Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T15H9_8
(750 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25152100|ref|NP_741036.1| DNaJ domain (prokaryotic heat shock... 388 e-107
gi|7507879|pir||T24938 hypothetical protein T15H9.1 - Caenorhabd... 388 e-107
gi|39589181|emb|CAE57914.1| Hypothetical protein CBG00965 [Caeno... 375 e-103
gi|50752156|ref|XP_422682.1| PREDICTED: similar to DnaJ homolog ... 244 1e-63
gi|7706495|ref|NP_057390.1| DnaJ (Hsp40) homolog, subfamily B, m... 243 2e-63
gi|14579002|gb|AAK69110.1| PWP1-interacting protein 4 [Homo sapi... 243 2e-63
gi|30584551|gb|AAP36528.1| Homo sapiens DnaJ (Hsp40) homolog, su... 243 2e-63
gi|48146309|emb|CAG33377.1| DNAJB11 [Homo sapiens] 242 5e-63
gi|45361185|ref|NP_989180.1| hypothetical protein MGC75796 [Xeno... 242 7e-63
gi|49523192|gb|AAH75137.1| Unknown (protein for MGC:81924) [Xeno... 241 1e-62
gi|26344614|dbj|BAC35956.1| unnamed protein product [Mus musculus] 241 2e-62
gi|37361854|gb|AAQ91040.1| LRRGT00084 [Rattus norvegicus] 241 2e-62
gi|20892117|ref|XP_148071.1| RIKEN cDNA 1810031F23 [Mus musculus... 241 2e-62
gi|27754067|ref|NP_080676.2| DnaJ (Hsp40) homolog, subfamily B, ... 241 2e-62
gi|38488745|ref|NP_942116.1| DnaJ (Hsp40) homolog, subfamily B, ... 240 3e-62
gi|42542970|gb|AAH66411.1| Dnajb11 protein [Danio rerio] 239 3e-62
gi|17352354|gb|AAL17676.1| apobec-1 binding protein 2 [Mus muscu... 239 6e-62
gi|47213197|emb|CAF95988.1| unnamed protein product [Tetraodon n... 238 8e-62
gi|31222162|ref|XP_317136.1| ENSANGP00000018254 [Anopheles gambi... 236 3e-61
gi|19920464|ref|NP_608525.1| CG4164-PA [Drosophila melanogaster]... 224 2e-57
gi|34869308|ref|XP_341008.1| similar to DnaJ (Hsp40) homolog, su... 210 3e-53
gi|15228802|ref|NP_191819.1| DNAJ heat shock family protein [Ara... 173 3e-42
gi|34897648|ref|NP_910170.1| hypothetical protein [Oryza sativa]... 172 9e-42
gi|33602907|ref|NP_890467.1| molecular chaperone [Bordetella bro... 107 3e-22
gi|23104784|ref|ZP_00091244.1| COG0484: DnaJ-class molecular cha... 107 3e-22
gi|46316148|ref|ZP_00216728.1| COG0484: DnaJ-class molecular cha... 105 8e-22
gi|46320203|ref|ZP_00220595.1| COG0484: DnaJ-class molecular cha... 105 8e-22
gi|33598001|ref|NP_885644.1| molecular chaperone [Bordetella par... 105 8e-22
gi|11496255|ref|NP_067397.1| heat shock protein, DNAJ-like 4 [Mu... 103 3e-21
gi|21758015|dbj|BAC05229.1| unnamed protein product [Homo sapiens] 103 4e-21
gi|33354249|ref|NP_061072.2| DnaJ (Hsp40) homolog, subfamily A, ... 103 4e-21
gi|47523738|ref|NP_999504.1| pDJA1 chaperone [Sus scrofa] >gnl|B... 103 4e-21
gi|27805462|sp|Q8WW22|DJA4_HUMAN DnaJ homolog subfamily A member... 103 4e-21
gi|17547353|ref|NP_520755.1| PROBABLE CHAPERONE PROTEIN [Ralston... 103 4e-21
gi|48768621|ref|ZP_00272970.1| COG0484: DnaJ-class molecular cha... 103 5e-21
gi|50425347|ref|XP_461267.1| unnamed protein product [Debaryomyc... 103 5e-21
gi|46137749|ref|XP_390566.1| hypothetical protein FG10390.1 [Gib... 103 5e-21
gi|28897428|ref|NP_797033.1| DnaJ protein [Vibrio parahaemolytic... 103 5e-21
gi|48861837|ref|ZP_00315736.1| COG0484: DnaJ-class molecular cha... 102 8e-21
gi|33593481|ref|NP_881125.1| molecular chaperone [Bordetella per... 102 8e-21
gi|46581645|ref|YP_012453.1| dnaJ protein [Desulfovibrio vulgari... 102 1e-20
gi|45521649|ref|ZP_00173167.1| COG0484: DnaJ-class molecular cha... 102 1e-20
gi|11132181|sp|O87385|DNAJ_VIBHA Chaperone protein dnaJ >gnl|BL_... 102 1e-20
gi|34863417|ref|XP_217147.2| similar to mmDj4 [Rattus norvegicus] 101 1e-20
gi|32880141|gb|AAP88901.1| DnaJ (Hsp40) homolog, subfamily A, me... 101 2e-20
gi|219588|dbj|BAA02656.1| DnaJ protein homolog [Homo sapiens] 101 2e-20
gi|15028450|gb|AAK81721.1| DnaJ-like protein [Cercopithecus aeth... 101 2e-20
gi|4504511|ref|NP_001530.1| DnaJ (Hsp40) homolog, subfamily A, m... 101 2e-20
gi|28200377|gb|AAO31694.1| DnaJA2 [Homo sapiens] 101 2e-20
gi|19112220|ref|NP_595428.1| putative mitochondrial protein impo... 100 3e-20
gi|6680297|ref|NP_032324.1| DnaJ (Hsp40) homolog, subfamily A, m... 100 3e-20
gi|7488735|pir||T09338 DnaJ-like protein MsJ1 - alfalfa >gnl|BL_... 100 3e-20
gi|45187616|ref|NP_983839.1| ADL257Cp [Eremothecium gossypii] >g... 100 4e-20
gi|3859851|gb|AAC72887.1| heat shock protein Ddj1 [Dictyostelium... 100 4e-20
gi|49250545|gb|AAH74569.1| Unknown (protein for MGC:69518) [Xeno... 100 6e-20
gi|28422719|gb|AAH46954.1| MGC53478 protein [Xenopus laevis] 100 6e-20
gi|27503357|gb|AAH42291.1| Dnaja1-prov protein [Xenopus laevis] 100 6e-20
gi|38605843|emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa (japon... 99 7e-20
gi|50811832|ref|NP_998658.1| similar to DnaJ subfamily A member ... 99 7e-20
gi|15599954|ref|NP_253448.1| DnaJ protein [Pseudomonas aeruginos... 99 7e-20
gi|46439078|gb|EAK98400.1| hypothetical protein CaO19.506 [Candi... 99 9e-20
gi|50291421|ref|XP_448143.1| unnamed protein product [Candida gl... 99 9e-20
gi|46439171|gb|EAK98492.1| hypothetical protein CaO19.8136 [Cand... 99 9e-20
gi|30249896|ref|NP_841966.1| DnaJ molecular chaperone [Nitrosomo... 99 1e-19
