Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T14B4_1
(1008 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 250 3e-65
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 250 3e-65
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 250 3e-65
gi|29570382|gb|AAO38600.2| Dumpy : shorter than wild-type protei... 240 4e-62
gi|32565703|ref|NP_872048.1| dumpy shorter than wild-type protei... 240 4e-62
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 238 2e-61
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 92 2e-17
gi|39590293|emb|CAE66031.1| Hypothetical protein CBG11226 [Caeno... 81 3e-14
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 81 3e-14
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 80 1e-13
gi|687634|gb|AAA62504.1| collagen 76 1e-12
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 73 9e-12
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 73 9e-12
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 72 2e-11
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 72 2e-11
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 67 6e-10
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 66 1e-09
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 64 5e-09
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 64 5e-09
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 62 2e-08
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 62 2e-08
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 62 3e-08
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 61 5e-08
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 61 5e-08
gi|1513204|gb|AAC48703.1| involucrin 60 8e-08
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 60 8e-08
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 59 1e-07
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 59 2e-07
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 58 4e-07
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 58 4e-07
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 57 5e-07
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 57 7e-07
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 57 9e-07
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 56 1e-06
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 56 1e-06
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 56 1e-06
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 54 2e-06
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 55 2e-06
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 55 3e-06
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 55 3e-06
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 54 6e-06
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 54 6e-06
gi|1705738|sp|P51861|CDR1_HUMAN Cerebellar-degeneration-related ... 54 6e-06
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 54 6e-06
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 54 7e-06
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 54 7e-06
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 54 7e-06
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 53 1e-05
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 53 1e-05
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 53 1e-05
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 53 1e-05
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 53 1e-05
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 53 1e-05
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 53 1e-05
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 53 1e-05
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 52 2e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 52 2e-05
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 52 2e-05
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 52 2e-05
gi|1184072|gb|AAC47437.1| COL-1 52 2e-05
gi|23479053|gb|EAA15986.1| mature-parasite-infected erythrocyte ... 52 2e-05
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 52 2e-05
gi|1513206|gb|AAC48704.1| involucrin 52 2e-05
gi|50344874|ref|NP_001002109.1| zgc:85944 [Danio rerio] >gnl|BL_... 52 2e-05
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 52 2e-05
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 52 3e-05
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 52 3e-05
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 52 3e-05
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 51 4e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 51 4e-05
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 51 5e-05
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 51 5e-05
