZP_00121592.2| COG0288: Carbonic anhydrase [Bifi...    47   0.001
gi|17544996|ref|NP_518398.1| PROBABLE CARBONIC ANHYDRASE PROTEIN...    47   0.001
gi|27377176|ref|NP_768705.1| carbonic anhydrase [Bradyrhizobium ...    46   0.002
gi|32035844|ref|ZP_00135664.1| COG0288: Carbonic anhydrase [Acti...    46   0.002
gi|46141480|ref|ZP_00146742.2| COG0288: Carbonic anhydrase [Psyc...    46   0.002
gi|47574193|ref|ZP_00244229.1| COG0288: Carbonic anhydrase [Rubr...    46   0.002
gi|50084256|ref|YP_045766.1| putative carbonic anhydrase [Acinet...    46   0.002
gi|48764476|ref|ZP_00269028.1| COG0288: Carbonic anhydrase [Rhod...    46   0.002
gi|16127799|ref|NP_422363.1| carbonic anhydrase family protein [...    46   0.002
gi|27365000|ref|NP_760528.1| Carbonic anhydrase [Vibrio vulnific...    46   0.002
gi|27379976|ref|NP_771505.1| bll4865 [Bradyrhizobium japonicum U...    46   0.002
gi|15837482|ref|NP_298170.1| carbonic anhydrase [Xylella fastidi...    46   0.002
gi|16759167|ref|NP_454784.1| carbonic anhydrase [Salmonella ente...    46   0.002
gi|15599871|ref|NP_253365.1| probable carbonic anhydrase [Pseudo...    45   0.003
gi|49078550|gb|AAT49796.1| PA4676 [synthetic construct]                45   0.003
gi|48855957|ref|ZP_00310115.1| COG0288: Carbonic anhydrase [Cyto...    45   0.003
gi|22531311|emb|CAC80134.1| beta-carbonic anhydrase [Ralstonia e...    45   0.003
gi|39996542|ref|NP_952493.1| carbonic anhydrase family protein [...    45   0.004
gi|16763561|ref|NP_459176.1| putative carbonic anhydrase [Salmon...    45   0.004
gi|27379974|ref|NP_771503.1| bll4863 [Bradyrhizobium japonicum U...    45   0.004
gi|38110319|gb|EAA56056.1| hypothetical protein MG01707.4 [Magna...    45   0.005
gi|48846021|ref|ZP_00300289.1| COG0288: Carbonic anhydrase [Geob...    45   0.005
gi|46323657|ref|ZP_00224020.1| COG0288: Carbonic anhydrase [Burk...    45   0.005
gi|50256218|gb|EAL18945.1| hypothetical protein CNBI2060 [Crypto...    45   0.005
gi|50086360|ref|YP_047870.1| putative sulfate permease [Acinetob...    44   0.006
gi|48770499|ref|ZP_00274842.1| COG0288: Carbonic anhydrase [Rals...    44   0.006
gi|50259484|gb|EAL22157.1| hypothetical protein CNBC2950 [Crypto...    44   0.006
gi|46312313|ref|ZP_00212910.1| COG0288: Carbonic anhydrase [Burk...    44   0.006
gi|48785864|ref|ZP_00282073.1| COG0288: Carbonic anhydrase [Burk...    44   0.006
gi|26246066|ref|NP_752105.1| Protein yadF [Escherichia coli CFT0...    44   0.008
gi|16128119|ref|NP_414668.1| putative carbonic anhdrase (EC 4.2....    44   0.008
gi|21492771|ref|NP_659846.1| probable carbonic anhydrase. [Rhizo...    44   0.008
gi|39995915|ref|NP_951866.1| carbonic anhydrase, putative [Geoba...    44   0.008
gi|15679577|ref|NP_276694.1| carbonic anhydrase [Methanothermoba...    44   0.008
gi|48846662|ref|ZP_00300922.1| COG0288: Carbonic anhydrase [Geob...    44   0.011
gi|23500522|ref|NP_699962.1| carbonic anhydrase [Brucella suis 1...    44   0.011
gi|37520514|ref|NP_923891.1| carbonate dehydratase [Gloeobacter ...    43   0.014
gi|45515915|ref|ZP_00167469.1| COG0288: Carbonic anhydrase [Rals...    43   0.014
gi|15828030|ref|NP_302293.1| putative carbonic anhydrase [Mycoba...    43   0.014
gi|39933876|ref|NP_946152.1| putative carbonic anhydrase [Rhodop...    43   0.014
gi|16331473|ref|NP_442201.1| carbonic anhydrase [Synechocystis s...    43   0.014
gi|30249878|ref|NP_841948.1| Prokaryotic-type carbonic anhydrase...    43   0.014
gi|23098552|ref|NP_692018.1| carbonic anhydrase [Oceanobacillus ...    43   0.018
gi|14277936|pdb|1I6O|A Chain A, Crystal Structure Of E. Coli Bet...    42   0.024
gi|25029083|ref|NP_739137.1| conserved hypothetical protein [Cor...    42   0.024
gi|21238981|dbj|BAB96702.1| Cyanate permease homolog. [Escherich...    42   0.024
gi|49088178|ref|XP_405942.1| hypothetical protein AN1805.2 [Aspe...    42   0.024
gi|1272331|gb|AAC44811.1| orf3; similar to carbonic anhydrase fr...    42   0.032
gi|50306805|ref|XP_453378.1| unnamed protein product [Kluyveromy...    42   0.032
gi|48730071|ref|ZP_00263819.1| COG0288: Carbonic anhydrase [Pseu...    42   0.032
gi|1279772|gb|AAC44822.1| orf3; similar to the carbonic anhydras...    42   0.032
gi|23125571|ref|ZP_00107498.1| COG0288: Carbonic anhydrase [Nost...    42   0.032
gi|50875739|emb|CAG35579.1| probable carbonic anhydrase [Desulfo...    42   0.041
gi|21222134|ref|NP_627913.1| putative carbonic anhydrase [Strept...    42   0.041
gi|1513236|gb|AAB06760.1| carbonic anhydrase                           41   0.070
gi|33600463|ref|NP_888023.1| Putative carbonic anhydrase precurs...    41   0.070
gi|33596697|ref|NP_884340.1| Putative carbonic anhydrase precurs...    41   0.070
gi|37521657|ref|NP_925034.1| periplasmic beta-type carbonic anhy...    41   0.070
gi|50122249|ref|YP_051416.1| putative carbonic anhydrase [Erwini...    41   0.070