gi|48095627|ref|XP_392331.1| similar to pDJA1 chaperone [Apis me... 99 1e-19
gi|1169382|sp|P42824|DNJ2_ALLPO DnaJ protein homolog 2 >gnl|BL_O... 99 1e-19
gi|21357547|ref|NP_650283.1| CG8863-PA [Drosophila melanogaster]... 99 1e-19
gi|50310423|ref|XP_455231.1| unnamed protein product [Kluyveromy... 99 1e-19
gi|16759006|ref|NP_454623.1| DnaJ protein [Salmonella enterica s... 98 2e-19
gi|33578041|gb|AAQ22347.1| heat shock protein [Pseudomonas stutz... 98 2e-19
gi|41723704|ref|ZP_00150614.1| COG0484: DnaJ-class molecular cha... 98 2e-19
gi|50355737|gb|AAT75262.1| putative DnaJ like protein [Oryza sa... 98 2e-19
gi|16128009|ref|NP_414556.1| chaperone with DnaK; heat shock pro... 98 2e-19
gi|15799695|ref|NP_285707.1| chaperone with DnaK; heat shock pro... 98 2e-19
gi|30061585|ref|NP_835756.1| chaperone with DnaK; heat shock pro... 98 2e-19
gi|27363826|ref|NP_759354.1| DnaJ chaperone [Vibrio vulnificus C... 98 2e-19
gi|37679017|ref|NP_933626.1| chaperone protein DnaJ [Vibrio vuln... 98 2e-19
gi|24111464|ref|NP_705974.1| chaperone with DnaK; heat shock pro... 98 2e-19
gi|28871638|ref|NP_794257.1| dnaJ protein [Pseudomonas syringae ... 98 2e-19
gi|1706465|sp|P50025|DNAJ_LEGPN Chaperone protein dnaJ >gnl|BL_O... 97 3e-19
gi|38086711|ref|XP_125441.3| similar to DnaJ-like protein 2 [Mus... 97 3e-19
gi|46188193|ref|ZP_00126275.2| COG0484: DnaJ-class molecular cha... 97 3e-19
gi|15616772|ref|NP_239984.1| DnaJ protein [Buchnera aphidicola s... 97 3e-19
gi|7441914|pir||JC5609 heat shock protein dnaJ - Buchnera sp >gn... 97 3e-19
gi|50086568|ref|YP_048078.1| heat shock protein (Hsp40), co-chap... 97 4e-19
gi|7441930|pir||T07371 dnaJ protein homolog - potato >gnl|BL_ORD... 97 4e-19
gi|6324265|ref|NP_014335.1| yeast dnaJ homolog (nuclear envelope... 97 5e-19
gi|29654589|ref|NP_820281.1| chaperone protein dnaJ [Coxiella bu... 97 5e-19
gi|14091768|ref|NP_114468.1| DnaJ (Hsp40) homolog, subfamily A, ... 97 5e-19
gi|9789937|ref|NP_062768.1| DnaJ (Hsp40) homolog, subfamily A, m... 97 5e-19
gi|5031741|ref|NP_005871.1| DnaJ subfamily A member 2; cell cycl... 97 5e-19
gi|49474890|ref|YP_032931.1| Heat shock protein DnaJ [Bartonella... 97 5e-19
gi|2119733|pir||I40843 heat shock protein dnaJ - Coxiella burnet... 97 5e-19
gi|48786661|ref|ZP_00282795.1| COG0484: DnaJ-class molecular cha... 97 5e-19
gi|33519590|ref|NP_878422.1| DnaJ protein [Candidatus Blochmanni... 97 5e-19
gi|14140154|emb|CAC39071.1| DnaJ-like protein [Oryza sativa] 96 6e-19
gi|32450159|gb|AAH53791.1| Dnaja2-prov protein [Xenopus laevis] 96 6e-19
gi|49388562|dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Ory... 96 6e-19
gi|48732394|ref|ZP_00266137.1| COG0484: DnaJ-class molecular cha... 96 6e-19
gi|47220868|emb|CAG03075.1| unnamed protein product [Tetraodon n... 96 8e-19
gi|47086707|ref|NP_997830.1| DnaJ (Hsp40) homolog, subfamily A, ... 96 8e-19
gi|48860314|ref|ZP_00314239.1| COG0484: DnaJ-class molecular cha... 96 8e-19
gi|47225843|emb|CAF98323.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|49473744|ref|YP_031786.1| Heat shock protein DnaJ [Bartonella... 96 1e-18
gi|50255984|gb|EAL18713.1| hypothetical protein CNBI2990 [Crypto... 95 1e-18
gi|4210948|gb|AAD12055.1| DnaJ protein [Hevea brasiliensis] 95 1e-18
gi|50762144|ref|XP_424949.1| PREDICTED: similar to DnaJ homolog ... 95 2e-18
gi|29249429|gb|EAA40941.1| GLP_186_64698_63613 [Giardia lamblia ... 94 2e-18
gi|16120798|ref|NP_404111.1| chaperone protein DnaJ [Yersinia pe... 94 3e-18
gi|1352281|sp|P48207|DNAJ_FRATU Chaperone protein dnaJ >gnl|BL_O... 94 3e-18
gi|15675997|ref|NP_273124.1| dnaJ protein [Neisseria meningitidi... 94 3e-18
gi|46141598|ref|ZP_00146910.2| COG0484: DnaJ-class molecular cha... 94 3e-18
gi|6782421|gb|AAF28382.1| DnaJ-like protein [Lycopersicon escule... 94 3e-18
gi|27468184|ref|NP_764821.1| DnaJ protein [Staphylococcus epider... 94 4e-18
gi|49090814|ref|XP_406868.1| hypothetical protein AN2731.2 [Aspe... 93 5e-18
gi|26991409|ref|NP_746834.1| dnaJ protein [Pseudomonas putida KT... 93 7e-18
gi|15679295|ref|NP_276412.1| DnaJ protein [Methanothermobacter t... 93 7e-18
gi|23466915|ref|ZP_00122501.1| COG0484: DnaJ-class molecular cha... 93 7e-18
gi|46228849|gb|EAK89719.1| DNAJ like chaperone [Cryptosporidium ... 93 7e-18
gi|15640872|ref|NP_230503.1| dnaJ protein [Vibrio cholerae O1 bi... 92 9e-18
gi|46912327|emb|CAG19119.1| putative DnaJ protein, DnaJ-class mo... 92 9e-18
gi|37524584|ref|NP_927928.1| heat shock protein dnaJ (HSP40) (ch... 92 1e-17
gi|21914368|gb|AAM81355.1| heat shock protein 40 [Steinernema fe... 92 1e-17
gi|15602605|ref|NP_245677.1| DnaJ [Pasteurella multocida Pm70] >... 92 1e-17
gi|2352904|gb|AAB69313.1| Dnj3/Cpr3 [Homo sapiens] 92 1e-17
gi|15838930|ref|NP_299618.1| DnaJ protein [Xylella fastidiosa 9a... 92 1e-17
gi|6226597|sp|P77866|DNAJ_ACTAC Chaperone protein dnaJ >gnl|BL_O... 91 2e-17
gi|34497100|ref|NP_901315.1| heat shock protein dnaJ; chaperone ... 91 2e-17
gi|23474234|ref|ZP_00129528.1| COG0484: DnaJ-class molecular cha... 91 2e-17
gi|48838226|ref|ZP_00295173.1| COG0484: DnaJ-class molecular cha... 91 2e-17