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 51 5e-05
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 50 6e-05
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 50 6e-05
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 50 6e-05
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 50 6e-05
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 50 6e-05
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 50 6e-05
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 50 8e-05
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 50 8e-05
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 50 8e-05
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 50 8e-05
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 50 8e-05
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 50 8e-05
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 50 1e-04
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 50 1e-04
gi|23479961|gb|EAA16652.1| SPRY domain, putative [Plasmodium yoe... 50 1e-04
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 50 1e-04
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 49 1e-04
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 49 1e-04
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 49 1e-04
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 49 1e-04
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 49 1e-04
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 49 1e-04
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 49 1e-04
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 49 2e-04
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 49 2e-04
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 49 2e-04
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 49 2e-04
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 49 2e-04
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 49 2e-04
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 49 2e-04
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 49 2e-04
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 49 2e-04
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 49 2e-04
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 48 3e-04
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 48 3e-04
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 48 3e-04
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 48 3e-04
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 48 4e-04
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 48 4e-04
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 48 4e-04
gi|13539605|emb|CAC35733.1| cyclophilin-RNA interacting protein ... 48 4e-04
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 48 4e-04
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can... 47 5e-04
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand... 47 5e-04
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 47 5e-04
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 47 7e-04
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 47 7e-04
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 47 7e-04
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 47 7e-04
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 47 7e-04
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 47 7e-04
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 47 7e-04
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 47 7e-04
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 47 7e-04
gi|42559523|sp|Q9BMM8|MYSP_SARSC Paramyosin >gnl|BL_ORD_ID|66920... 47 7e-04
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 47 0.001
gi|25518567|pir||E86336 hypothetical protein F14O10.11 - Arabido... 47 0.001
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 47 0.001
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 47 0.001
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 47 0.001
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 47 0.001
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 47 0.001
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative... 46 0.001
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 46 0.001
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 46 0.001
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 46 0.001
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 46 0.002
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 46 0.002
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 46 0.002
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 46 0.002
gi|34393510|dbj|BAC83071.1| unknown protein [Oryza sativa (japon... 45 0.002
