Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T13C5_7
(1290 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25147567|ref|NP_741808.1| beta Carbonic Anhydrase (bca-1) [Ca... 811 0.0
gi|25147564|ref|NP_741809.1| beta Carbonic Anhydrase (30.7 kD) (... 550 e-155
gi|39598198|emb|CAE68890.1| Hypothetical protein CBG14861 [Caeno... 409 e-112
gi|7507781|pir||T16869 hypothetical protein T13C5.6 - Caenorhabd... 263 5e-69
gi|39585216|emb|CAE57459.1| Hypothetical protein CBG00424 [Caeno... 244 3e-63
gi|7509370|pir||T31522 hypothetical protein Y116A8C.28 - Caenorh... 242 2e-62
gi|24645213|ref|NP_649849.1| CG11967-PA [Drosophila melanogaster... 239 8e-62
gi|31205891|ref|XP_311897.1| ENSANGP00000017560 [Anopheles gambi... 238 2e-61
gi|39598199|emb|CAE68891.1| Hypothetical protein CBG14862 [Caeno... 196 8e-49
gi|41053465|ref|NP_956980.1| hypothetical protein MGC63910 [Dani... 138 2e-31
gi|19572988|emb|CAD28128.1| putative protein [Anopheles gambiae]... 138 3e-31
gi|6624131|gb|AAF19257.1|AC004832_2 similar to T13C5.6 gene prod... 137 4e-31
gi|27696864|ref|XP_214075.1| similar to hypothetical protein HSP... 137 6e-31
gi|31242139|ref|XP_321500.1| ENSANGP00000018160 [Anopheles gambi... 136 1e-30
gi|48097027|ref|XP_393669.1| similar to Ras-related GTP-binding ... 136 1e-30
gi|31980939|ref|NP_080719.2| RIKEN cDNA 2610507A21 [Mus musculus... 133 8e-30
gi|12848562|dbj|BAB27999.1| unnamed protein product [Mus musculus] 133 1e-29
gi|48094984|ref|XP_394322.1| similar to beta Carbonic Anhydrase ... 130 5e-29
gi|32565971|ref|NP_503031.2| putative cytoplasmic protein family... 129 2e-28
gi|47223582|emb|CAF99191.1| unnamed protein product [Tetraodon n... 125 2e-27
gi|46446564|ref|YP_007929.1| putative carbonic anhydrase [Parach... 124 4e-27
gi|47200126|emb|CAF89369.1| unnamed protein product [Tetraodon n... 117 5e-25
gi|48769978|ref|ZP_00274322.1| COG0288: Carbonic anhydrase [Rals... 115 2e-24
gi|18859915|ref|NP_573257.1| CG7772-PA [Drosophila melanogaster]... 108 4e-22
gi|34497336|ref|NP_901551.1| carbonate dehydratase [Chromobacter... 106 1e-21
gi|46314452|ref|ZP_00215038.1| COG0288: Carbonic anhydrase [Burk... 106 1e-21
gi|28872367|ref|NP_794986.1| carbonic anhydrase [Pseudomonas syr... 105 3e-21
gi|46188644|ref|ZP_00124959.2| COG0288: Carbonic anhydrase [Pseu... 105 3e-21
gi|48733582|ref|ZP_00267325.1| COG0288: Carbonic anhydrase [Pseu... 104 5e-21
gi|20151391|gb|AAM11055.1| GH10821p [Drosophila melanogaster] 104 5e-21
gi|46324033|ref|ZP_00224395.1| COG0288: Carbonic anhydrase [Burk... 102 2e-20
gi|32565973|ref|NP_872092.1| putative cytoplasmic protein family... 102 2e-20
gi|46315937|ref|ZP_00216518.1| COG0288: Carbonic anhydrase [Burk... 102 2e-20
gi|49082084|gb|AAT50442.1| PA0102 [synthetic construct] 102 3e-20
gi|15595300|ref|NP_248792.1| probable carbonic anhydrase [Pseudo... 102 3e-20
gi|15791609|ref|NP_281432.1| carbonic anyhydrase [Campylobacter ... 101 4e-20
gi|46317325|ref|ZP_00217903.1| COG0288: Carbonic anhydrase [Burk... 100 6e-20
gi|46140735|ref|ZP_00152387.2| COG0288: Carbonic anhydrase [Dech... 99 2e-19
gi|29831143|ref|NP_825777.1| putative membrane protein [Streptom... 99 3e-19
gi|32265539|ref|NP_859571.1| carbonic anhydrase [Helicobacter he... 98 5e-19
gi|49078574|gb|AAT49798.1| PA2053 [synthetic construct] 97 6e-19
gi|7705531|ref|NP_057582.1| hypothetical protein HSPC242 [Homo s... 97 8e-19
gi|37524137|ref|NP_927481.1| carbonic anhydrase [Photorhabdus lu... 97 1e-18