gi|22997388|ref|ZP_00041620.1| COG0484: DnaJ-class molecular cha... 91 3e-17
gi|2731574|gb|AAC27389.1| DnaJ homolog [Babesia bovis] 91 3e-17
gi|31215420|ref|XP_316024.1| ENSANGP00000010793 [Anopheles gambi... 91 3e-17
gi|28199253|ref|NP_779567.1| DnaJ protein [Xylella fastidiosa Te... 91 3e-17
gi|15924569|ref|NP_372103.1| DnaJ protein [Staphylococcus aureus... 91 3e-17
gi|49483827|ref|YP_041051.1| chaperone protein [Staphylococcus a... 91 3e-17
gi|46156765|ref|ZP_00132203.2| COG0484: DnaJ-class molecular cha... 91 3e-17
gi|39995145|ref|NP_951096.1| chaperone protein dnaJ [Geobacter s... 91 3e-17
gi|46226966|gb|EAK87932.1| DNAj domain protein having a signal p... 91 3e-17
gi|22994777|ref|ZP_00039268.1| COG0484: DnaJ-class molecular cha... 91 3e-17
gi|11132612|sp|Q9ZFC5|DNAJ_METSS Chaperone protein dnaJ >gnl|BL_... 90 4e-17
gi|21672435|ref|NP_660502.1| DnaJ protein [Buchnera aphidicola s... 90 4e-17
gi|45915423|ref|ZP_00194061.2| COG0484: DnaJ-class molecular cha... 90 4e-17
gi|23612369|ref|NP_703949.1| DNAJ domain protein, putative [Plas... 90 4e-17
gi|27375791|ref|NP_767320.1| chaperone protein [Bradyrhizobium j... 90 4e-17
gi|461942|sp|Q03363|DNJ1_ALLPO DnaJ protein homolog 1 (DNAJ-1) >... 90 6e-17
gi|20807437|ref|NP_622608.1| Molecular chaperones (contain C-ter... 89 7e-17
gi|38106994|gb|EAA53225.1| hypothetical protein MG07502.4 [Magna... 89 7e-17
gi|11132491|sp|Q9UXR9|DNAJ_METTE Chaperone protein dnaJ (Heat sh... 89 1e-16
gi|21230930|ref|NP_636847.1| DnaJ protein [Xanthomonas campestri... 89 1e-16
gi|12484032|gb|AAG53937.1| DnaJ [Xanthomonas campestris pv. camp... 89 1e-16
gi|28302332|gb|AAH46660.1| MGC52928 protein [Xenopus laevis] 89 1e-16
gi|21228606|ref|NP_634528.1| Chaperone protein [Methanosarcina m... 89 1e-16
gi|18420428|ref|NP_568412.1| DNAJ heat shock protein, putative [... 89 1e-16
gi|23099422|ref|NP_692888.1| heat shock protein [Oceanobacillus ... 88 2e-16
gi|11061652|emb|CAC14528.1| DNAJ protein [Leishmania major] 88 2e-16
gi|32475650|ref|NP_868644.1| chaperone protein DnaJ [Pirellula s... 88 2e-16
gi|47574814|ref|ZP_00244849.1| COG0484: DnaJ-class molecular cha... 88 2e-16
gi|535588|gb|AAB86799.1| putative [Arabidopsis thaliana] >gnl|BL... 88 2e-16
gi|20090338|ref|NP_616413.1| heat shock protein 40 [Methanosarci... 88 2e-16
gi|2546944|emb|CAA70246.1| DnaJ [Geodia cydonium] 88 2e-16
gi|11277163|pir||T43929 DnaJ protein homolog [imported] - Salix ... 88 2e-16
gi|1169372|sp|P45555|DNAJ_STAAU Chaperone protein dnaJ (HSP40) >... 87 3e-16
gi|23509581|ref|NP_702248.1| hypothetical protein, conserved [Pl... 87 3e-16
gi|7595798|gb|AAF64454.1| DnaJ protein [Euphorbia esula] 87 3e-16
gi|9309334|dbj|BAB03216.1| dnaJ [Geobacillus thermoglucosidasius] 87 3e-16
gi|48833385|ref|ZP_00290405.1| COG0484: DnaJ-class molecular cha... 87 4e-16
gi|29367357|gb|AAO72551.1| DNAJ-like protein [Oryza sativa (japo... 87 4e-16
gi|7441932|pir||T01643 DnaJ protein homolog ZMDJ1 - maize >gnl|B... 87 4e-16
gi|30691988|ref|NP_850653.1| DNAJ heat shock protein, putative (... 87 5e-16
gi|15229874|ref|NP_189997.1| DNAJ heat shock protein, putative (... 87 5e-16
gi|24372710|ref|NP_716752.1| chaperone protein DnaJ [Shewanella ... 87 5e-16
gi|32491047|ref|NP_871301.1| dnaJ [Wigglesworthia glossinidia en... 87 5e-16
gi|31204407|ref|XP_311152.1| ENSANGP00000020449 [Anopheles gambi... 87 5e-16
gi|22298332|ref|NP_681579.1| heat shock protein [Thermosynechoco... 86 6e-16
gi|2129577|pir||S71199 dnaJ protein homolog atj3 - Arabidopsis t... 86 6e-16
gi|10798648|emb|CAC12824.1| putative DNAJ protein [Nicotiana tab... 86 6e-16
gi|28950130|emb|CAD70988.1| related to SCJ1 protein [Neurospora ... 86 6e-16
gi|33151439|ref|NP_872792.1| chaperone protein DnaJ [Haemophilus... 86 6e-16
gi|32450126|gb|AAH54199.1| MGC64353 protein [Xenopus laevis] 86 8e-16
gi|16124267|ref|NP_418831.1| dnaJ protein [Caulobacter crescentu... 86 8e-16
gi|17988284|ref|NP_540918.1| CHAPERONE PROTEIN DNAJ [Brucella me... 86 8e-16
gi|49235988|ref|ZP_00330051.1| COG0484: DnaJ-class molecular cha... 86 1e-15
gi|46309065|ref|ZP_00211257.1| COG0484: DnaJ-class molecular cha... 86 1e-15
gi|15010708|gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thali... 85 1e-15
gi|48763848|ref|ZP_00268401.1| COG0484: DnaJ-class molecular cha... 85 1e-15
gi|50122802|ref|YP_051969.1| chaperone protein DnaJ [Erwinia car... 85 2e-15
gi|886414|gb|AAC18895.1| TCJ2 [Trypanosoma cruzi] 85 2e-15
gi|15963936|ref|NP_384289.1| PROBABLE CHAPERONE PROTEIN [Sinorhi... 84 2e-15
gi|15887475|ref|NP_353156.1| AGR_C_192p [Agrobacterium tumefacie... 84 2e-15
gi|46142067|ref|ZP_00147640.2| COG0484: DnaJ-class molecular cha... 84 3e-15
gi|49097694|ref|XP_410307.1| hypothetical protein AN6170.2 [Aspe... 84 4e-15
gi|40362978|gb|AAR84666.1| DnaJ [Agrobacterium tumefaciens] 83 5e-15
gi|47224128|emb|CAG13048.1| unnamed protein product [Tetraodon n... 83 5e-15
gi|23490062|gb|EAA21924.1| DnaJ homolog [Plasmodium yoelii yoelii] 83 5e-15
gi|50876371|emb|CAG36211.1| probable chaperone protein DnaJ [Des... 83 5e-15
gi|16273157|ref|NP_439394.1| heat shock protein [Haemophilus inf... 83 7e-15