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 45 0.002
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 45 0.002
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ... 45 0.002
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 45 0.002
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 45 0.002
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 45 0.002
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 45 0.002
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 45 0.002
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens] 45 0.002
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 45 0.002
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 45 0.002
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 45 0.002
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 45 0.002
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 45 0.002
gi|31198741|ref|XP_308318.1| ENSANGP00000010717 [Anopheles gambi... 45 0.003
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 45 0.003
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 45 0.003
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 45 0.003
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 45 0.003
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 45 0.003
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 45 0.003
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 45 0.003
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 45 0.003
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 45 0.003
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 45 0.003
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 45 0.003
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 45 0.003
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 45 0.003
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 45 0.003
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 45 0.003
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 45 0.003
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 44 0.004
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ... 44 0.004
gi|5326838|gb|AAD42061.1| histidine-rich calcium-binding protein... 44 0.004
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 44 0.004
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 44 0.004
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 44 0.004
gi|27461725|gb|AAN05017.1| pinin [Mus musculus] 44 0.004
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 44 0.006
gi|39938533|ref|NP_950299.1| conserved hypothetical protein [Oni... 44 0.006
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 44 0.006
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 44 0.006
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 44 0.006
gi|23487174|gb|EAA20984.1| MIF4G domain, putative [Plasmodium yo... 44 0.006
gi|2425111|gb|AAB70839.1| ZipA [Dictyostelium discoideum] 44 0.006
gi|23483000|gb|EAA18812.1| probable ATP-dependent RNA helicase h... 44 0.006
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 44 0.006
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 44 0.006
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 44 0.008
gi|6754242|ref|NP_034603.1| histidine rich calcium binding prote... 44 0.008
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 44 0.008
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 44 0.008
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 44 0.008
gi|18203740|gb|AAH21623.1| Hrc protein [Mus musculus] 44 0.008
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 44 0.008
gi|46309585|ref|NP_908998.1| retrotransposon-like 1 [Mus musculu... 44 0.008
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 44 0.008
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 44 0.008
gi|11345232|gb|AAG34654.1| involucrin [Mus musculus] 43 0.010
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 43 0.010
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 43 0.010
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 43 0.010
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 43 0.010
gi|549041|sp|Q01550|TANA_XENLA Tanabin >gnl|BL_ORD_ID|1599351 gi... 43 0.010
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 43 0.010
gi|23613218|ref|NP_703540.1| hypothetical protein [Plasmodium fa... 43 0.010
gi|11385652|gb|AAG34907.1| CTCL tumor antigen se20-7 [Homo sapiens] 43 0.013
gi|47216472|emb|CAG02123.1| unnamed protein product [Tetraodon n... 43 0.013
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ... 43 0.013
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 43 0.013
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 43 0.013