gi|17230402|ref|NP_486950.1| carbonate dehydratase [Nostoc sp. P...    40   0.092
gi|45505459|ref|ZP_00157840.1| COG0288: Carbonic anhydrase [Anab...    40   0.092
gi|45505460|ref|ZP_00157841.1| COG0288: Carbonic anhydrase [Anab...    40   0.092
gi|46188217|ref|ZP_00125387.2| COG0288: Carbonic anhydrase [Pseu...    40   0.12
gi|46443601|gb|EAL02882.1| hypothetical protein CaO19.9289 [Cand...    40   0.12
gi|13786684|pdb|1G5C|A Chain A, Crystal Structure Of The 'cab' T...    40   0.16
gi|32042150|ref|ZP_00139733.1| COG0288: Carbonic anhydrase [Pseu...    40   0.16
gi|16127802|ref|NP_422366.1| carbonic anhydrase [Caulobacter cre...    39   0.20
gi|46366969|ref|ZP_00199473.2| COG0288: Carbonic anhydrase [Kine...    39   0.20
gi|23129848|ref|ZP_00111671.1| COG0288: Carbonic anhydrase [Nost...    39   0.20
gi|28829996|gb|AAO52486.1| similar to Dictyostelium discoideum (...    39   0.20
gi|28868214|ref|NP_790833.1| carbonic anhydrase [Pseudomonas syr...    39   0.27
gi|25010185|ref|NP_734580.1| Unknown [Streptococcus agalactiae N...    39   0.27
gi|49103716|ref|XP_411179.1| hypothetical protein AN7042.2 [Aspe...    39   0.35
gi|22536296|ref|NP_687147.1| carbonic anhydrase-related protein ...    39   0.35
gi|16121130|ref|NP_404443.1| putative carbonic anhydrase [Yersin...    38   0.46
gi|15674422|ref|NP_268596.1| conserved hypothetical protein [Str...    38   0.46
gi|15899971|ref|NP_344575.1| conserved hypothetical protein [Str...    38   0.46
gi|19745373|ref|NP_606509.1| conserved hypothetical protein [Str...    38   0.46
gi|21909704|ref|NP_663972.1| conserved hypothetical protein [Str...    38   0.46
gi|15807230|ref|NP_295960.1| carbonic anhydrase [Deinococcus rad...    38   0.46
gi|1737488|gb|AAC49888.1| beta-carbonic anhydrase [Chlamydomonas...    38   0.46
gi|7484356|pir||T08204 carbonate dehydratase (EC 4.2.1.1) precur...    38   0.46
gi|1323551|gb|AAB19184.1| carbonic anhydrase precursor                 38   0.46
gi|1323549|gb|AAB19183.1| carbonic anhydrase precursor                 38   0.46
gi|50409399|ref|XP_456870.1| unnamed protein product [Debaryomyc...    38   0.59
gi|46114256|ref|XP_383146.1| hypothetical protein FG02970.1 [Gib...    38   0.59
gi|26988802|ref|NP_744227.1| diaminopimelate decarboxylase [Pseu...    38   0.59
gi|48374226|gb|AAT41924.1| putative carbonic anhydrase [Fremyell...    38   0.59
gi|50427865|ref|XP_462545.1| unnamed protein product [Debaryomyc...    38   0.59
gi|17988847|ref|NP_541480.1| CARBONIC ANHYDRASE [Brucella melite...    38   0.59
gi|50590093|ref|ZP_00331521.1| COG0288: Carbonic anhydrase [Stre...    38   0.59
gi|32412232|ref|XP_326596.1| predicted protein [Neurospora crass...    37   0.78
gi|48834975|ref|ZP_00291978.1| COG0288: Carbonic anhydrase [Ther...    37   0.78
gi|48786371|ref|ZP_00282505.1| COG0288: Carbonic anhydrase [Burk...    37   0.78
gi|38110990|gb|EAA56629.1| hypothetical protein MG06600.4 [Magna...    37   1.0
gi|47060327|ref|NP_665783.2| pANL45 [Synechococcus elongatus PCC...    37   1.0
gi|23473823|ref|ZP_00129118.1| COG0288: Carbonic anhydrase [Desu...    37   1.0
gi|45511629|ref|ZP_00163197.1| COG0288: Carbonic anhydrase [Syne...    37   1.0
gi|12084975|ref|NP_073268.1| Mig5 [Salmonella enterica subsp. en...    37   1.3
gi|2460260|gb|AAB80735.1| putative carbonic anhydrase Mig-5 [Sal...    37   1.3
gi|32411923|ref|XP_326442.1| predicted protein [Neurospora crass...    36   1.7
gi|15902070|ref|NP_357620.1| Conserved hypothetical protein [Str...    36   1.7
gi|46121779|ref|XP_385443.1| hypothetical protein FG05267.1 [Gib...    36   1.7
gi|23126746|ref|ZP_00108634.1| COG0288: Carbonic anhydrase [Nost...    36   1.7
gi|46364764|ref|ZP_00227344.1| COG0288: Carbonic anhydrase [Kine...    36   1.7
gi|41408585|ref|NP_961421.1| hypothetical protein MAP2487c [Myco...    36   2.3
gi|38109578|gb|EAA55427.1| hypothetical protein MG09234.4 [Magna...    36   2.3
gi|45358862|ref|NP_988419.1| carbonic anhydrase [Methanococcus m...    35   2.9
gi|37526161|ref|NP_929505.1| hypothetical protein [Photorhabdus ...    35   2.9
gi|24378826|ref|NP_720781.1| putative carbonic anhydrase [Strept...    35   3.9
gi|46437406|gb|EAK96753.1| hypothetical protein CaO19.2836 [Cand...    35   3.9
gi|32488438|emb|CAE03280.1| OSJNBa0072K14.13 [Oryza sativa (japo...    35   3.9
gi|39934900|ref|NP_947176.1| conserved hypothetical protein [Rho...    35   3.9
gi|50310487|ref|XP_455263.1| unnamed protein product [Kluyveromy...    35   5.0
gi|4028948|gb|AAC97147.1| Nra [Streptococcus pyogenes]                 31   5.7
gi|21909633|ref|NP_663901.1| negative transcriptional regulator ...    31   5.7
gi|42523230|ref|NP_968610.1| putative carbonic anhydrase [Bdello...    34   6.6
gi|48113517|ref|XP_396355.1| similar to MGC52879 protein [Apis m...    34   6.6
gi|20089546|ref|NP_615621.1| Na+-transporting NADH:ubiquinone ox...    34   8.6