gi|1169371|sp|P43735|DNAJ_HAEIN Chaperone protein dnaJ 83 7e-15
gi|46191789|ref|ZP_00008042.2| COG0484: DnaJ-class molecular cha... 83 7e-15
gi|46200114|ref|YP_005781.1| chaperone protein dnaJ [Thermus the... 83 7e-15
gi|32034805|ref|ZP_00134923.1| COG0484: DnaJ-class molecular cha... 82 9e-15
gi|25090177|sp|Q9LCQ4|DNAJ_BRECH Chaperone protein dnaJ >gnl|BL_... 82 1e-14
gi|42522819|ref|NP_968199.1| DnaJ protein [Bdellovibrio bacterio... 82 1e-14
gi|46124895|ref|XP_387001.1| hypothetical protein FG06825.1 [Gib... 82 1e-14
gi|13473985|ref|NP_105553.1| heat shock protein dnaJ (40) [Mesor... 82 2e-14
gi|37523836|ref|NP_927213.1| chaperone protein [Gloeobacter viol... 82 2e-14
gi|39933411|ref|NP_945687.1| heat shock protein DnaJ (40) [Rhodo... 81 2e-14
gi|28211652|ref|NP_782596.1| chaperone protein dnaJ [Clostridium... 81 2e-14
gi|46133570|ref|ZP_00157396.2| COG0484: DnaJ-class molecular cha... 81 2e-14
gi|42519957|ref|NP_965872.1| dnaJ protein [Wolbachia endosymbion... 81 2e-14
gi|21553367|gb|AAM62460.1| DnaJ protein-like [Arabidopsis thaliana] 81 2e-14
gi|50305127|ref|XP_452522.1| unnamed protein product [Kluyveromy... 81 3e-14
gi|21402360|ref|NP_658345.1| DnaJ_C, DnaJ C terminal region [Bac... 80 3e-14
gi|30264384|ref|NP_846761.1| chaperone protein dnaJ [Bacillus an... 80 3e-14
gi|48845784|ref|ZP_00300056.1| COG0484: DnaJ-class molecular cha... 80 3e-14
gi|461943|sp|Q05980|DNAJ_BRUOV Chaperone protein dnaJ >gnl|BL_OR... 80 5e-14
gi|29466787|dbj|BAC66861.1| heat shock protein DnaJ [Lactobacill... 80 5e-14
gi|16805018|ref|NP_473047.1| heat shock 40 kDa protein, putative... 80 5e-14
gi|33944935|ref|XP_340615.1| DnaJ protein, putative [Trypanosoma... 80 5e-14
gi|50260032|gb|EAL22695.1| hypothetical protein CNBB1440 [Crypto... 80 5e-14
gi|46201302|ref|ZP_00055306.2| COG0484: DnaJ-class molecular cha... 80 6e-14
gi|20129487|ref|NP_609605.1| CG9828-PA [Drosophila melanogaster]... 80 6e-14
gi|18446877|gb|AAL68031.1| AT04231p [Drosophila melanogaster] 80 6e-14
gi|42783440|ref|NP_980687.1| chaperone protein dnaJ [Bacillus ce... 79 8e-14
gi|11132092|sp|O52065|DNAJ_PASHA Chaperone protein dnaJ >gnl|BL_... 79 1e-13
gi|18399949|ref|NP_565533.1| DNAJ heat shock family protein [Ara... 79 1e-13
gi|30794072|gb|AAP40480.1| putative DnaJ protein [Arabidopsis th... 79 1e-13
gi|30421324|gb|AAP31275.1| DNAJ-1 [Drosophila sechellia] 79 1e-13
gi|25296019|pir||G84611 probable DnaJ protein [imported] - Arabi... 79 1e-13
gi|951451|gb|AAC18896.1| TCJ3 [Trypanosoma cruzi] 79 1e-13
gi|46093414|dbj|BAD14920.1| DnaJ [Acetobacter aceti] 79 1e-13
gi|31199405|ref|XP_308650.1| ENSANGP00000011260 [Anopheles gambi... 79 1e-13
gi|50762236|ref|XP_424983.1| PREDICTED: similar to DnaJ homolog ... 79 1e-13
gi|29832113|ref|NP_826747.1| putative DnaJ protein [Streptomyces... 79 1e-13
gi|49075818|ref|XP_401947.1| hypothetical protein UM04332.1 [Ust... 79 1e-13
gi|45190948|ref|NP_985202.1| AER346Wp [Eremothecium gossypii] >g... 79 1e-13
gi|11132095|sp|O52164|DNJ2_STRAL Chaperone protein dnaJ2 >gnl|BL... 78 2e-13
gi|30022392|ref|NP_834023.1| Chaperone protein dnaJ [Bacillus ce... 78 2e-13
gi|21536561|gb|AAM60893.1| putative DnaJ protein [Arabidopsis th... 78 2e-13
gi|18420568|ref|NP_568076.1| DNAJ heat shock family protein [Ara... 78 2e-13
gi|15807619|ref|NP_293852.1| dnaJ protein [Deinococcus radiodura... 78 2e-13
gi|3122016|sp|Q52702|DNAJ_RHOCA Chaperone protein dnaJ >gnl|BL_O... 78 2e-13
gi|7441920|pir||T06102 heat shock protein T5J17.130, dnaJ-type -... 78 2e-13
gi|49066696|ref|XP_397638.1| hypothetical protein UM00023.1 [Ust... 78 2e-13
gi|46907700|ref|YP_014089.1| chaperone protein DnaJ [Listeria mo... 77 3e-13
gi|17229939|ref|NP_486487.1| DnaJ protein [Nostoc sp. PCC 7120] ... 77 4e-13
gi|42526145|ref|NP_971243.1| chaperone protein DnaJ [Treponema d... 77 4e-13
gi|33860577|ref|NP_892138.1| DnaJ protein [Prochlorococcus marin... 77 4e-13
gi|30421312|gb|AAP31269.1| DNAJ-1 [Drosophila mimetica] 77 5e-13
gi|16800577|ref|NP_470845.1| heat shock protein DnaJ [Listeria i... 77 5e-13
gi|30421320|gb|AAP31273.1| DNAJ-1 [Drosophila yakuba] 77 5e-13
gi|30421316|gb|AAP31271.1| DNAJ-1 [Drosophila erecta] 77 5e-13
gi|46438362|gb|EAK97694.1| hypothetical protein CaO19.10942 [Can... 77 5e-13
gi|48893092|ref|ZP_00326385.1| COG0484: DnaJ-class molecular cha... 77 5e-13
gi|30421314|gb|AAP31270.1| DNAJ-1 [Drosophila orena] 77 5e-13
gi|30421322|gb|AAP31274.1| DNAJ-1 [Drosophila mauritiana] 77 5e-13
gi|30421326|gb|AAP31276.1| DNAJ-1 [Drosophila simulans] >gnl|BL_... 77 5e-13
gi|16082112|ref|NP_394547.1| heat shock protein DnaJ related pro... 77 5e-13
gi|18412605|ref|NP_565227.1| DNAJ heat shock protein, putative [... 76 7e-13
gi|23478094|gb|EAA15273.1| DnaJ homolog, putative [Plasmodium yo... 76 7e-13
gi|3122004|sp|O33529|DNAJ_RHILE Chaperone protein dnaJ >gnl|BL_O... 76 7e-13
gi|50552724|ref|XP_503772.1| hypothetical protein [Yarrowia lipo... 76 7e-13
gi|16803512|ref|NP_464997.1| heat shock protein DnaJ [Listeria m... 76 7e-13
gi|14326568|gb|AAK60328.1| At1g80030/F18B13_37 [Arabidopsis thal... 76 9e-13