gi|15800068|ref|NP_286080.1| carbonic anhydrase [Escherichia col... 97 1e-18
gi|48728561|ref|ZP_00262318.1| COG0288: Carbonic anhydrase [Pseu... 97 1e-18
gi|50756737|ref|XP_415297.1| PREDICTED: similar to Hypothetical ... 97 1e-18
gi|15597249|ref|NP_250743.1| carbonate dehydratase [Pseudomonas ... 95 4e-18
gi|21242330|ref|NP_641912.1| carbonic anhydrase [Xanthomonas axo... 94 5e-18
gi|21221981|ref|NP_627760.1| putative integral membrane transpor... 94 5e-18
gi|15829646|ref|NP_308419.1| carbonic anhydrase [Escherichia col... 94 7e-18
gi|46129892|ref|ZP_00164522.2| COG0288: Carbonic anhydrase [Syne... 93 2e-17
gi|34556729|ref|NP_906544.1| CARBONIC ANYHYDRASE [Wolinella succ... 92 3e-17
gi|23104336|ref|ZP_00090802.1| COG0288: Carbonic anhydrase [Azot... 92 3e-17
gi|21230984|ref|NP_636901.1| carbonic anhydrase [Xanthomonas cam... 91 8e-17
gi|15611075|ref|NP_222726.1| Carbonic anhydrase [Helicobacter py... 91 8e-17
gi|26986845|ref|NP_742270.1| carbonic anhydrase [Pseudomonas put... 90 1e-16
gi|16330758|ref|NP_441486.1| carbonic anhydrase [Synechocystis s... 90 1e-16
gi|23128982|ref|ZP_00110818.1| COG0288: Carbonic anhydrase [Nost... 89 2e-16
gi|48785863|ref|ZP_00282072.1| COG0288: Carbonic anhydrase [Burk... 89 2e-16
gi|145642|gb|AAA23625.1| cyanate permease 89 2e-16
gi|32043255|ref|ZP_00140517.1| COG0288: Carbonic anhydrase [Pseu... 88 5e-16
gi|2493490|sp|Q54735|CYNT_SYNY3 Carbonic anhydrase >gnl|BL_ORD_I... 87 1e-15
gi|48772106|ref|ZP_00276448.1| COG0288: Carbonic anhydrase [Rals... 87 1e-15
gi|39997405|ref|NP_953356.1| carbonic anhydrase [Geobacter sulfu... 86 1e-15
gi|45525442|ref|ZP_00176676.1| COG0288: Carbonic anhydrase [Croc... 86 2e-15
gi|29832200|ref|NP_826834.1| putative carbonic anhydrase [Strept... 85 4e-15
gi|15610409|ref|NP_217790.1| hypothetical protein Rv3273 [Mycoba... 85 4e-15
gi|15644638|ref|NP_206806.1| carbonic anhydrase (icfA) [Helicoba... 84 7e-15
gi|48847813|ref|ZP_00302062.1| COG0288: Carbonic anhydrase [Novo... 83 1e-14
gi|48731408|ref|ZP_00265153.1| COG0288: Carbonic anhydrase [Pseu... 83 1e-14
gi|46580187|ref|YP_010995.1| carbonic anhydrase [Desulfovibrio v... 79 2e-13
gi|29828752|ref|NP_823386.1| putative carbonic anhydrase [Strept... 78 4e-13
gi|30678347|ref|NP_850490.1| carbonic anhydrase 1, chloroplast /... 77 9e-13
gi|30678353|ref|NP_850491.1| carbonic anhydrase 1, chloroplast /... 77 9e-13
gi|45451864|gb|AAS65454.1| chloroplast carbonic anhydrase precur... 77 9e-13
gi|30678350|ref|NP_186799.2| carbonic anhydrase 1, chloroplast /... 77 9e-13
gi|48769555|ref|ZP_00273900.1| COG0288: Carbonic anhydrase [Rals... 76 2e-12
gi|45518361|ref|ZP_00169912.1| COG0288: Carbonic anhydrase [Rals... 75 3e-12
gi|13473511|ref|NP_105078.1| similar to carbonic anhydrase [Meso... 74 6e-12
gi|7489810|pir||T02080 probable carbonate dehydratase (EC 4.2.1.... 72 3e-11
gi|30685030|ref|NP_568303.2| carbonic anhydrase 2 / carbonate de... 71 5e-11
gi|34911604|ref|NP_917149.1| carbonic anhydrase [Oryza sativa (j... 71 5e-11
gi|7436816|pir||T03254 probable carbonate dehydratase (EC 4.2.1.... 71 5e-11
gi|42573371|ref|NP_974782.1| carbonic anhydrase 2 / carbonate de... 71 5e-11
gi|46322517|ref|ZP_00222886.1| COG0288: Carbonic anhydrase [Burk... 71 5e-11
gi|29653497|ref|NP_819189.1| carbonic anhydrase [Coxiella burnet... 71 6e-11
gi|21224385|ref|NP_630164.1| probable carbonic anhydrase [Strept... 71 6e-11
