Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T24B8_5
(405 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536431|ref|NP_495934.1| ribosomal Protein, Large subunit (1... 217 5e-56
gi|39597564|emb|CAE59794.1| Hypothetical protein CBG03254 [Caeno... 211 2e-54
gi|2500374|sp|Q94460|RL32_DROAC 60S RIBOSOMAL PROTEIN L32 (RP49)... 139 2e-32
gi|24651273|ref|NP_733339.1| CG7939-PC [Drosophila melanogaster]... 138 3e-32
gi|17864106|ref|NP_524582.1| CG7939-PA [Drosophila melanogaster]... 138 3e-32
gi|49532900|dbj|BAD26685.1| Ribosomal protein L32 [Plutella xylo... 137 5e-32
gi|15213784|gb|AAK92167.1| ribosomal protein L32 [Spodoptera fru... 136 1e-31
gi|1173049|sp|P46615|RL32_DROPS 60S RIBOSOMAL PROTEIN L32 (RP49)... 136 1e-31
gi|132977|sp|P13930|RL32_DROSU 60S RIBOSOMAL PROTEIN L32 (RP49) ... 135 1e-31
gi|15293933|gb|AAK95159.1| ribosomal protein L32 [Ictalurus punc... 134 4e-31
gi|17933355|gb|AAL48255.1| ribosomal protein L32 [Epinephelus co... 134 4e-31
gi|47223156|emb|CAG11291.1| unnamed protein product [Tetraodon n... 133 7e-31
gi|50754636|ref|XP_414453.1| PREDICTED: similar to 60S ribosomal... 132 2e-30
gi|4506635|ref|NP_000985.1| ribosomal protein L32; 60S ribosomal... 131 3e-30
gi|18479061|gb|AAL73401.1| ribosomal protein 49 [Apis mellifera] 131 3e-30
gi|31241003|ref|XP_320915.1| ENSANGP00000017702 [Anopheles gambi... 131 3e-30
gi|28828904|gb|AAO51490.1| similar to 60S ribosomal protein L32 ... 129 1e-29
gi|28200284|gb|AAO31774.1| ribosomal protein L32 [Branchiostoma ... 128 3e-29
gi|27525292|emb|CAC82555.1| putative 60S ribosomal protein L32 [... 126 8e-29
gi|22758904|gb|AAN05611.1| ribosomal protein L32 [Argopecten irr... 125 2e-28
gi|37963503|gb|AAR05875.1| ribosomal protein L32 [Drosophila stu... 123 9e-28
gi|50254657|gb|EAL17404.1| hypothetical protein CNBM2080 [Crypto... 122 2e-27
gi|29119643|emb|CAD79337.1| ribosomal protein L32 [Crassostrea g... 122 2e-27
gi|5834553|emb|CAB55349.1| ribosomal protein 49 [Drosophila viri... 121 3e-27
gi|37963499|gb|AAR05873.1| ribosomal protein L32 [Drosophila suc... 121 4e-27
gi|49068502|ref|XP_398540.1| hypothetical protein UM00925.1 [Ust... 120 6e-27
gi|29647485|dbj|BAC75414.1| putative ribosomal protein L32 [Oryz... 120 8e-27
gi|37963501|gb|AAR05874.1| ribosomal protein L32 [Drosophila sal... 119 1e-26
gi|32403874|ref|XP_322550.1| hypothetical protein [Neurospora cr... 119 1e-26
gi|20873269|ref|XP_143323.1| similar to 60S RIBOSOMAL PROTEIN L3... 117 7e-26
gi|15236757|ref|NP_193544.1| 60S ribosomal protein L32 (RPL32A) ... 116 9e-26
gi|21555143|gb|AAM63787.1| ribosomal protein L32-like protein [A... 116 9e-26
gi|27707010|ref|XP_213183.1| similar to 60S ribosomal protein L3... 116 9e-26
gi|46116590|ref|XP_384313.1| hypothetical protein FG04137.1 [Gib... 115 1e-25
gi|40287540|gb|AAR83884.1| ly200 protein [Capsicum annuum] 115 3e-25
gi|38106221|gb|EAA52556.1| hypothetical protein MG05248.4 [Magna... 114 3e-25