gi|9845259|ref|NP_063927.1| DnaJ (Hsp40) homolog, subfamily B, m... 76 9e-13
gi|34867171|ref|XP_233767.2| similar to heat shock protein hsp40... 76 9e-13
gi|15827255|ref|NP_301518.1| DnaJ homologue [Mycobacterium lepra... 76 9e-13
gi|16326131|dbj|BAB70509.1| DNAJ homologue [Oryza sativa] 76 9e-13
gi|47497379|dbj|BAD19417.1| putative heat shock protein dnaJ [Or... 76 9e-13
gi|13541318|ref|NP_111006.1| Molecular chaperone (DnaJ-related) ... 76 9e-13
gi|7441921|pir||T06594 heat shock protein dnaJ - garden pea >gnl... 76 9e-13
gi|48975929|emb|CAD99040.1| putative scj1 protein [Yarrowia lipo... 76 9e-13
gi|46849521|dbj|BAD17849.1| putative chaperone DnaJ [Hydrogenoba... 75 1e-12
gi|18202150|sp|O75953|DJB5_HUMAN DnaJ homolog subfamily B member... 75 1e-12
gi|30421318|gb|AAP31272.1| DNAJ-1 [Drosophila teissieri] 75 1e-12
gi|48835289|ref|ZP_00292290.1| COG0484: DnaJ-class molecular cha... 75 1e-12
gi|15082401|gb|AAH12115.1| DNAJB5 protein [Homo sapiens] 75 1e-12
gi|2494151|sp|Q45552|DNAJ_BACST Chaperone protein dnaJ >gnl|BL_O... 75 1e-12
gi|21361413|ref|NP_036398.2| DnaJ (Hsp40) homolog, subfamily B, ... 75 1e-12
gi|48836594|ref|ZP_00293590.1| COG0484: DnaJ-class molecular cha... 75 1e-12
gi|24668492|ref|NP_649380.1| CG7130-PA [Drosophila melanogaster]... 75 1e-12
gi|47210685|emb|CAG06349.1| unnamed protein product [Tetraodon n... 75 1e-12
gi|3228367|gb|AAC23584.1| droj1 [Drosophila melanogaster] 75 1e-12
gi|30421332|gb|AAP31279.1| DNAJ-1 [Drosophila melanogaster] 75 1e-12
gi|24658555|ref|NP_523936.2| CG10578-PA [Drosophila melanogaster... 75 1e-12
gi|50539774|ref|NP_001002353.1| zgc:92148 [Danio rerio] >gnl|BL_... 75 1e-12
gi|3121987|sp|O34136|DNAJ_DEIPR Chaperone protein dnaJ (40 kDa h... 75 1e-12
gi|31544354|ref|NP_852932.1| DnaJ [Mycoplasma gallisepticum R] >... 75 1e-12
gi|2735762|gb|AAC35417.1| heat shock protein DnaJ [Leptospira in... 75 2e-12
gi|31236518|ref|XP_319427.1| ENSANGP00000023631 [Anopheles gambi... 75 2e-12
gi|15640026|ref|NP_218657.1| heat shock protein [Treponema palli... 75 2e-12
gi|7441931|pir||F71379 heat shock protein dnaJ - syphilis spiroc... 75 2e-12
gi|29250418|gb|EAA41912.1| GLP_39_30615_31604 [Giardia lamblia A... 75 2e-12
gi|6179940|gb|AAF05720.1| DnaJ-like protein [Nicotiana tabacum] 75 2e-12
gi|15645945|ref|NP_208124.1| co-chaperone and heat shock protein... 74 2e-12
gi|18422864|ref|NP_568690.1| DNAJ heat shock protein, mitochondr... 74 2e-12
gi|21429604|gb|AAM49801.1| GFA2 [Arabidopsis thaliana] 74 2e-12
gi|48477913|ref|YP_023619.1| chaperone protein DnaJ [Picrophilus... 74 2e-12
gi|26554350|ref|NP_758284.1| heat shock protein DnaJ [Mycoplasma... 74 2e-12
gi|37522683|ref|NP_926060.1| chaperone protein [Gloeobacter viol... 74 2e-12
gi|42525193|ref|NP_970573.1| DnaJ protein [Bdellovibrio bacterio... 74 2e-12
gi|11863723|emb|CAC16088.2| DnaJ like protein [Lycopersicon escu... 74 2e-12
gi|46446102|ref|YP_007467.1| probable heat shock protein dnaJ [P... 74 2e-12
gi|48095889|ref|XP_394545.1| similar to CG5001-PA [Apis mellifera] 74 2e-12
gi|15612317|ref|NP_223970.1| co-chaperone with DnaK [Helicobacte... 74 3e-12
gi|10177754|dbj|BAB11067.1| DnaJ protein-like [Arabidopsis thali... 74 3e-12
gi|15594862|ref|NP_212651.1| heat shock protein (dnaJ-1) [Borrel... 74 3e-12
gi|47226687|emb|CAG07846.1| unnamed protein product [Tetraodon n... 74 3e-12
gi|144000|gb|AAA22948.1| dnaJ homologue 74 3e-12
gi|143978|gb|AAA22925.1| putative 74 3e-12
gi|477566|pir||A49210 heat shock protein dnaJ - Lyme disease spi... 74 3e-12
gi|21674304|ref|NP_662369.1| DnaJ protein [Chlorobium tepidum TL... 74 3e-12
gi|23130152|ref|ZP_00111971.1| COG0484: DnaJ-class molecular cha... 74 4e-12
gi|45513518|ref|ZP_00165084.1| COG0484: DnaJ-class molecular cha... 74 4e-12
gi|24216406|ref|NP_713887.1| Chaperone protein dnaJ [Leptospira ... 74 4e-12
gi|24580827|ref|NP_608586.1| CG5001-PA [Drosophila melanogaster]... 74 4e-12
gi|48853832|ref|ZP_00307998.1| COG0484: DnaJ-class molecular cha... 73 6e-12
gi|24654066|ref|NP_725541.1| CG8448-PA [Drosophila melanogaster]... 73 6e-12
gi|11132455|sp|Q9RUG2|DNAJ_DEIRA Chaperone protein dnaJ 73 6e-12
gi|15806441|ref|NP_295147.1| dnaJ protein [Deinococcus radiodura... 73 6e-12
gi|33239469|ref|NP_874411.1| DnaJ-class molecular chaperone [Pro... 73 6e-12
gi|18311014|ref|NP_562948.1| heat shock protein [Clostridium per... 73 6e-12
gi|25296044|pir||G96831 hypothetical protein F18B13.12 [imported... 73 7e-12
gi|32267018|ref|NP_861050.1| co-chaperone and heat shock protein... 73 7e-12
gi|47223452|emb|CAG04313.1| unnamed protein product [Tetraodon n... 73 7e-12
gi|15617956|ref|NP_224240.1| Heat Shock Protein J [Chlamydophila... 72 9e-12
gi|45526679|ref|ZP_00177882.1| COG2214: DnaJ-class molecular cha... 72 9e-12
gi|16331768|ref|NP_442496.1| DnaJ protein [Synechocystis sp. PCC... 72 9e-12
gi|50418455|gb|AAH77166.1| Unknown (protein for MGC:91922) [Dani... 72 9e-12
gi|29840996|gb|AAP06009.1| similar to GenBank Accession Number Q... 72 9e-12
gi|15240968|ref|NP_195759.1| DNAJ heat shock protein, putative [... 72 9e-12