gi|47122934|gb|AAH70599.1| Unknown (protein for MGC:81235) [Xeno... 43 0.013
gi|23479255|gb|EAA16133.1| hypothetical protein [Plasmodium yoel... 43 0.013
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 43 0.013
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens] 43 0.013
gi|50424259|ref|XP_460716.1| unnamed protein product [Debaryomyc... 43 0.013
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 43 0.013
gi|15789646|ref|NP_279470.1| Vng0394c [Halobacterium sp. NRC-1] ... 43 0.013
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 43 0.013
gi|28829296|gb|AAO51838.1| similar to hypothetical protein [Schi... 43 0.013
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 42 0.017
gi|17550148|ref|NP_509861.1| putative protein (XL762) [Caenorhab... 42 0.017
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 42 0.017
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 42 0.017
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 42 0.017
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 42 0.017
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 42 0.017
gi|50733070|ref|XP_426013.1| PREDICTED: similar to FYVE and coil... 42 0.017
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 42 0.017
gi|23482054|gb|EAA18150.1| mature-parasite-infected erythrocyte ... 42 0.017
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip... 42 0.017
gi|23957763|ref|NP_473250.2| hypothetical protein [Plasmodium fa... 42 0.022
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 42 0.022
gi|45433533|ref|NP_956114.2| Unknown (protein for MGC:66194); wu... 42 0.022
gi|7494237|pir||T18450 hypothetical protein C0570c - malaria par... 42 0.022
gi|42660674|ref|XP_377369.1| similar to hypothetical protein FLJ... 42 0.022
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 42 0.022
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 42 0.022
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus] 42 0.022
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 42 0.029
gi|26326913|dbj|BAC27200.1| unnamed protein product [Mus musculus] 42 0.029
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 42 0.029
gi|31241663|ref|XP_321262.1| ENSANGP00000024231 [Anopheles gambi... 42 0.029
gi|1684847|gb|AAB48304.1| pinin [Homo sapiens] 42 0.029
gi|37589184|gb|AAH59196.1| Unknown (protein for MGC:66194) [Dani... 42 0.029
gi|23509702|ref|NP_702369.1| hypothetical protein [Plasmodium fa... 42 0.029
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 42 0.029
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 42 0.029
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 42 0.029
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 42 0.029
gi|38083204|ref|XP_355737.1| similar to splicing factor YT521-B ... 42 0.029
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis] 42 0.029
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 42 0.029
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ... 42 0.029
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 42 0.029
gi|47180733|emb|CAG14181.1| unnamed protein product [Tetraodon n... 42 0.029
gi|31241661|ref|XP_321261.1| ENSANGP00000023656 [Anopheles gambi... 42 0.029
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 42 0.029
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 41 0.038
gi|23481567|gb|EAA17806.1| hypothetical protein [Plasmodium yoel... 41 0.038
gi|23619599|ref|NP_705561.1| hypothetical protein [Plasmodium fa... 41 0.038
gi|31207321|ref|XP_312627.1| ENSANGP00000015381 [Anopheles gambi... 41 0.038
gi|32141042|gb|AAP70486.1| histidine-rich calcium binding protei... 41 0.038
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 41 0.038
gi|42660685|ref|XP_375272.1| similar to hypothetical protein FLJ... 41 0.038
gi|3617817|emb|CAA12197.1| SRF related protein [Dictyostelium di... 41 0.038
gi|2144789|pir||I37061 involucrin M - gorilla >gnl|BL_ORD_ID|838... 41 0.038
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 41 0.038
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 41 0.038
gi|50745756|ref|XP_420230.1| PREDICTED: similar to Mtap7 protein... 41 0.038
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 41 0.038
gi|19481961|gb|AAL89237.1| WSSV369 [shrimp white spot syndrome v... 41 0.050
gi|14589860|ref|NP_115855.1| aspartate beta-hydroxylase isoform ... 41 0.050
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 41 0.050
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 41 0.050
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 41 0.050
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 41 0.050
gi|14589864|ref|NP_115857.1| aspartate beta-hydroxylase isoform ... 41 0.050