gi|39933309|ref|NP_945585.1| putative carbonic anhydrase [Rhodop... 71 6e-11
gi|22550386|gb|AAL51055.2| beta-carbonic anhydrase [Nicotiana ta... 70 8e-11
gi|7436815|pir||T02886 carbonate dehydratase (EC 4.2.1.1), chlor... 70 8e-11
gi|28625017|emb|CAD66064.1| carbonic anhydrase [Lotus corniculat... 70 8e-11
gi|47571703|ref|ZP_00241752.1| COG0288: Carbonic anhydrase [Rubr... 70 8e-11
gi|48855748|ref|ZP_00309906.1| COG0288: Carbonic anhydrase [Cyto... 70 8e-11
gi|3061271|dbj|BAA25639.1| NPCA1 [Nicotiana paniculata] 70 8e-11
gi|49476257|ref|YP_034298.1| Carbonic anhydrase protein [Bartone... 70 1e-10
gi|115473|sp|P27141|CAHC_TOBAC Carbonic anhydrase, chloroplast p... 70 1e-10
gi|438449|gb|AAA50156.1| carbonic anhydrase 70 1e-10
gi|7436820|pir||T09797 carbonate dehydratase (EC 4.2.1.1) 1b - P... 70 1e-10
gi|882246|gb|AAA69027.1| carbonic anhydrase 2 70 1e-10
gi|7489809|pir||T02079 probable carbonate dehydratase (EC 4.2.1.... 70 1e-10
gi|15220853|ref|NP_173785.1| carbonic anhydrase, putative / carb... 69 2e-10
gi|7436819|pir||T09793 carbonate dehydratase (EC 4.2.1.1) 1a - P... 69 2e-10
gi|46446692|ref|YP_008057.1| putative carbonate dehydratase, cyn... 69 2e-10
gi|45916910|ref|ZP_00197675.1| COG0288: Carbonic anhydrase [Meso... 69 3e-10
gi|1168738|sp|P46512|CAH1_FLALI Carbonic anhydrase 1 (Carbonate ... 68 4e-10
gi|23502682|ref|NP_698809.1| carbonic anhydrase, putative [Bruce... 68 4e-10
gi|17986506|ref|NP_539140.1| CARBONIC ANHYDRASE [Brucella melite... 68 4e-10
gi|4754913|gb|AAD29049.1| carbonic anhydrase isoform 1 [Gossypiu... 68 5e-10
gi|15889755|ref|NP_355436.1| AGR_C_4521p [Agrobacterium tumefaci... 67 7e-10
gi|4754915|gb|AAD29050.1| carbonic anhydrase isoform 2 [Gossypiu... 67 7e-10
gi|20502881|gb|AAM22683.1| carbonic anhydrase [Gossypium hirsutum] 67 7e-10
gi|42523716|ref|NP_969096.1| cah [Bdellovibrio bacteriovorus HD1... 67 9e-10
gi|882248|gb|AAA69028.1| carbonic anhydrase 1 67 1e-09
gi|1168746|sp|P46511|CAHX_FLABR Carbonic anhydrase (Carbonate de... 66 2e-09
gi|47606728|sp|P46510|CAHX_FLABI Carbonic anhydrase (Carbonate d... 66 2e-09
gi|1084443|pir||S48675 carbonate dehydratase (EC 4.2.1.1) precur... 66 2e-09
gi|39995178|ref|NP_951129.1| carbonic anhydrase [Geobacter sulfu... 66 2e-09
gi|1168747|sp|P46281|CAHX_FLAPR Carbonic anhydrase (Carbonate de... 66 2e-09
gi|729003|sp|P40880|CAHC_HORVU Carbonic anhydrase, chloroplast p... 65 5e-09
gi|33594307|ref|NP_881951.1| putative carbonic anhydrase [Bordet... 64 6e-09
gi|15967071|ref|NP_387424.1| PUTATIVE CARBONIC ANHYDRASE PROTEIN... 64 6e-09
gi|50725202|dbj|BAD33953.1| putative carbonic anhydrase [Oryza s... 64 8e-09
gi|27652184|gb|AAO17573.1| carbonic anhydrase 2 [Flaveria bidentis] 64 8e-09
gi|19113304|ref|NP_596512.1| carbonic anhydrase [Schizosaccharom... 64 1e-08
gi|115471|sp|P17067|CAHC_PEA Carbonic anhydrase, chloroplast pre... 63 1e-08
gi|8569250|pdb|1EKJ|A Chain A, The X-Ray Crystallographic Struct... 63 1e-08
gi|33595113|ref|NP_882756.1| putative carbonic anhydrase [Bordet... 63 1e-08
gi|32416722|ref|XP_328839.1| hypothetical protein [Neurospora cr... 63 1e-08
gi|30696223|ref|NP_176114.2| carbonic anhydrase family protein /... 63 2e-08
gi|48846355|ref|ZP_00300619.1| COG0288: Carbonic anhydrase [Geob... 63 2e-08
gi|8954289|gb|AAD27876.2| carbonic anhydrase [Vigna radiata] 62 2e-08
gi|1168740|sp|P46513|CAH2_FLALI Carbonic anhydrase 2 (Carbonate ... 62 3e-08
gi|169057|gb|AAA33652.1| carbonic anhydrase >gnl|BL_ORD_ID|13439... 62 3e-08