gi|46103471|ref|ZP_00198394.1| COG0484: DnaJ-class molecular cha... 72 1e-11
gi|48096650|ref|XP_392495.1| similar to CG8448-PA [Apis mellifera] 72 1e-11
gi|22974306|ref|ZP_00020599.1| hypothetical protein [Chloroflexu... 72 1e-11
gi|39597250|emb|CAE59478.1| Hypothetical protein CBG02862 [Caeno... 72 1e-11
gi|47215594|emb|CAG11625.1| unnamed protein product [Tetraodon n... 72 1e-11
gi|48824061|ref|ZP_00285490.1| COG0484: DnaJ-class molecular cha... 72 1e-11
gi|46124601|ref|XP_386854.1| hypothetical protein FG06678.1 [Gib... 72 1e-11
gi|13507760|ref|NP_109709.1| heat shock protein DnaJ [Mycoplasma... 72 1e-11
gi|29840088|ref|NP_829194.1| dnaJ protein [Chlamydophila caviae ... 72 2e-11
gi|34902472|ref|NP_912582.1| Putative DNAJ protein [Oryza sativa... 72 2e-11
gi|46106508|ref|ZP_00200021.1| COG0484: DnaJ-class molecular cha... 72 2e-11
gi|49473993|ref|YP_032035.1| Heat shock protein DnaJ [Bartonella... 72 2e-11
gi|47206629|emb|CAF95110.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|42519350|ref|NP_965280.1| chaperone protein DnaJ [Lactobacill... 72 2e-11
gi|48716890|dbj|BAD23586.1| putative DnaJ-like protein [Oryza sa... 72 2e-11
gi|5542127|pdb|1BQZ| J-Domain (Residues 1-77) Of The Escherichi... 72 2e-11
gi|5542126|pdb|1BQ0| J-Domain (Residues 1-77) Of The Escherichi... 72 2e-11
gi|1942570|pdb|1XBL| Nmr Structure Of The J-Domain (Residues 2-... 72 2e-11
gi|41053503|ref|NP_956599.1| hypothetical protein MGC56709 [Dani... 71 2e-11
gi|50425059|ref|XP_461121.1| unnamed protein product [Debaryomyc... 71 2e-11
gi|48870606|ref|ZP_00323327.1| COG0484: DnaJ-class molecular cha... 71 2e-11
gi|3372677|gb|AAC29066.1| tumorous imaginal discs protein Tid56 ... 71 2e-11
gi|22299692|ref|NP_682939.1| DnaJ protein [Thermosynechococcus e... 71 2e-11
gi|31560085|ref|NP_076135.2| DnaJ (Hsp40) homolog, subfamily A, ... 71 2e-11
gi|31542539|ref|NP_005138.2| DnaJ (Hsp40) homolog, subfamily A, ... 71 2e-11
gi|30913111|sp|Q99M87|DJA3_MOUSE DnaJ homolog subfamily A member... 71 2e-11
gi|12836451|dbj|BAB23661.1| unnamed protein product [Mus musculus] 71 2e-11
gi|34868661|ref|XP_340756.1| similar to tumorous imaginal discs ... 71 2e-11
gi|12963344|gb|AAK11222.1| tumorous imaginal discs protein Tid56... 71 2e-11
gi|17066575|gb|AAL35323.1| DnaJ protein Tid-1 [Homo sapiens] >gn... 71 2e-11
gi|26327155|dbj|BAC27321.1| unnamed protein product [Mus musculus] 71 2e-11
gi|34924888|sp|Q24331|TID_DROVI Tumorous imaginal discs protein,... 71 2e-11
gi|13938209|gb|AAH07225.1| Unknown (protein for IMAGE:3161441) [... 71 2e-11
gi|34897976|ref|NP_910334.1| DnaJ protein-like~contains EST AU18... 71 2e-11
gi|21313156|ref|NP_080202.1| DnaJ (Hsp40) homolog, subfamily B, ... 71 2e-11
gi|29347222|ref|NP_810725.1| putative chaperone DnAJ [Bacteroide... 71 2e-11
gi|40225932|gb|AAH14062.1| DNAJA3 protein [Homo sapiens] >gnl|BL... 71 2e-11
gi|13278151|gb|AAH03920.1| Dnaja3 protein [Mus musculus] 71 2e-11
gi|12963346|gb|AAK11223.1| tumorous imaginal discs protein Tid56... 71 2e-11
gi|15605064|ref|NP_219848.1| Heat Shock Protein J [Chlamydia tra... 71 3e-11
gi|15235310|ref|NP_194577.1| DNAJ heat shock family protein [Ara... 71 3e-11
gi|41152000|ref|NP_958470.1| DnaJ (Hsp40) homolog, subfamily A, ... 71 3e-11
gi|50751414|ref|XP_422386.1| PREDICTED: similar to DnaJ (Hsp40) ... 71 3e-11
gi|23501321|ref|NP_697448.1| chaperone protein DnaJ, putative [B... 71 3e-11
gi|17987796|ref|NP_540430.1| CHAPERONE PROTEIN DNAJ [Brucella me... 71 3e-11
gi|34861654|ref|XP_227809.2| similar to DnaJ homolog subfamily B... 71 3e-11
gi|15835234|ref|NP_296993.1| dnaJ protein [Chlamydia muridarum] ... 71 3e-11
gi|47215424|emb|CAG01121.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|15231987|ref|NP_187503.1| DNAJ heat shock protein, putative [... 70 4e-11
gi|21618097|gb|AAM67147.1| putative heat shock protein [Arabidop... 70 4e-11
gi|7512480|pir||G02272 heat shock protein hsp40 homolog - human ... 70 4e-11
gi|6631085|ref|NP_008965.2| DnaJ (Hsp40) homolog, subfamily B, m... 70 4e-11
gi|47219032|emb|CAG00171.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|48850382|ref|ZP_00304624.1| COG2214: DnaJ-class molecular cha... 70 5e-11
gi|32476331|ref|NP_869325.1| DnaJ1 protein [Pirellula sp. 1] >gn... 70 5e-11
gi|27806965|ref|NP_776957.1| DnaJ (Hsp40) homolog, subfamily B, ... 70 5e-11
gi|34557109|ref|NP_906924.1| CHAPERONE WITH DNAK, HEAT SHOCK PRO... 70 5e-11
gi|23002899|ref|ZP_00046571.1| COG0484: DnaJ-class molecular cha... 70 5e-11
gi|29375878|ref|NP_815032.1| dnaJ protein [Enterococcus faecalis... 70 5e-11
gi|41053046|dbj|BAD07976.1| putative heat shock protein 40 [Oryz... 70 5e-11
gi|21312512|ref|NP_081563.1| DnaJ (Hsp40) homolog, subfamily B, ... 70 5e-11
gi|34541399|ref|NP_905878.1| dnaJ protein [Porphyromonas gingiva... 70 5e-11
gi|94571|pir||B35388 heat shock protein dnaJ - Caulobacter cresc... 70 6e-11
gi|46580285|ref|YP_011093.1| dnaJ protein, putative [Desulfovibr... 70 6e-11
gi|41408260|ref|NP_961096.1| DnaJ2 [Mycobacterium avium subsp. p... 70 6e-11
gi|34905276|ref|NP_913985.1| putative heat shock protein 40 [Ory... 70 6e-11