gi|13877126|gb|AAK43709.1| ribosomal protein L32 [Mercurialis an... 114 4e-25
gi|1841306|dbj|BAA19212.1| ribosomal protein L32 homolog [Schizo... 114 4e-25
gi|19115094|ref|NP_594182.1| 60s ribosomal protein L32 [Schizosa... 114 4e-25
gi|32401001|gb|AAP80706.1| ribosome protein L32 [Griffithsia jap... 114 6e-25
gi|15237436|ref|NP_199455.1| 60S ribosomal protein L32 (RPL32B) ... 113 7e-25
gi|37963497|gb|AAR05872.1| ribosomal protein L32 [Drosophila cap... 113 1e-24
gi|37963495|gb|AAR05871.1| ribosomal protein L32 [Drosophila neb... 112 1e-24
gi|6118520|gb|AAF04131.1| ribosomal protein L32 [Ovis aries] 112 1e-24
gi|19113601|ref|NP_596809.1| 60S ribosomal protein L32 [Schizosa... 112 2e-24
gi|50424629|ref|XP_460904.1| unnamed protein product [Debaryomyc... 112 2e-24
gi|37963493|gb|AAR05870.1| ribosomal protein L32 [Drosophila wil... 111 3e-24
gi|34869999|ref|XP_345558.1| similar to 60S ribosomal protein L3... 111 4e-24
gi|23485472|gb|EAA20441.1| Ribosomal protein L32 [Plasmodium yoe... 111 4e-24
gi|32398910|emb|CAD98375.1| ribosomal protein L32, probable [Cry... 110 5e-24
gi|20983842|ref|XP_141727.1| similar to 60S ribosomal protein L3... 110 5e-24
gi|23613560|ref|NP_704581.1| ribosomal protein L32, putative [Pl... 110 6e-24
gi|45200816|ref|NP_986386.1| AGL281Cp [Eremothecium gossypii] >g... 110 6e-24
gi|27719901|ref|XP_236007.1| similar to 60S ribosomal protein L3... 110 8e-24
gi|50289123|ref|XP_446991.1| unnamed protein product [Candida gl... 109 1e-23
gi|6319378|ref|NP_009460.1| Protein component of the large (60S)... 108 2e-23
gi|49107096|ref|XP_411491.1| hypothetical protein AN7354.2 [Aspe... 108 2e-23
gi|41210574|ref|XP_373343.1| similar to 60S ribosomal protein L3... 107 4e-23
gi|44885906|dbj|BAD12054.1| ribosomal protein 49 [Lucilia sericata] 106 9e-23
gi|8928332|sp|O94008|RL32_CANAL 60S ribosomal protein L32 >gnl|B... 106 9e-23
gi|7530119|emb|CAB86700.1| ribosomal protein 49 (L32) [Leishmani... 105 2e-22
gi|50308509|ref|XP_454257.1| unnamed protein product [Kluyveromy... 103 1e-21
gi|50554395|ref|XP_504606.1| hypothetical protein [Yarrowia lipo... 102 2e-21
gi|29249735|gb|EAA41241.1| GLP_28_64726_64316 [Giardia lamblia A... 101 3e-21
gi|19074209|ref|NP_584815.1| 60S RIBOSOMAL PROTEIN L32 [Encephal... 100 7e-21
gi|2275294|gb|AAB63872.1| 60S ribosomal protein L32 homolog [Sch... 99 2e-20
gi|71339|pir||R5FF49 ribosomal protein L32 - fruit fly (Drosophi... 97 9e-20
gi|8478|emb|CAA25404.1| ribosomal protein 49 [Drosophila melanog... 96 1e-19
gi|7576919|gb|AAF64051.1| 60S ribosomal protein L32 [Leishmania ... 96 2e-19
gi|20126675|dbj|BAB88879.1| ribosomal protein L32 [Sarcophaga cr... 91 5e-18
gi|34858341|ref|XP_342742.1| similar to 60S ribosomal protein L3... 87 6e-17
gi|9967442|dbj|BAB12413.1| ribosomal protein 49 [Bombyx mori] 87 6e-17
gi|41148558|ref|XP_373245.1| similar to 60S ribosomal protein L3... 87 7e-17
gi|38080910|ref|XP_358851.1| similar to 60S ribosomal protein L3... 87 7e-17
