Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T24H10_1
(912 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532615|ref|NP_495940.1| voltage gated CLC-type chloride cha... 580 e-164
gi|6467501|gb|AAF13167.1| CLC chloride channel protein [Caenorha... 580 e-164
gi|39597570|emb|CAE59800.1| Hypothetical protein CBG03262 [Caeno... 556 e-157
gi|7511576|pir||T19065 probable protein kinase C-regulated chlor... 457 e-127
gi|48101397|ref|XP_392670.1| similar to ENSANGP00000024063 [Apis... 278 1e-73
gi|31213995|ref|XP_315792.1| ENSANGP00000018663 [Anopheles gambi... 269 6e-71
gi|31214001|ref|XP_315793.1| ENSANGP00000024063 [Anopheles gambi... 265 1e-69
gi|45551566|ref|NP_730105.2| CG5284-PA [Drosophila melanogaster]... 257 3e-67
gi|24665008|ref|NP_648834.1| CG5284-PB [Drosophila melanogaster]... 257 3e-67
gi|21744243|gb|AAM76180.1| LD07266p [Drosophila melanogaster] 257 3e-67
gi|34878057|ref|XP_341429.1| chloride channel 3 [Rattus norvegicus] 249 8e-65
gi|2599550|gb|AAB95162.1| chloride channel protein 3 [Mus muscul... 249 8e-65
gi|4762023|gb|AAD29440.1| chloride channel protein 3 long form [... 249 8e-65
gi|22023506|gb|AAM89117.1| chloride channel isoform e [Mus muscu... 249 8e-65
gi|2599548|gb|AAB95161.1| chloride channel protein 3 [Homo sapie... 246 4e-64
gi|4502869|ref|NP_001820.1| chloride channel 3; ClC-3 [Homo sapi... 246 4e-64
gi|34783726|gb|AAH57133.1| Chloride channel 3, isoform c [Mus mu... 244 1e-63
gi|50745842|ref|XP_420265.1| PREDICTED: similar to chloride chan... 244 2e-63
gi|50746198|ref|XP_420400.1| PREDICTED: similar to chloride chan... 244 3e-63
gi|22023507|gb|AAM89118.1| chloride channel isoform f [Mus muscu... 243 4e-63
gi|41281837|ref|NP_776301.1| chloride channel 3 isoform c [Mus m... 243 4e-63
gi|1705903|sp|P51790|CLC3_HUMAN Chloride channel protein 3 (ClC-... 240 3e-62
gi|47210785|emb|CAF91095.1| unnamed protein product [Tetraodon n... 240 3e-62
gi|6680948|ref|NP_031737.1| chloride channel 3 isoform a [Mus mu... 240 3e-62
gi|38502833|sp|O18894|CLC3_RABIT Chloride channel protein 3 (ClC-3) 240 3e-62
gi|1705905|sp|P51792|CLC3_RAT Chloride channel protein 3 (ClC-3)... 240 3e-62
gi|8134363|sp|Q9R279|CLC3_CAVPO Chloride channel protein 3 (ClC-... 240 3e-62
gi|4753144|gb|AAB88634.2| volume-regulated outwardly-rectifying ... 240 3e-62
gi|34785552|gb|AAH57855.1| Clcn3 protein [Mus musculus] 240 3e-62
gi|41281846|ref|NP_776297.1| chloride channel 3 isoform e; ClC-3... 240 3e-62
gi|22023505|gb|AAM89116.1| chloride channel isoform d [Mus muscu... 240 3e-62
gi|5923861|gb|AAD56388.1| chloride channel CLC-3 [Oreochromis mo... 239 8e-62
gi|6634696|emb|CAA71072.2| putative chloride channel ClC-3 [Xeno... 238 1e-61
gi|5923863|gb|AAD56389.1| chloride channel CLC-5 [Oreochromis mo... 237 3e-61
gi|20141247|sp|P51793|CLC4_HUMAN Chloride channel protein 4 (ClC... 236 4e-61
gi|11559970|ref|NP_071534.1| putative chloride channel (similar ... 236 4e-61
gi|13542693|gb|AAH05553.1| Clcn4-2 protein [Mus musculus] 235 9e-61
gi|1587069|prf||2205339A Cl channel 235 9e-61
gi|50730316|ref|XP_425575.1| PREDICTED: similar to Chloride chan... 235 9e-61
gi|3182962|sp|Q61418|CLC4_MOUSE Chloride channel protein 4 (ClC-... 235 9e-61
gi|31981502|ref|NP_035464.2| chloride channel 4-2 [Mus musculus]... 235 9e-61
gi|4502871|ref|NP_001821.1| chloride channel 4 [Homo sapiens] >g... 234 2e-60
gi|47523078|ref|NP_999304.1| outwardly rectifying chloride chann... 233 3e-60