gi|17534355|ref|NP_496468.1| DNaJ domain (prokaryotic heat shock... 70 6e-11
gi|48847091|ref|ZP_00301349.1| COG2214: DnaJ-class molecular cha... 69 8e-11
gi|23508689|ref|NP_701358.1| hypothetical protein [Plasmodium fa... 69 8e-11
gi|17228981|ref|NP_485529.1| chaperone protein [Nostoc sp. PCC 7... 69 8e-11
gi|15792584|ref|NP_282407.1| chaperone DnaJ [Campylobacter jejun... 69 8e-11
gi|48867977|ref|ZP_00321382.1| COG0484: DnaJ-class molecular cha... 69 8e-11
gi|19262995|dbj|BAB85846.1| heat shock protein 40 [Ciona intesti... 69 8e-11
gi|50750359|ref|XP_421968.1| PREDICTED: similar to macrothioredo... 69 1e-10
gi|13357969|ref|NP_078243.1| heat shock protein [Ureaplasma parv... 69 1e-10
gi|544177|sp|Q05646|DNAJ_ERYRH Chaperone protein dnaJ >gnl|BL_OR... 69 1e-10
gi|29833781|ref|NP_828415.1| putative heat shock protein DnaJ [S... 69 1e-10
gi|48765686|ref|ZP_00270236.1| COG2214: DnaJ-class molecular cha... 69 1e-10
gi|47226293|emb|CAG09261.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|5020005|gb|AAD37973.1| heat shock protein DnaJ [Rhodothermus ... 69 1e-10
gi|50415468|gb|AAH78100.1| Unknown (protein for MGC:83507) [Xeno... 69 1e-10
gi|15225377|ref|NP_179646.1| DNAJ heat shock family protein [Ara... 69 1e-10
gi|1362106|pir||S56704 GUT 7-2a protein - common tobacco (fragment) 69 1e-10
gi|12322012|gb|AAG51050.1| DnaJ protein, putative, 3' partial; 1... 69 1e-10
gi|31198721|ref|XP_308308.1| ENSANGP00000010875 [Anopheles gambi... 69 1e-10
gi|15230424|ref|NP_187824.1| DNAJ heat shock N-terminal domain-c... 69 1e-10
gi|12044869|ref|NP_072679.1| heat shock protein (dnaJ) [Mycoplas... 69 1e-10
gi|49092102|ref|XP_407512.1| hypothetical protein AN3375.2 [Aspe... 69 1e-10
gi|41152223|ref|NP_958499.1| DnaJ (Hsp40) homolog, subfamily A, ... 69 1e-10
gi|2984740|gb|AAC08023.1| heat shock protein [Campylobacter jejuni] 68 2e-10
gi|42564975|ref|NP_188410.2| DNAJ heat shock family protein [Ara... 68 2e-10
gi|31544538|ref|NP_853116.1| CbpA [Mycoplasma gallisepticum R] >... 68 2e-10
gi|4885495|ref|NP_005485.1| DnaJ (Hsp40) homolog, subfamily B, m... 68 2e-10
gi|47223894|emb|CAG06071.1| unnamed protein product [Tetraodon n... 68 2e-10
gi|24370470|emb|CAC70151.1| putative dnaJ protein [Brugia malayi] 68 2e-10
gi|7441928|pir||F71623 protein with DnaJ domain PFB0090c - malar... 68 2e-10
gi|17388799|ref|NP_490647.1| DnaJ (Hsp40) homolog, subfamily B, ... 68 2e-10
gi|50732259|ref|XP_418551.1| PREDICTED: similar to DnaJ (Hsp40) ... 68 2e-10
gi|27685061|ref|XP_217436.1| similar to DnaJ (Hsp40) homolog, su... 68 2e-10
gi|32395916|gb|AAP41818.1| P58IPK [Lycopersicon esculentum] 68 2e-10
gi|11277165|pir||T48660 heat shock protein dnaJ [validated] - Ca... 68 2e-10
gi|4322315|gb|AAD16010.1| DnaJ-like 2 protein [Homo sapiens] 68 2e-10
gi|41471290|gb|AAS07393.1| unknown [Homo sapiens] 68 2e-10
gi|50553969|ref|XP_504393.1| hypothetical protein [Yarrowia lipo... 68 2e-10
gi|49168458|emb|CAG38724.1| DNAJB1 [Homo sapiens] 68 2e-10
gi|5453690|ref|NP_006136.1| DnaJ (Hsp40) homolog, subfamily B, m... 68 2e-10
gi|30017349|ref|NP_835156.1| DnaJ (Hsp40) homolog, subfamily B, ... 68 2e-10
gi|41054271|ref|NP_956067.1| DnaJ (Hsp40) homolog, subfamily B, ... 68 2e-10
gi|50876854|emb|CAG36694.1| related to chaperone protein DnaJ [D... 68 2e-10
gi|50417181|gb|AAH77119.1| Unknown (protein for MGC:101068) [Dan... 68 2e-10
gi|47940223|gb|AAH72042.1| MGC78895 protein [Xenopus laevis] 68 2e-10
gi|9294487|dbj|BAB02706.1| DnaJ homolog [Arabidopsis thaliana] 68 2e-10
gi|22972332|ref|ZP_00019216.1| hypothetical protein [Chloroflexu... 68 2e-10
gi|45531751|ref|ZP_00182781.1| COG0484: DnaJ-class molecular cha... 68 2e-10
gi|1487966|emb|CAA64531.1| Tid56 protein [Drosophila melanogaste... 68 2e-10
gi|542596|pir||S42091 Tid(56) protein - fruit fly (Drosophila me... 68 2e-10
gi|15643612|ref|NP_228658.1| dnaJ protein [Thermotoga maritima M... 68 2e-10
gi|128503|sp|P26508|NOLC_RHIFR NolC protein >gnl|BL_ORD_ID|51078... 68 2e-10
gi|30583809|gb|AAP36153.1| Homo sapiens DnaJ (Hsp40) homolog, su... 68 2e-10
gi|45549272|ref|NP_524932.2| CG5504-PA [Drosophila melanogaster]... 68 2e-10
gi|17863042|gb|AAL39998.1| SD10289p [Drosophila melanogaster] 68 2e-10
gi|6016273|sp|P25686|DJB2_HUMAN DnaJ homolog subfamily B member ... 68 2e-10
gi|284069|pir||S23508 dnaJ protein homolog - human >gnl|BL_ORD_I... 68 2e-10
gi|15609510|ref|NP_216889.1| dnaJ2 [Mycobacterium tuberculosis H... 68 2e-10
gi|45552811|ref|NP_995931.1| CG5504-PC [Drosophila melanogaster]... 68 2e-10
gi|49093736|ref|XP_408329.1| hypothetical protein AN4192.2 [Aspe... 68 2e-10
gi|39995125|ref|NP_951076.1| phage prohead protease, HK97 family... 68 2e-10
gi|45531653|ref|ZP_00182689.1| COG2214: DnaJ-class molecular cha... 68 2e-10
gi|34904486|ref|NP_913590.1| putative heat shock protein 40 [Ory... 68 2e-10
gi|45552813|ref|NP_995932.1| CG5504-PB [Drosophila melanogaster]... 68 2e-10
gi|34924896|sp|Q27237|TID_DROME Tumorous imaginal discs protein,... 68 2e-10
gi|15029743|gb|AAH11090.1| Dnajb10 protein [Mus musculus] 68 2e-10
gi|26787996|emb|CAA44969.2| HSJ1a protien [Homo sapiens] >gnl|BL... 68 2e-10