>gi|25147567|ref|NP_741808.1| beta Carbonic Anhydrase (bca-1)
            [Caenorhabditis elegans]
 gi|20198884|gb|AAM15604.1| Beta carbonic anhydrase protein 1, isoform
            b [Caenorhabditis elegans]
          Length = 429

 Score =  811 bits (2095), Expect = 0.0
 Identities = 407/429 (94%), Positives = 407/429 (94%)
 Frame = -1

Query: 1290 MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLXXXXXXXXXXXVAFGYVAADSIDKGL 1111
            MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSL           VAFGYVAADSIDKGL
Sbjct: 1    MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSIDKGL 60

Query: 1110 QEYIXXXXXXXXXXXKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN 931
            QEYI           KVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN
Sbjct: 61   QEYIKTHSTSTEKTKKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN 120

Query: 930  MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK 751
            MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK
Sbjct: 121  MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK 180

Query: 750  QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV 571
            QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV
Sbjct: 181  QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV 240

Query: 570  NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS 391
            NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS
Sbjct: 241  NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS 300

Query: 390  VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF 211
            VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF
Sbjct: 301  VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF 360

Query: 210  LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD 31
            LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD
Sbjct: 361  LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD 420

Query: 30   GPVAFAKSN 4
            GPVAFAKSN
Sbjct: 421  GPVAFAKSN 429




[DB home][top]