gi|6224928|gb|AAF06018.1| chloride channel CLC-5 [Oryctolagus cu... 233 3e-60
gi|12240255|gb|AAG49590.1| chloride channel CLCN5 [Cavia porcellus] 233 3e-60
gi|4557473|ref|NP_000075.1| chloride channel 5 [Homo sapiens] >g... 233 6e-60
gi|2155011|emb|CAA71071.1| chloride channel ClC-5 [Xenopus laevis] 231 2e-59
gi|4580765|gb|AAD24497.1| chloride channel ClC-5 [Xenopus laevis] 231 2e-59
gi|8393141|ref|NP_058802.1| chloride channel 5 [Rattus norvegicu... 231 2e-59
gi|1705909|sp|P51796|CLC5_RAT Chloride channel protein 5 (ClC-5)... 231 2e-59
gi|26343153|dbj|BAC35233.1| unnamed protein product [Mus musculus] 230 3e-59
gi|13124106|sp|Q9WVD4|CLC5_MOUSE Chloride channel protein 5 (ClC... 230 3e-59
gi|31980678|ref|NP_057900.2| chloride channel 5 [Mus musculus] >... 230 4e-59
gi|36938566|gb|AAQ86831.1| chloride channel [Ixodes scapularis] 214 2e-54
gi|47214384|emb|CAG00865.1| unnamed protein product [Tetraodon n... 211 1e-53
gi|47212813|emb|CAF94486.1| unnamed protein product [Tetraodon n... 211 2e-53
gi|29893086|dbj|BAC75635.1| CLC chloride channel [Ascidia sydnei... 204 3e-51
gi|4928468|gb|AAD33600.1| chloride channel Clc-5 [Cavia porcellus] 199 5e-50
gi|32411997|ref|XP_326479.1| hypothetical protein [Neurospora cr... 164 3e-39
gi|38106704|gb|EAA52976.1| hypothetical protein MG06104.4 [Magna... 163 6e-39
gi|38085734|ref|XP_357692.1| similar to Clcn4-2 protein [Mus mus... 162 1e-38
gi|50543090|ref|XP_499711.1| hypothetical protein [Yarrowia lipo... 148 1e-34
gi|46121851|ref|XP_385479.1| hypothetical protein FG05303.1 [Gib... 145 2e-33
gi|32411637|ref|XP_326299.1| hypothetical protein [Neurospora cr... 136 6e-31
gi|50255408|gb|EAL18143.1| hypothetical protein CNBK1640 [Crypto... 136 7e-31
gi|46122147|ref|XP_385627.1| hypothetical protein FG05451.1 [Gib... 136 7e-31
gi|29374036|gb|AAO73005.1| voltage-gated chloride channel [Crypt... 135 2e-30
gi|50768606|ref|XP_427006.1| PREDICTED: similar to Chloride chan... 131 2e-29
gi|50424555|ref|XP_460866.1| unnamed protein product [Debaryomyc... 130 4e-29
gi|49089480|ref|XP_406445.1| hypothetical protein AN2308.2 [Aspe... 129 7e-29
gi|38101911|gb|EAA48810.1| hypothetical protein MG00468.4 [Magna... 124 2e-27
gi|50552612|ref|XP_503716.1| hypothetical protein [Yarrowia lipo... 119 9e-26
gi|49097568|ref|XP_410244.1| hypothetical protein AN6107.2 [Aspe... 118 2e-25
gi|29825714|gb|AAO91914.1| CLC channel [Emericella nidulans] 118 2e-25
gi|46444957|gb|EAL04228.1| hypothetical protein CaO19.13301 [Can... 116 8e-25
gi|49073854|ref|XP_401105.1| hypothetical protein UM03490.1 [Ust... 109 7e-23
gi|33392722|gb|AAH54877.1| CLCN3 protein [Homo sapiens] 104 3e-21
gi|11466110|ref|NP_047043.1| CCP; L2602.3 [Leishmania major] >gn... 103 5e-21
gi|46122355|ref|XP_385731.1| hypothetical protein FG05555.1 [Gib... 102 1e-20
gi|19112959|ref|NP_596167.1| chloride channel [Schizosaccharomyc... 100 8e-20
gi|45199257|ref|NP_986286.1| AFR738Cp [Eremothecium gossypii] >g... 98 2e-19
gi|50549131|ref|XP_502036.1| hypothetical protein [Yarrowia lipo... 94 3e-18
gi|50257756|gb|EAL20457.1| hypothetical protein CNBE3780 [Crypto... 92 1e-17
gi|49074760|ref|XP_401491.1| hypothetical protein UM03876.1 [Ust... 91 4e-17
gi|32403188|ref|XP_322207.1| hypothetical protein [Neurospora cr... 91 5e-17
gi|38104469|gb|EAA51030.1| hypothetical protein MG04789.4 [Magna... 81 4e-14
gi|46434910|gb|EAK94306.1| hypothetical protein CaO19.3734 [Cand... 80 6e-14
gi|46434951|gb|EAK94344.1| hypothetical protein CaO19.11219 [Can... 80 6e-14