gi|48833898|ref|ZP_00290914.1| COG0288: Carbonic anhydrase [Magn... 62 4e-08
gi|24213279|ref|NP_710760.1| Carbonic anhydrase [Leptospira inte... 62 4e-08
gi|30698715|ref|NP_849872.1| carbonic anhydrase, putative / carb... 62 4e-08
gi|15223141|ref|NP_177198.1| carbonic anhydrase, putative / carb... 62 4e-08
gi|170102|gb|AAA34026.1| carbonic anhydrase precursor 61 5e-08
gi|227613|prf||1707317A carbonic anhydrase 61 7e-08
gi|115472|sp|P16016|CAHC_SPIOL Carbonic anhydrase, chloroplast p... 61 7e-08
gi|1395172|dbj|BAA12981.1| carbonic anhydrase [Porphyridium purp... 61 7e-08
gi|7245350|pdb|1DDZ|A Chain A, X-Ray Structure Of A Beta-Carboni... 60 9e-08
gi|1395170|dbj|BAA12980.1| carbonic anhydrase [Porphyridium purp... 60 9e-08
gi|46192995|ref|ZP_00005607.2| COG0288: Carbonic anhydrase [Rhod... 60 1e-07
gi|45508227|ref|ZP_00160567.1| COG0288: Carbonic anhydrase [Anab... 60 1e-07
gi|25404198|pir||B96615 probable carbonic anhydrase T18I24.9 [im... 60 1e-07
gi|32407071|ref|XP_324135.1| hypothetical protein [Neurospora cr... 59 2e-07
gi|4902525|emb|CAB43571.1| carbonic anhydrase [Glycine max] 59 2e-07
gi|38104258|gb|EAA50852.1| hypothetical protein MG04611.4 [Magna... 59 2e-07
gi|27375611|ref|NP_767140.1| carbonate dehydratase [Bradyrhizobi... 59 3e-07
gi|27652186|gb|AAO17574.1| carbonic anhydrase 3 [Flaveria bidentis] 59 3e-07
gi|12001986|gb|AAG43136.1| My022 protein [Homo sapiens] 58 6e-07
gi|50875826|emb|CAG35666.1| probable carbonic anhydrase [Desulfo... 57 7e-07
gi|15778654|gb|AAL07493.1| intracellular beta-type carbonic anhy... 57 9e-07
gi|23130016|ref|ZP_00111837.1| COG0288: Carbonic anhydrase [Nost... 57 9e-07
gi|50556600|ref|XP_505708.1| hypothetical protein [Yarrowia lipo... 57 9e-07
gi|7436818|pir||T09570 carbonate dehydratase (EC 4.2.1.1) - alfa... 57 1e-06
gi|18418245|ref|NP_567928.1| carbonic anhydrase family protein /... 57 1e-06
gi|32476768|ref|NP_869762.1| probable sulfate transporter [Pirel... 56 2e-06
gi|48849318|ref|ZP_00303561.1| COG0288: Carbonic anhydrase [Novo... 56 2e-06
gi|1663720|gb|AAC33484.1| beta-type carbonic anhydrase beta-CA1 ... 55 3e-06
gi|30696219|ref|NP_849823.1| carbonic anhydrase family protein /... 55 5e-06
gi|21539555|gb|AAM53330.1| putative carbonic anhydrase [Arabidop... 55 5e-06
gi|23466702|ref|ZP_00122289.1| COG0288: Carbonic anhydrase [Haem... 55 5e-06
gi|49096576|ref|XP_409748.1| hypothetical protein AN5611.2 [Aspe... 54 6e-06
gi|28899288|ref|NP_798893.1| putative carbonic anhydrase [Vibrio... 54 6e-06
gi|16273213|ref|NP_439452.1| carbonic anhydrase [Haemophilus inf... 54 1e-05
gi|15640607|ref|NP_230236.1| carbonic anhydrase, putative [Vibri... 54 1e-05
gi|32394562|gb|AAM93979.1| carbonic anhydrase [Griffithsia japon... 54 1e-05
gi|18314239|ref|NP_560906.1| carbonic anhydrase part 1, authenti... 53 1e-05
gi|46359649|dbj|BAD15329.1| carbonic anhydrase [Hydrogenovibrio ... 53 2e-05
gi|42629533|ref|ZP_00155079.1| COG0288: Carbonic anhydrase [Haem... 52 2e-05
gi|33866997|ref|NP_898556.1| carbonic anhydrase [Synechococcus s... 52 2e-05
gi|21231010|ref|NP_636927.1| carbonic anhydrase [Xanthomonas cam... 52 3e-05
gi|17548333|ref|NP_521673.1| PUTATIVE CARBONIC ANHYDRASE PROTEIN... 52 3e-05
gi|46117432|ref|XP_384734.1| hypothetical protein FG04558.1 [Gib... 52 3e-05
gi|37524862|ref|NP_928206.1| hypothetical protein [Photorhabdus ... 52 4e-05
gi|41406568|ref|NP_959404.1| hypothetical protein MAP0470 [Mycob... 51 7e-05