gi|250082|gb|AAA09034.1| HSJ1a [Homo sapiens] 68 2e-10
gi|27151736|ref|NP_006727.2| DnaJ (Hsp40) homolog, subfamily B, ... 68 2e-10
gi|33863815|ref|NP_895375.1| DnaJ3 protein [Prochlorococcus mari... 67 3e-10
gi|23593332|ref|NP_473112.2| hypothetical protein [Plasmodium fa... 67 3e-10
gi|49475227|ref|YP_033268.1| heat shock protein DnaJ [Bartonella... 67 3e-10
gi|9055242|ref|NP_061278.1| DnaJ (Hsp40) homolog, subfamily B, m... 67 3e-10
gi|47122966|gb|AAH70632.1| MGC81459 protein [Xenopus laevis] 67 3e-10
gi|26399923|sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 >gnl|... 67 3e-10
gi|19113489|ref|NP_596697.1| dnaj related protein. [Schizosaccha... 67 3e-10
gi|7494396|pir||H71602 protein with DnaJ domain (RESA-like) PFB0... 67 3e-10
gi|23128544|ref|ZP_00110389.1| COG2214: DnaJ-class molecular cha... 67 3e-10
gi|48854237|ref|ZP_00308400.1| COG2214: DnaJ-class molecular cha... 67 4e-10
gi|2689720|gb|AAB91418.1| DnaJ homologue [Arabidopsis thaliana] 67 4e-10
gi|15240212|ref|NP_196308.1| DNAJ heat shock protein, putative (... 67 4e-10
gi|44889077|sp|Q9QYI8|DJB7_MOUSE DnaJ homolog subfamily B member... 67 4e-10
gi|34851465|ref|XP_341664.1| similar to heat shock protein 40 [R... 67 4e-10
gi|32398844|emb|CAD98554.1| heat shock protein DNAJ homologue pf... 67 4e-10
gi|20521712|dbj|BAA76806.2| KIAA0962 protein [Homo sapiens] 67 4e-10
gi|27377737|ref|NP_769266.1| chaperone protein [Bradyrhizobium j... 67 4e-10
gi|29346654|ref|NP_810157.1| chaperone protein dnaJ [Bacteroides... 67 4e-10
gi|50287405|ref|XP_446132.1| unnamed protein product [Candida gl... 67 4e-10
gi|50421801|ref|XP_459458.1| unnamed protein product [Debaryomyc... 67 4e-10
gi|1943502|pdb|1HDJ| Human Hsp40 (Hdj-1), Nmr 67 4e-10
gi|11496245|ref|NP_067292.1| DnaJ (Hsp40) homolog, subfamily B, ... 67 4e-10
gi|47569309|ref|ZP_00239993.1| dnaJ protein [Bacillus cereus G92... 67 4e-10
gi|28704053|gb|AAH47363.1| KIAA0962 protein [Homo sapiens] 67 4e-10
gi|46120263|ref|ZP_00179674.2| COG2214: DnaJ-class molecular cha... 67 5e-10
gi|32404842|ref|XP_323034.1| hypothetical protein ( (AL513467) r... 67 5e-10
gi|422811|pir||S34632 dnaJ protein homolog - human 67 5e-10
gi|41149466|ref|XP_370665.1| similar to DnaJ (Hsp40) homolog, su... 67 5e-10
gi|15894565|ref|NP_347914.1| Molecular chaperones DnaJ (HSP40 fa... 67 5e-10
gi|48895741|ref|ZP_00328725.1| COG2214: DnaJ-class molecular cha... 67 5e-10
gi|32403286|ref|XP_322256.1| hypothetical protein [Neurospora cr... 67 5e-10
gi|144832|gb|AAA23247.1| dnaJ 67 5e-10
gi|24817751|dbj|BAC23064.1| dnaJ [Mycobacterium sp. 'baby formul... 67 5e-10
gi|49089298|ref|XP_406375.1| hypothetical protein AN2238.2 [Aspe... 67 5e-10
>gi|25152100|ref|NP_741036.1| DNaJ domain (prokaryotic heat shock
protein) (dnj-20) [Caenorhabditis elegans]
gi|30580426|sp|Q8MPX3|DJ20_CAEEL DnaJ homolog dnj-20 precursor
gi|20803777|emb|CAD31695.1| Hypothetical protein T15H9.7
[Caenorhabditis elegans]
Length = 249
Score = 388 bits (996), Expect = e-107
Identities = 198/249 (79%), Positives = 198/249 (79%)
Frame = -1
Query: 750 MRILNXXXXXXXXXXXAFVECGRDFYKILGVXXXXXXXXXXXAYRKLAKELHPDRNQDDE 571
MRILN AFVECGRDFYKILGV AYRKLAKELHPDRNQDDE
Sbjct: 1 MRILNVSLLVLASSLVAFVECGRDFYKILGVAKNANANQIKKAYRKLAKELHPDRNQDDE 60
Query: 570 MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKMXXXXXXXXXXXXXXXXXXXXXXXX 391
MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKM
Sbjct: 61 MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKMGGGGGGGHDPFSSFFGDFFGGGGG 120
Query: 390 XXXXXGTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG 211
GTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG
Sbjct: 121 HGGEEGTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG 180
Query: 210 QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF 31
QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF
Sbjct: 181 QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF 240
Query: 30 KIRIQKHPR 4
KIRIQKHPR
Sbjct: 241 KIRIQKHPR 249
>gi|7507879|pir||T24938 hypothetical protein T15H9.1 -
Caenorhabditis elegans
Length = 355
Score = 388 bits (996), Expect = e-107
Identities = 198/249 (79%), Positives = 198/249 (79%)
Frame = -1
Query: 750 MRILNXXXXXXXXXXXAFVECGRDFYKILGVXXXXXXXXXXXAYRKLAKELHPDRNQDDE 571
MRILN AFVECGRDFYKILGV AYRKLAKELHPDRNQDDE
Sbjct: 1 MRILNVSLLVLASSLVAFVECGRDFYKILGVAKNANANQIKKAYRKLAKELHPDRNQDDE 60
Query: 570 MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKMXXXXXXXXXXXXXXXXXXXXXXXX 391
MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKM
Sbjct: 61 MANEKFQDLSSAYEVLSDKEKRAMYDRHGEEGVAKMGGGGGGGHDPFSSFFGDFFGGGGG 120
Query: 390 XXXXXGTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG 211
GTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG
Sbjct: 121 HGGEEGTPKGADVTIDLFVTLEEVYNGHFVEIKRKKAVYKQTSGTRQCNCRHEMRTEQMG 180
Query: 210 QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF 31
QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF
Sbjct: 181 QGRFQMFQVKVCDECPNVKLVQENKVLEVEVEVGADNGHQQIFHGEGEPHIEGDPGDLKF 240
Query: 30 KIRIQKHPR 4
KIRIQKHPR
Sbjct: 241 KIRIQKHPR 249