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 41 0.050
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 41 0.050
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 41 0.050
gi|23486915|gb|EAA20924.1| casein kinase ii beta chain [Plasmodi... 41 0.050
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 41 0.050
gi|39596710|emb|CAE63329.1| Hypothetical protein CBG07728 [Caeno... 41 0.050
gi|41054033|ref|NP_956189.1| Unknown (protein for MGC:63502); wu... 41 0.050
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 41 0.050
gi|14589866|ref|NP_004309.2| aspartate beta-hydroxylase isoform ... 41 0.050
gi|1911652|gb|AAB50779.1| aspartyl(asparaginyl)beta-hydroxylase;... 41 0.050
gi|17569623|ref|NP_509801.1| esophageal gland cell secretory pro... 41 0.050
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 41 0.050
gi|17158415|ref|NP_477835.1| wsv313 [shrimp white spot syndrome ... 41 0.050
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 41 0.050
gi|2498165|sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydrox... 41 0.050
gi|13540523|ref|NP_110390.1| nucleosomal binding protein 1 [Homo... 41 0.050
gi|15021546|gb|AAK77823.1| ORF154 [shrimp white spot syndrome vi... 41 0.050
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 41 0.050
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 40 0.065
gi|6322676|ref|NP_012749.1| Essential protein required for the m... 40 0.065
gi|47217784|emb|CAG06006.1| unnamed protein product [Tetraodon n... 40 0.065
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g... 40 0.065
gi|19112832|ref|NP_596040.1| hypothetical protein [Schizosacchar... 40 0.065
gi|32421487|ref|XP_331187.1| hypothetical protein [Neurospora cr... 40 0.065
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy... 40 0.065
gi|23486300|gb|EAA20765.1| hypothetical protein [Plasmodium yoel... 40 0.065
gi|124730|sp|P24710|INVO_GALCR Involucrin >gnl|BL_ORD_ID|1873056... 40 0.065
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 40 0.065
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 40 0.065
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 40 0.065
gi|6688177|emb|CAB65108.1| DIPB protein [Homo sapiens] 40 0.065
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 40 0.065
gi|28829071|gb|AAO51637.1| similar to Dictyostelium discoideum (... 40 0.065
gi|23509816|ref|NP_702483.1| hypothetical protein [Plasmodium fa... 40 0.065
gi|46437473|gb|EAK96819.1| hypothetical protein CaO19.10369 [Can... 40 0.065
gi|10140993|ref|NP_065570.1| putative immediate early protein [A... 40 0.065
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 40 0.065
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533... 40 0.065
gi|15902649|ref|NP_358199.1| Cell division protein DivIB [Strept... 40 0.085
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 40 0.085
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 40 0.085
gi|34879107|ref|XP_225008.2| similar to Runt-related transcripti... 40 0.085
gi|17553116|ref|NP_498427.1| putative protein, with 3 coiled coi... 40 0.085
gi|42733801|gb|AAS38719.1| similar to Dictyostelium discoideum (... 40 0.085
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 40 0.085
gi|24660458|ref|NP_729301.1| CG17888-PD [Drosophila melanogaster... 40 0.085
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 40 0.085
gi|27462846|gb|AAO15612.1| paramyosin [Sarcoptes scabiei type ho... 40 0.085
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno... 40 0.085
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 40 0.085
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 40 0.085
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 40 0.085
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 40 0.085
gi|23619248|ref|NP_705210.1| hypothetical protein, conserved [Pl... 40 0.085
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ... 40 0.085
gi|28870283|ref|NP_792902.1| cointegrate resolution protein T [P... 40 0.085
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 40 0.085
gi|23613123|ref|NP_703445.1| hypothetical protein [Plasmodium fa... 40 0.11
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150... 40 0.11
gi|50422753|ref|XP_459953.1| unnamed protein product [Debaryomyc... 40 0.11
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 40 0.11
gi|4009482|gb|AAC95451.1| cell division protein DivIB [Streptoco... 40 0.11
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 40 0.11
gi|17555622|ref|NP_498151.1| g-protein beta WD-40 repeat (3G476)... 40 0.11
gi|25410974|pir||B84434 hypothetical protein At2g02200 [imported... 40 0.11