gi|21242354|ref|NP_641936.1| carbonic anhydrase [Xanthomonas axo... 50 9e-05
gi|40218045|gb|AAR82947.1| chloroplast beta carbonic anhydrase [... 50 9e-05
gi|38234543|ref|NP_940310.1| Putative carbonic anhydrase [Coryne... 50 9e-05
gi|15895747|ref|NP_349096.1| Carbonic anhydrase [Clostridium ace... 50 1e-04
gi|21242214|ref|NP_641796.1| carbonic anhydrase [Xanthomonas axo... 50 1e-04
gi|46914708|emb|CAG21485.1| putative Carbonic anhydrase [Photoba... 50 2e-04
gi|21230875|ref|NP_636792.1| carbonic anhydrase [Xanthomonas cam... 50 2e-04
gi|46311350|ref|ZP_00211958.1| COG0288: Carbonic anhydrase [Burk... 50 2e-04
gi|49067052|ref|XP_397816.1| hypothetical protein UM00201.1 [Ust... 49 2e-04
gi|33152436|ref|NP_873789.1| probable carbonic anhydrase [Haemop... 49 2e-04
gi|15602440|ref|NP_245512.1| unknown [Pasteurella multocida Pm70... 49 2e-04
gi|15610724|ref|NP_218105.1| hypothetical protein Rv3588c [Mycob... 49 2e-04
gi|22996066|ref|ZP_00040339.1| COG0288: Carbonic anhydrase [Xyle... 49 3e-04
gi|28199671|ref|NP_779985.1| carbonic anhydrase [Xylella fastidi... 49 3e-04
gi|48863509|ref|ZP_00317403.1| COG0288: Carbonic anhydrase [Micr... 49 3e-04
gi|45521603|ref|ZP_00173121.1| COG0288: Carbonic anhydrase [Meth... 49 3e-04
gi|48854751|ref|ZP_00308912.1| COG0288: Carbonic anhydrase [Cyto... 49 3e-04
gi|19553866|ref|NP_601868.1| carbonic anhydrase [Corynebacterium... 49 3e-04
gi|15029386|gb|AAK81867.1| putative carbonic anhydrase [Streptoc... 49 3e-04
gi|38100190|gb|EAA47356.1| hypothetical protein MG02599.4 [Magna... 49 3e-04
gi|48866613|ref|ZP_00320404.1| COG0288: Carbonic anhydrase [Haem... 49 3e-04
gi|24374018|ref|NP_718061.1| carbonic anhydrase family protein [... 49 3e-04
gi|46319555|ref|ZP_00219959.1| COG0288: Carbonic anhydrase [Burk... 48 4e-04
gi|28868548|ref|NP_791167.1| carbonic anhydrase [Pseudomonas syr... 48 4e-04
gi|22994211|ref|ZP_00038724.1| COG0288: Carbonic anhydrase [Xyle... 48 6e-04
gi|50258427|gb|EAL21116.1| hypothetical protein CNBD4920 [Crypto... 48 6e-04
gi|31794765|ref|NP_857258.1| CARBONIC ANHYDRASE (CARBONATE DEHYD... 48 6e-04
gi|48784240|ref|ZP_00280606.1| COG0288: Carbonic anhydrase [Burk... 48 6e-04
gi|23014103|ref|ZP_00053939.1| COG0288: Carbonic anhydrase [Magn... 47 8e-04
gi|22124692|ref|NP_668115.1| putative carbonic anhdrase [Yersini... 47 0.001
gi|45440138|ref|NP_991677.1| putative carbonic anhdrase [Yersini... 47 0.001
gi|37680952|ref|NP_935561.1| carbonic anhydrase [Vibrio vulnific... 47 0.001
gi|16123556|ref|NP_406869.1| putative carbonic anhydrase [Yersin... 47 0.001
gi|15799810|ref|NP_285822.1| putative carbonic anhdrase (EC 4.2.... 47 0.001
gi|23465200|ref|NP_695803.1| probable carbonic anhydrase [Bifido... 47 0.001
gi|46190352|ref|ZP_00121592.2| COG0288: Carbonic anhydrase [Bifi... 47 0.001
gi|17544996|ref|NP_518398.1| PROBABLE CARBONIC ANHYDRASE PROTEIN... 47 0.001
gi|27377176|ref|NP_768705.1| carbonic anhydrase [Bradyrhizobium ... 46 0.002
gi|32035844|ref|ZP_00135664.1| COG0288: Carbonic anhydrase [Acti... 46 0.002
gi|46141480|ref|ZP_00146742.2| COG0288: Carbonic anhydrase [Psyc... 46 0.002
gi|47574193|ref|ZP_00244229.1| COG0288: Carbonic anhydrase [Rubr... 46 0.002
gi|50084256|ref|YP_045766.1| putative carbonic anhydrase [Acinet... 46 0.002
gi|48764476|ref|ZP_00269028.1| COG0288: Carbonic anhydrase [Rhod... 46 0.002
gi|16127799|ref|NP_422363.1| carbonic anhydrase family protein [... 46 0.002