gi|38080597|ref|XP_357506.1| similar to 60S ribosomal protein L3... 78 5e-14
gi|34865528|ref|XP_345964.1| similar to 60S ribosomal protein L3... 77 1e-13
gi|20824378|ref|XP_129492.1| similar to 60S ribosomal protein L3... 77 1e-13
gi|13812077|ref|NP_113214.1| 60S ribosomal protein L32 [Guillard... 76 2e-13
gi|42661208|ref|XP_372677.2| similar to DEAH (Asp-Glu-Ala-His) b... 74 9e-13
gi|38076460|ref|XP_139098.2| similar to 60S ribosomal protein L3... 72 3e-12
gi|34854230|ref|XP_226768.2| similar to membrane-spanning proteo... 69 3e-11
gi|14520540|ref|NP_126015.1| LSU ribosomal protein L32E [Pyrococ... 66 1e-10
gi|18978179|ref|NP_579536.1| LSU ribosomal protein L32E [Pyrococ... 66 1e-10
gi|14591517|ref|NP_143598.1| 50S ribosomal protein L32 [Pyrococc... 66 1e-10
gi|464633|sp|P34040|RL32_TRIHA 60S ribosomal protein L32 64 7e-10
gi|20094661|ref|NP_614508.1| Ribosomal protein L32E [Methanopyru... 64 9e-10
gi|42658006|ref|XP_377997.1| similar to 60S ribosomal protein L3... 62 3e-09
gi|15678051|ref|NP_275165.1| ribosomal protein L32 [Methanotherm... 62 3e-09
gi|34855430|ref|XP_218353.2| similar to 60S ribosomal protein L3... 60 1e-08
gi|3914750|sp|O05638|RL32_SULAC 50S ribosomal protein L32E >gnl|... 59 3e-08
gi|13541173|ref|NP_110861.1| 50S ribosomal protein L32E [Thermop... 56 1e-07
gi|15897607|ref|NP_342212.1| LSU ribosomal protein L32E (rpl32E)... 55 2e-07
gi|15920625|ref|NP_376294.1| 131aa long hypothetical 50S ribosom... 55 3e-07
gi|16082256|ref|NP_394710.1| 50S ribosomal protein L32 related p... 54 7e-07
gi|41718240|ref|ZP_00147297.1| COG1717: Ribosomal protein L32E [... 54 7e-07
gi|41615313|ref|NP_963811.1| NEQ530 [Nanoarchaeum equitans Kin4-... 54 9e-07
gi|15668649|ref|NP_247448.1| LSU ribosomal protein L32E [Methano... 53 1e-06
gi|21228243|ref|NP_634165.1| LSU ribosomal protein L32E [Methano... 51 6e-06
gi|48838700|ref|ZP_00295640.1| COG1717: Ribosomal protein L32E [... 50 1e-05
gi|20089959|ref|NP_616034.1| ribosomal protein L32e [Methanosarc... 50 1e-05
gi|479612|pir||S34860 ribosomal protein L32.e, cytosolic - fungu... 47 7e-05
gi|11499492|ref|NP_070733.1| LSU ribosomal protein L32E (rpl32E)... 45 2e-04
gi|132888|sp|P14549|RL32_METVA PROBABLE 50S RIBOSOMAL PROTEIN L3... 45 4e-04
gi|48477729|ref|YP_023435.1| large subunit ribosomal protein L32... 44 6e-04
gi|14600653|ref|NP_147170.1| 50S ribosomal protein L32 [Aeropyru... 44 7e-04
gi|18313096|ref|NP_559763.1| ribosomal protein L32 [Pyrobaculum ... 44 7e-04
gi|3885519|gb|AAC77930.1| similar to ribosomal protein L32 [Medi... 44 0.001
gi|48852509|ref|ZP_00306695.1| COG1717: Ribosomal protein L32E [... 42 0.004
gi|1710539|sp|P51421|RL32_MAIZE 60S RIBOSOMAL PROTEIN L32 >gnl|B... 42 0.004
gi|132885|sp|P12736|RL32_HALMA 50S ribosomal protein L32E (Hl5) ... 40 0.014
gi|10120941|pdb|1FFK|V Chain V, Crystal Structure Of The Large R... 40 0.014
gi|15825966|pdb|1JJ2|X Chain X, Fully Refined Crystal Structure ... 40 0.014