gi|10048257|gb|AAG12326.1| glutamate-rich protein [Plasmodium fa... 40 0.11
gi|8650501|gb|AAF78238.1| rabaptin-5delta [Mus musculus] 40 0.11
gi|23619502|ref|NP_705464.1| hypothetical protein [Plasmodium fa... 40 0.11
gi|45190902|ref|NP_985156.1| AER299Cp [Eremothecium gossypii] >g... 40 0.11
gi|23508822|ref|NP_701490.1| eukaryotic translation initiation f... 40 0.11
gi|7494300|pir||G71611 hypothetical protein PFB0560w - malaria p... 39 0.14
gi|39586363|emb|CAE74020.1| Hypothetical protein CBG21668 [Caeno... 39 0.14
gi|23612500|ref|NP_704061.1| erythrocyte membrane protein 1 (PfE... 39 0.14
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 39 0.14
gi|25742663|ref|NP_446340.1| myelin transcription factor 1-like;... 39 0.14
gi|41393115|ref|NP_958887.1| nucleobindin 2b [Danio rerio] >gnl|... 39 0.14
gi|23593303|ref|NP_473041.2| hypothetical protein [Plasmodium fa... 39 0.14
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 39 0.14
gi|45501169|gb|AAH67334.1| Nucb2b protein [Danio rerio] 39 0.14
gi|40787733|gb|AAH64825.1| Ipo7 protein [Mus musculus] 39 0.14
gi|6225217|sp|O14578|CTRO_HUMAN Citron protein (Rho-interacting,... 39 0.14
gi|32698688|ref|NP_009105.1| citron; rho-interacting, serine/thr... 39 0.14
gi|26325886|dbj|BAC26697.1| unnamed protein product [Mus musculus] 39 0.14
gi|15900591|ref|NP_345195.1| cell division protein DivIB [Strept... 39 0.14
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 39 0.14
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485... 39 0.14
gi|15131992|emb|CAC49971.1| dJ276E15.1 (DIPB protein) [Homo sapi... 39 0.14
gi|50310441|ref|XP_455240.1| unnamed protein product [Kluyveromy... 39 0.14
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa... 39 0.14
gi|32306846|gb|AAP76200.1| lectin associated matrix protein [Cot... 39 0.14
gi|45476977|sp|Q9EPL8|IPO7_MOUSE Importin 7 (Imp7) (Ran-binding ... 39 0.14
gi|21361639|ref|NP_060053.2| DIPB protein [Homo sapiens] >gnl|BL... 39 0.14
gi|13929120|ref|NP_113978.1| postsynaptic density protein (citro... 39 0.14
gi|39592595|emb|CAE63672.1| Hypothetical protein CBG08174 [Caeno... 39 0.14
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 39 0.14
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 39 0.14
gi|38424010|dbj|BAD01767.1| RNA helicase-like [Oryza sativa (jap... 39 0.14
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 39 0.14
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 39 0.14
gi|39581569|emb|CAE58354.1| Hypothetical protein CBG01475 [Caeno... 39 0.14
gi|39579193|emb|CAE57000.1| Hypothetical protein CBG24867 [Caeno... 39 0.14
gi|31581595|ref|NP_852658.1| importin 7; RAN binding protein 7 [... 39 0.14
gi|31657148|gb|AAH53524.1| Ipo7 protein [Mus musculus] 39 0.14
gi|6679407|ref|NP_032917.1| pinin [Mus musculus] >gnl|BL_ORD_ID|... 39 0.14
gi|13569852|ref|NP_076368.1| retinitis pigmentosa GTPase regulat... 39 0.14
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 39 0.14
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 39 0.14
gi|39586045|emb|CAE69121.1| Hypothetical protein CBG15147 [Caeno... 39 0.19
gi|17542492|ref|NP_500613.1| putative membrane protein, with a c... 39 0.19
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 39 0.19
gi|34861086|ref|XP_342606.1| similar to neural zinc finger prote... 39 0.19
gi|2116688|dbj|BAA11178.1| deltaEF1 [Gallus gallus] 39 0.19
gi|45384096|ref|NP_990462.1| deltaEF1 [Gallus gallus] >gnl|BL_OR... 39 0.19
gi|39591680|emb|CAE71258.1| Hypothetical protein CBG18138 [Caeno... 39 0.19
gi|29570388|gb|AAO91670.1| Hypothetical protein T22B11.4b [Caeno... 39 0.19
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 39 0.19
gi|11544639|emb|CAC17609.1| importin7 [Homo sapiens] 39 0.19
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 39 0.19
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 39 0.19
gi|50747758|ref|XP_420979.1| PREDICTED: similar to Importin 7 (I... 39 0.19
gi|11359893|pir||T46501 hypothetical protein DKFZp434A179.1 - hu... 39 0.19
gi|47213005|emb|CAF95397.1| unnamed protein product [Tetraodon n... 39 0.19
gi|5453998|ref|NP_006382.1| importin 7; RAN-binding protein 7; R... 39 0.19
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 39 0.19
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 39 0.19
gi|3360514|gb|AAC27933.1| Citron-K kinase [Mus musculus] 39 0.19
gi|24664506|ref|NP_648752.1| CG12316-PA [Drosophila melanogaster... 39 0.19
gi|48106581|ref|XP_396127.1| similar to ENSANGP00000013112 [Apis... 39 0.19
gi|23488075|gb|EAA21219.1| glutamic acid-rich protein precursor ... 39 0.19
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 39 0.19
gi|2696101|dbj|BAA23818.1| neurocrescin [Mus musculus] 39 0.25