gi|27365000|ref|NP_760528.1| Carbonic anhydrase [Vibrio vulnific... 46 0.002
gi|27379976|ref|NP_771505.1| bll4865 [Bradyrhizobium japonicum U... 46 0.002
gi|15837482|ref|NP_298170.1| carbonic anhydrase [Xylella fastidi... 46 0.002
gi|16759167|ref|NP_454784.1| carbonic anhydrase [Salmonella ente... 46 0.002
gi|15599871|ref|NP_253365.1| probable carbonic anhydrase [Pseudo... 45 0.003
gi|49078550|gb|AAT49796.1| PA4676 [synthetic construct] 45 0.003
gi|48855957|ref|ZP_00310115.1| COG0288: Carbonic anhydrase [Cyto... 45 0.003
gi|22531311|emb|CAC80134.1| beta-carbonic anhydrase [Ralstonia e... 45 0.003
gi|39996542|ref|NP_952493.1| carbonic anhydrase family protein [... 45 0.004
gi|16763561|ref|NP_459176.1| putative carbonic anhydrase [Salmon... 45 0.004
gi|27379974|ref|NP_771503.1| bll4863 [Bradyrhizobium japonicum U... 45 0.004
gi|38110319|gb|EAA56056.1| hypothetical protein MG01707.4 [Magna... 45 0.005
gi|48846021|ref|ZP_00300289.1| COG0288: Carbonic anhydrase [Geob... 45 0.005
gi|46323657|ref|ZP_00224020.1| COG0288: Carbonic anhydrase [Burk... 45 0.005
gi|50256218|gb|EAL18945.1| hypothetical protein CNBI2060 [Crypto... 45 0.005
gi|50086360|ref|YP_047870.1| putative sulfate permease [Acinetob... 44 0.006
gi|48770499|ref|ZP_00274842.1| COG0288: Carbonic anhydrase [Rals... 44 0.006
gi|50259484|gb|EAL22157.1| hypothetical protein CNBC2950 [Crypto... 44 0.006
gi|46312313|ref|ZP_00212910.1| COG0288: Carbonic anhydrase [Burk... 44 0.006
gi|48785864|ref|ZP_00282073.1| COG0288: Carbonic anhydrase [Burk... 44 0.006
gi|26246066|ref|NP_752105.1| Protein yadF [Escherichia coli CFT0... 44 0.008
gi|16128119|ref|NP_414668.1| putative carbonic anhdrase (EC 4.2.... 44 0.008
gi|21492771|ref|NP_659846.1| probable carbonic anhydrase. [Rhizo... 44 0.008
gi|39995915|ref|NP_951866.1| carbonic anhydrase, putative [Geoba... 44 0.008
gi|15679577|ref|NP_276694.1| carbonic anhydrase [Methanothermoba... 44 0.008
gi|48846662|ref|ZP_00300922.1| COG0288: Carbonic anhydrase [Geob... 44 0.011
gi|23500522|ref|NP_699962.1| carbonic anhydrase [Brucella suis 1... 44 0.011
gi|37520514|ref|NP_923891.1| carbonate dehydratase [Gloeobacter ... 43 0.014
gi|45515915|ref|ZP_00167469.1| COG0288: Carbonic anhydrase [Rals... 43 0.014
gi|15828030|ref|NP_302293.1| putative carbonic anhydrase [Mycoba... 43 0.014
gi|39933876|ref|NP_946152.1| putative carbonic anhydrase [Rhodop... 43 0.014
gi|16331473|ref|NP_442201.1| carbonic anhydrase [Synechocystis s... 43 0.014
gi|30249878|ref|NP_841948.1| Prokaryotic-type carbonic anhydrase... 43 0.014
gi|23098552|ref|NP_692018.1| carbonic anhydrase [Oceanobacillus ... 43 0.018
gi|14277936|pdb|1I6O|A Chain A, Crystal Structure Of E. Coli Bet... 42 0.024
gi|25029083|ref|NP_739137.1| conserved hypothetical protein [Cor... 42 0.024
gi|21238981|dbj|BAB96702.1| Cyanate permease homolog. [Escherich... 42 0.024
gi|49088178|ref|XP_405942.1| hypothetical protein AN1805.2 [Aspe... 42 0.024
gi|1272331|gb|AAC44811.1| orf3; similar to carbonic anhydrase fr... 42 0.032
gi|50306805|ref|XP_453378.1| unnamed protein product [Kluyveromy... 42 0.032
gi|48730071|ref|ZP_00263819.1| COG0288: Carbonic anhydrase [Pseu... 42 0.032
gi|1279772|gb|AAC44822.1| orf3; similar to the carbonic anhydras... 42 0.032
gi|23125571|ref|ZP_00107498.1| COG0288: Carbonic anhydrase [Nost... 42 0.032
gi|50875739|emb|CAG35579.1| probable carbonic anhydrase [Desulfo... 42 0.041