gi|45358979|ref|NP_988536.1| LSU ribosomal protein L32E [Methano... 39 0.018
gi|41222693|ref|XP_373312.1| similar to 60S ribosomal protein L3... 34 0.75
gi|15790649|ref|NP_280473.1| 50S ribosomal protein L32E; Rpl32e ... 34 0.75
gi|15899047|ref|NP_343652.1| Cysteinyl-tRNA synthetase (cysS) [S... 33 0.98
gi|24651385|ref|NP_651794.1| CG15538-PA [Drosophila melanogaster... 33 1.3
gi|27467210|ref|NP_763847.1| cysteinyl-tRNA synthetase [Staphylo... 32 2.2
gi|23469177|ref|ZP_00124512.1| COG0215: Cysteinyl-tRNA synthetas... 32 2.2
gi|24650530|ref|NP_651538.1| CG6066-PA [Drosophila melanogaster]... 32 2.2
gi|47939900|gb|AAH71219.1| Tle2 protein [Mus musculus] 32 2.2
gi|42522787|ref|NP_968167.1| conserved hypothetical protein [Bde... 32 2.2
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 32 2.8
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 32 2.8
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 32 2.8
gi|4768988|gb|AAD29707.1| 60S ribosomal protein [Oryza sativa] 32 2.8
gi|16198129|gb|AAL13867.1| LD33732p [Drosophila melanogaster] 32 2.8
gi|48374960|gb|AAT42158.1| hypothetical protein SB20O07.12 [Sorg... 32 3.7
gi|48096781|ref|XP_394771.1| similar to insulin receptor precurs... 32 3.7
gi|2500965|sp|P77986|SYC_STAXY Cysteinyl-tRNA synthetase (Cystei... 32 3.7
gi|49075002|ref|XP_401595.1| hypothetical protein UM03980.1 [Ust... 32 3.7
gi|28316933|gb|AAO39488.1| SD13756p [Drosophila melanogaster] 32 3.7
gi|25386235|pir||G86186 hypothetical protein [imported] - Arabid... 31 4.9
gi|15220448|ref|NP_172015.1| homeobox-leucine zipper family prot... 31 4.9
gi|48890303|ref|ZP_00324037.1| hypothetical protein Tery02006526... 31 6.3
gi|34856462|ref|XP_342454.1| similar to cDNA sequence BC003993 [... 31 6.3
gi|49388351|dbj|BAD25461.1| putative zinc finger and C2 domain p... 31 6.3
gi|26989624|ref|NP_745049.1| cysteinyl-tRNA synthetase [Pseudomo... 30 8.3
gi|48729809|ref|ZP_00263558.1| COG0215: Cysteinyl-tRNA synthetas... 30 8.3
gi|28870897|ref|NP_793516.1| cysteinyl-tRNA synthetase [Pseudomo... 30 8.3
gi|32404446|ref|XP_322836.1| hypothetical protein [Neurospora cr... 30 8.3
>gi|17536431|ref|NP_495934.1| ribosomal Protein, Large subunit (15.5
kD) (rpl-32) [Caenorhabditis elegans]
gi|7508357|pir||T25221 hypothetical protein T24B8.1 -
Caenorhabditis elegans
gi|3880149|emb|CAA92757.1| Hypothetical protein T24B8.1
[Caenorhabditis elegans]
Length = 134
Score = 217 bits (552), Expect = 5e-56
Identities = 113/134 (84%), Positives = 113/134 (84%)
Frame = -1
Query: 405 MVHVSGTXXXXXXXXXXXXKRHESDRYRRVAPSWRKPKGIDNXXXXXXXXXRAMPTIGHG 226
MVHVSGT KRHESDRYRRVAPSWRKPKGIDN RAMPTIGHG
Sbjct: 1 MVHVSGTKVKVVKKKLTKFKRHESDRYRRVAPSWRKPKGIDNRVRRRFRGMRAMPTIGHG 60
Query: 225 SDRRTRFVLPNGYKKVLVQNVKDLDMLLMQSYKYIGEIGHGVSAKSRKGIVERAAQLNIK 46
SDRRTRFVLPNGYKKVLVQNVKDLDMLLMQSYKYIGEIGHGVSAKSRKGIVERAAQLNIK
Sbjct: 61 SDRRTRFVLPNGYKKVLVQNVKDLDMLLMQSYKYIGEIGHGVSAKSRKGIVERAAQLNIK 120
Query: 45 LTNGNARLRTEESE 4
LTNGNARLRTEESE
Sbjct: 121 LTNGNARLRTEESE 134