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 39 0.25
gi|11024712|ref|NP_060003.1| myosin, heavy polypeptide 4, skelet... 39 0.25
gi|1083257|pir||S52391 centrosomin B - mouse >gnl|BL_ORD_ID|1046... 39 0.25
gi|39586913|emb|CAE62848.1| Hypothetical protein CBG07027 [Caeno... 39 0.25
gi|23488856|gb|EAA21422.1| immediate early protein homolog-relat... 39 0.25
gi|24655781|ref|NP_647680.1| CG5690-PA [Drosophila melanogaster]... 39 0.25
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 39 0.25
gi|7508682|pir||T15138 hypothetical protein T28F2.4 - Caenorhabd... 39 0.25
gi|15292547|gb|AAK93542.1| SD06673p [Drosophila melanogaster] 39 0.25
gi|9507021|ref|NP_062273.1| rabaptin, RAB GTPase binding effecto... 39 0.25
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 39 0.25
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 39 0.25
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 39 0.25
gi|12005629|gb|AAG44544.1| rabaptin-5gamma [Mus musculus] 39 0.25
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 39 0.25
gi|50794060|ref|XP_423656.1| PREDICTED: transitin [Gallus gallus] 39 0.25
gi|17543780|ref|NP_502799.1| putative nuclear protein, with 2 co... 39 0.25
gi|50750157|ref|XP_421895.1| PREDICTED: similar to Disco-interac... 39 0.25
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 39 0.25
gi|45554124|ref|NP_996345.1| CG32776-PB [Drosophila melanogaster... 39 0.25
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re... 39 0.25
gi|47227297|emb|CAF96846.1| unnamed protein product [Tetraodon n... 39 0.25
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 39 0.25
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 39 0.25
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 39 0.25
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 39 0.25
gi|50308411|ref|XP_454207.1| unnamed protein product [Kluyveromy... 39 0.25
gi|482391|pir||A45555 glutamate rich protein - malaria parasite ... 39 0.25
gi|28375561|emb|CAD66604.1| SMC protein [Synechococcus sp. PCC 7... 39 0.25
gi|41117725|ref|XP_372917.1| similar to Cerebellar-degeneration-... 38 0.32
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 38 0.32
gi|3021392|emb|CAA71377.1| nuclear protein SDK3 [Homo sapiens] 38 0.32
gi|50293455|ref|XP_449139.1| unnamed protein product [Candida gl... 38 0.32
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa... 38 0.32
gi|13345189|gb|AAK19245.1| reticulocyte binding protein 2 homolo... 38 0.32
gi|23486696|gb|EAA20872.1| hypothetical protein [Plasmodium yoel... 38 0.32
gi|30679235|ref|NP_172024.2| myosin-related [Arabidopsis thaliana] 38 0.32
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 38 0.32
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens] 38 0.32
gi|33413778|gb|AAN39448.1| normocyte binding protein 2b [Plasmod... 38 0.32
gi|4503509|ref|NP_003741.1| eukaryotic translation initiation fa... 38 0.32
gi|23612443|ref|NP_704004.1| hypothetical protein [Plasmodium fa... 38 0.32
gi|50753688|ref|XP_414090.1| PREDICTED: similar to Hypothetical ... 38 0.32
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa... 38 0.32
gi|40786396|ref|NP_955370.1| FLJ35171 protein [Homo sapiens] >gn... 38 0.32
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 38 0.32
gi|40788877|dbj|BAA09488.2| KIAA0139 [Homo sapiens] 38 0.32
gi|4581463|emb|CAA70874.1| MEMA [Homo sapiens] 38 0.32
gi|23619292|ref|NP_705254.1| Plasmodium falciparum reticulocyte ... 38 0.32
gi|34858944|ref|XP_219265.2| similar to importin 7 [Rattus norve... 38 0.32
gi|23619017|ref|NP_704979.1| hypothetical protein [Plasmodium fa... 38 0.32
gi|17558914|ref|NP_506120.1| predicted CDS, filamentous hemagglu... 38 0.32
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom... 38 0.32
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 38 0.32
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 38 0.32
gi|6563230|gb|AAF17209.1| nuclear protein SDK3 [Homo sapiens] 38 0.32
gi|15223313|ref|NP_174560.1| hypothetical protein [Arabidopsis t... 38 0.32
gi|33356174|ref|NP_002678.2| pinin, desmosome associated protein... 38 0.32
gi|15779123|gb|AAH14625.1| Unknown (protein for IMAGE:2960670) [... 38 0.32
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei... 38 0.32
gi|25406838|pir||A86188 hypothetical protein [imported] - Arabid... 38 0.32
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ... 38 0.32
gi|39591036|emb|CAE58816.1| Hypothetical protein CBG02025 [Caeno... 38 0.32
gi|38078686|ref|XP_204076.2| similar to putative C3orf6 protein ... 38 0.42
gi|23479387|gb|EAA16230.1| mature parasite-infected erythrocyte ... 38 0.42