gi|21222134|ref|NP_627913.1| putative carbonic anhydrase [Strept... 42 0.041
gi|1513236|gb|AAB06760.1| carbonic anhydrase 41 0.070
gi|33600463|ref|NP_888023.1| Putative carbonic anhydrase precurs... 41 0.070
gi|33596697|ref|NP_884340.1| Putative carbonic anhydrase precurs... 41 0.070
gi|37521657|ref|NP_925034.1| periplasmic beta-type carbonic anhy... 41 0.070
gi|50122249|ref|YP_051416.1| putative carbonic anhydrase [Erwini... 41 0.070
gi|17230402|ref|NP_486950.1| carbonate dehydratase [Nostoc sp. P... 40 0.092
gi|45505459|ref|ZP_00157840.1| COG0288: Carbonic anhydrase [Anab... 40 0.092
gi|45505460|ref|ZP_00157841.1| COG0288: Carbonic anhydrase [Anab... 40 0.092
gi|46188217|ref|ZP_00125387.2| COG0288: Carbonic anhydrase [Pseu... 40 0.12
gi|46443601|gb|EAL02882.1| hypothetical protein CaO19.9289 [Cand... 40 0.12
gi|13786684|pdb|1G5C|A Chain A, Crystal Structure Of The 'cab' T... 40 0.16
gi|32042150|ref|ZP_00139733.1| COG0288: Carbonic anhydrase [Pseu... 40 0.16
gi|16127802|ref|NP_422366.1| carbonic anhydrase [Caulobacter cre... 39 0.20
gi|46366969|ref|ZP_00199473.2| COG0288: Carbonic anhydrase [Kine... 39 0.20
gi|23129848|ref|ZP_00111671.1| COG0288: Carbonic anhydrase [Nost... 39 0.20
gi|28829996|gb|AAO52486.1| similar to Dictyostelium discoideum (... 39 0.20
gi|28868214|ref|NP_790833.1| carbonic anhydrase [Pseudomonas syr... 39 0.27
gi|25010185|ref|NP_734580.1| Unknown [Streptococcus agalactiae N... 39 0.27
gi|49103716|ref|XP_411179.1| hypothetical protein AN7042.2 [Aspe... 39 0.35
gi|22536296|ref|NP_687147.1| carbonic anhydrase-related protein ... 39 0.35
gi|16121130|ref|NP_404443.1| putative carbonic anhydrase [Yersin... 38 0.46
gi|15674422|ref|NP_268596.1| conserved hypothetical protein [Str... 38 0.46
gi|15899971|ref|NP_344575.1| conserved hypothetical protein [Str... 38 0.46
gi|19745373|ref|NP_606509.1| conserved hypothetical protein [Str... 38 0.46
gi|21909704|ref|NP_663972.1| conserved hypothetical protein [Str... 38 0.46
gi|15807230|ref|NP_295960.1| carbonic anhydrase [Deinococcus rad... 38 0.46
gi|1737488|gb|AAC49888.1| beta-carbonic anhydrase [Chlamydomonas... 38 0.46
gi|7484356|pir||T08204 carbonate dehydratase (EC 4.2.1.1) precur... 38 0.46
gi|1323551|gb|AAB19184.1| carbonic anhydrase precursor 38 0.46
gi|1323549|gb|AAB19183.1| carbonic anhydrase precursor 38 0.46
gi|50409399|ref|XP_456870.1| unnamed protein product [Debaryomyc... 38 0.59
gi|46114256|ref|XP_383146.1| hypothetical protein FG02970.1 [Gib... 38 0.59
gi|26988802|ref|NP_744227.1| diaminopimelate decarboxylase [Pseu... 38 0.59
gi|48374226|gb|AAT41924.1| putative carbonic anhydrase [Fremyell... 38 0.59
gi|50427865|ref|XP_462545.1| unnamed protein product [Debaryomyc... 38 0.59
gi|17988847|ref|NP_541480.1| CARBONIC ANHYDRASE [Brucella melite... 38 0.59
gi|50590093|ref|ZP_00331521.1| COG0288: Carbonic anhydrase [Stre... 38 0.59
gi|32412232|ref|XP_326596.1| predicted protein [Neurospora crass... 37 0.78
gi|48834975|ref|ZP_00291978.1| COG0288: Carbonic anhydrase [Ther... 37 0.78
gi|48786371|ref|ZP_00282505.1| COG0288: Carbonic anhydrase [Burk... 37 0.78
gi|38110990|gb|EAA56629.1| hypothetical protein MG06600.4 [Magna... 37 1.0
gi|47060327|ref|NP_665783.2| pANL45 [Synechococcus elongatus PCC... 37 1.0
gi|23473823|ref|ZP_00129118.1| COG0288: Carbonic anhydrase [Desu... 37 1.0
gi|45511629|ref|ZP_00163197.1| COG0288: Carbonic anhydrase [Syne... 37 1.0
gi|12084975|ref|NP_073268.1| Mig5 [Salmonella enterica subsp. en... 37 1.3
gi|2460260|gb|AAB80735.1| putative carbonic anhydrase Mig-5 [Sal... 37 1.3
gi|32411923|ref|XP_326442.1| predicted protein [Neurospora crass... 36 1.7
gi|15902070|ref|NP_357620.1| Conserved hypothetical protein [Str... 36 1.7
gi|46121779|ref|XP_385443.1| hypothetical protein FG05267.1 [Gib... 36 1.7
gi|23126746|ref|ZP_00108634.1| COG0288: Carbonic anhydrase [Nost... 36 1.7
gi|46364764|ref|ZP_00227344.1| COG0288: Carbonic anhydrase [Kine... 36 1.7
gi|41408585|ref|NP_961421.1| hypothetical protein MAP2487c [Myco... 36 2.3
gi|38109578|gb|EAA55427.1| hypothetical protein MG09234.4 [Magna... 36 2.3
gi|45358862|ref|NP_988419.1| carbonic anhydrase [Methanococcus m... 35 2.9
gi|37526161|ref|NP_929505.1| hypothetical protein [Photorhabdus ... 35 2.9
gi|24378826|ref|NP_720781.1| putative carbonic anhydrase [Strept... 35 3.9
gi|46437406|gb|EAK96753.1| hypothetical protein CaO19.2836 [Cand... 35 3.9
gi|32488438|emb|CAE03280.1| OSJNBa0072K14.13 [Oryza sativa (japo... 35 3.9
gi|39934900|ref|NP_947176.1| conserved hypothetical protein [Rho... 35 3.9
gi|50310487|ref|XP_455263.1| unnamed protein product [Kluyveromy... 35 5.0
gi|4028948|gb|AAC97147.1| Nra [Streptococcus pyogenes] 31 5.7
gi|21909633|ref|NP_663901.1| negative transcriptional regulator ... 31 5.7
gi|42523230|ref|NP_968610.1| putative carbonic anhydrase [Bdello... 34 6.6
gi|48113517|ref|XP_396355.1| similar to MGC52879 protein [Apis m... 34 6.6
gi|20089546|ref|NP_615621.1| Na+-transporting NADH:ubiquinone ox... 34 8.6
>gi|25147567|ref|NP_741808.1| beta Carbonic Anhydrase (bca-1)
[Caenorhabditis elegans]
gi|20198884|gb|AAM15604.1| Beta carbonic anhydrase protein 1, isoform
b [Caenorhabditis elegans]
Length = 429
Score = 811 bits (2095), Expect = 0.0
Identities = 407/429 (94%), Positives = 407/429 (94%)
Frame = -1
Query: 1290 MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLXXXXXXXXXXXVAFGYVAADSIDKGL 1111
MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSL VAFGYVAADSIDKGL
Sbjct: 1 MTPVEEIIKKDIFRETPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAADSIDKGL 60
Query: 1110 QEYIXXXXXXXXXXXKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN 931
QEYI KVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN
Sbjct: 61 QEYIKTHSTSTEKTKKVAIAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTKLPTN 120
Query: 930 MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK 751
MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK
Sbjct: 121 MRKWTVTCLGLATIPFIVHPIDSFVEEAMDKTARKIYNKMNKILRGVIQFRNTIRKDLVK 180
Query: 750 QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV 571
QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV
Sbjct: 181 QFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSV 240
Query: 570 NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS 391
NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS
Sbjct: 241 NTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGLHQCPKNFDVTSPMDHWVRRNGFAS 300
Query: 390 VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF 211
VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF
Sbjct: 301 VKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEF 360
Query: 210 LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD 31
LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD
Sbjct: 361 LKEYLESGRLHIHGMWFDIYKGEDYLFSKDKKRFVVIDEKTVTDLLAELNARYPVPEDQD 420
Query: 30 GPVAFAKSN 4
GPVAFAKSN
Sbjct: 421 GPVAFAKSN 429