gi|23508147|ref|NP_700817.1| glutamate-rich protein [Plasmodium ... 38 0.42
gi|17027112|gb|AAL34086.1| merozoite surface protein 3 [syntheti... 38 0.42
gi|50761541|ref|XP_424756.1| PREDICTED: similar to Splicing fact... 38 0.42
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein... 38 0.42
gi|23612884|ref|NP_704423.1| hypothetical protein [Plasmodium fa... 38 0.42
gi|40253668|dbj|BAD05611.1| glutamic acid-rich protein precursor... 38 0.42
gi|552138|gb|AAA28970.1| tropomyosin isoform 129 38 0.42
gi|26000356|gb|AAN75470.1| dentin matrix protein 1 [Pteropus hyp... 38 0.42
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes] 38 0.42
gi|90095|pir||S00084 myosin heavy chain, fast skeletal muscle - ... 38 0.42
gi|31243065|ref|XP_321967.1| ENSANGP00000012035 [Anopheles gambi... 38 0.42
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 38 0.42
gi|28901310|ref|NP_800965.1| hypothetical protein VPA1455 [Vibri... 38 0.42
gi|32422933|ref|XP_331910.1| predicted protein [Neurospora crass... 38 0.42
gi|37778944|gb|AAO73464.1| HDM allergen [Dermatophagoides pteron... 38 0.42
gi|50256804|gb|EAL19524.1| hypothetical protein CNBG4710 [Crypto... 38 0.42
gi|32469711|sp|Q8CHG3|GCC2_MOUSE GRIP and coiled-coil domain-con... 38 0.42
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 38 0.42
gi|45551906|ref|NP_732013.2| CG4843-PC [Drosophila melanogaster]... 38 0.42
gi|17945305|gb|AAL48709.1| RE15528p [Drosophila melanogaster] 38 0.42
>gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans
Length = 284
Score = 250 bits (639), Expect = 3e-65
Identities = 126/148 (85%), Positives = 126/148 (85%)
Frame = -1
Query: 1008 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 829
MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG
Sbjct: 1 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 60
Query: 828 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETEXXXXXXXXXXXXXXXXXXXXX 649
KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETE
Sbjct: 61 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETECPGCCIPGPPGPRGSSGTPGK 120
Query: 648 XGLPGNAGKPGMPGTTPNQTCPLNQVRE 565
GLPGNAGKPGMPGTTPNQTCPLNQVRE
Sbjct: 121 PGLPGNAGKPGMPGTTPNQTCPLNQVRE 148
>gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor
(Dumpy protein 10)
gi|7332273|gb|AAA17395.2| collagen [Caenorhabditis elegans]
Length = 356
Score = 250 bits (639), Expect = 3e-65
Identities = 126/148 (85%), Positives = 126/148 (85%)
Frame = -1
Query: 1008 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 829
MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG
Sbjct: 22 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 81
Query: 828 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETEXXXXXXXXXXXXXXXXXXXXX 649
KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETE
Sbjct: 82 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETECPGCCIPGPPGPRGSSGTPGK 141
Query: 648 XGLPGNAGKPGMPGTTPNQTCPLNQVRE 565
GLPGNAGKPGMPGTTPNQTCPLNQVRE
Sbjct: 142 PGLPGNAGKPGMPGTTPNQTCPLNQVRE 169
Score = 58.5 bits (140), Expect = 2e-07
Identities = 34/64 (53%), Positives = 34/64 (53%)
Frame = -1
Query: 279 RNGLTGGQGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVCVCQNVDSILLINPGPQ 100
RNGLTGGQGER GVCVCQNVDSILLINPGPQ
Sbjct: 265 RNGLTGGQGERGWPGVSGESGEPGYPGPEGPMGGQGPPGEPGVCVCQNVDSILLINPGPQ 324
Query: 99 PRIR 88
PRIR
Sbjct: 325 PRIR 328
>gi|32565701|ref|NP_495366.2| collagen triple helix repeat family
member, DumPY : shorter than wild-type DPY-10, ROLler:
helically twisted, animals roll when moving ROL-7
(dpy-10) [Caenorhabditis elegans]
gi|24418223|gb|AAK31556.2| Dumpy : shorter than wild-type protein 10,
isoform a [Caenorhabditis elegans]
Length = 335
Score = 250 bits (639), Expect = 3e-65
Identities = 126/148 (85%), Positives = 126/148 (85%)
Frame = -1
Query: 1008 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 829
MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG
Sbjct: 1 MIYRCVTGLQIGFSLFSFIIVCVALPIMYNHVQNTITYVDREMAYCERSNDEAALELQYG 60
Query: 828 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETEXXXXXXXXXXXXXXXXXXXXX 649
KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETE
Sbjct: 61 KMRMTGNRTARGAYGSGASHGFRPTAYGDEITGAPLETECPGCCIPGPPGPRGSSGTPGK 120
Query: 648 XGLPGNAGKPGMPGTTPNQTCPLNQVRE 565
GLPGNAGKPGMPGTTPNQTCPLNQVRE
Sbjct: 121 PGLPGNAGKPGMPGTTPNQTCPLNQVRE 148
Score = 58.5 bits (140), Expect = 2e-07
Identities = 34/64 (53%), Positives = 34/64 (53%)
Frame = -1
Query: 279 RNGLTGGQGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVCVCQNVDSILLINPGPQ 100
RNGLTGGQGER GVCVCQNVDSILLINPGPQ
Sbjct: 244 RNGLTGGQGERGWPGVSGESGEPGYPGPEGPMGGQGPPGEPGVCVCQNVDSILLINPGPQ 303
Query: 99 PRIR 88
PRIR
Sbjct: 304 PRIR 307