gi|50423419|ref|XP_460292.1| unnamed protein product [Debaryomyc... 78 3e-13
gi|46117512|ref|XP_384774.1| hypothetical protein FG04598.1 [Gib... 69 1e-10
gi|45190536|ref|NP_984790.1| AEL071Cp [Eremothecium gossypii] >g... 67 7e-10
gi|50405889|ref|XP_456585.1| unnamed protein product [Debaryomyc... 66 9e-10
gi|50309911|ref|XP_454969.1| unnamed protein product [Kluyveromy... 66 1e-09
gi|47939636|gb|AAH72004.1| CLCN2 protein [Homo sapiens] 65 2e-09
gi|5597006|ref|NP_004357.2| chloride channel 2; ClC-2; Epilepsy,... 65 2e-09
gi|2570864|gb|AAB88807.1| chloride channel protein [Homo sapiens] 65 2e-09
gi|47210718|emb|CAF92945.1| unnamed protein product [Tetraodon n... 65 3e-09
gi|12643327|sp|Q9WU45|CLC2_CAVPO Chloride channel protein 2 (ClC... 65 3e-09
gi|5001718|gb|AAD37114.1| chloride channel protein [Cavia porcel... 65 3e-09
gi|46433448|gb|EAK92888.1| hypothetical protein CaO19.8698 [Cand... 64 4e-09
gi|2136954|pir||S68210 chloride channel protein 2-beta - rabbit ... 64 5e-09
gi|1585164|prf||2124309A Cl channel 64 5e-09
gi|1705902|sp|P51789|CLC2_RABIT Chloride channel protein 2 (ClC-... 64 5e-09
gi|2873367|gb|AAC06343.1| chloride channel 2 [Rattus norvegicus] 64 6e-09
gi|8393138|ref|NP_058833.1| chloride channel 2 [Rattus norvegicu... 64 6e-09
gi|228578|prf||1806385A voltage-gated Cl channel ClC 2 64 6e-09
gi|2873368|gb|AAC06344.1| chloride channel 2 [Rattus norvegicus] 64 6e-09
gi|47224813|emb|CAG06383.1| unnamed protein product [Tetraodon n... 64 6e-09
gi|2873369|gb|AAC06345.1| chloride channel 2 [Rattus norvegicus] 64 6e-09
gi|4589362|gb|AAD26466.1| voltage-regulated and volume-regulated... 62 2e-08
gi|20892061|ref|XP_147240.1| chloride channel 2 [Mus musculus] 62 2e-08
gi|6753432|ref|NP_034030.1| chloride channel 2 [Mus musculus] >g... 62 2e-08
gi|544380|sp|P37020|GEF1_YEAST GEF1 protein (Voltage-gated chlor... 60 9e-08
gi|50289785|ref|XP_447324.1| unnamed protein product [Candida gl... 60 9e-08
gi|6322500|ref|NP_012574.1| Chloride channel localized to late- ... 59 2e-07
gi|50770679|ref|XP_427086.1| PREDICTED: similar to Chloride chan... 57 7e-07
gi|28573073|ref|NP_731634.2| CG31116-PC [Drosophila melanogaster... 57 7e-07
gi|33589350|gb|AAQ22442.1| RE62514p [Drosophila melanogaster] 57 7e-07
gi|28573075|ref|NP_788639.1| CG31116-PD [Drosophila melanogaster... 57 7e-07
gi|28573071|ref|NP_731635.2| CG31116-PA [Drosophila melanogaster... 57 7e-07
gi|32563740|ref|NP_496429.3| voltage gated CLC-type chloride cha... 56 1e-06
gi|39597463|emb|CAE59693.1| Hypothetical protein CBG03117 [Caeno... 56 1e-06
gi|17531373|ref|NP_496428.1| voltage gated CLC-type chloride cha... 56 1e-06
gi|14530317|emb|CAC42250.1| Hypothetical protein B0491.8b [Caeno... 56 1e-06
gi|21428948|gb|AAM50193.1| GH23529p [Drosophila melanogaster] 55 2e-06
gi|48098168|ref|XP_392015.1| similar to CG31116-PC [Apis mellifera] 55 2e-06
gi|1621605|gb|AAC48666.1| skeletal muscle voltage-gated chloride... 55 2e-06
gi|116414|sp|P21564|CICH_TORMA Chloride channel protein >gnl|BL_... 55 2e-06
gi|227369|prf||1702364A Cl channel 55 2e-06
gi|39582326|emb|CAE67575.1| Hypothetical protein CBG13104 [Caeno... 55 3e-06
gi|3399663|gb|AAC83175.1| Chloride Channel protein 4 [Homo sapiens] 54 4e-06
gi|39597294|emb|CAE59522.1| Hypothetical protein CBG02916 [Caeno... 54 4e-06
gi|31206139|ref|XP_312021.1| ENSANGP00000018612 [Anopheles gambi... 54 4e-06
gi|7508575|pir||T25358 hypothetical protein T27D12.2 - Caenorhab... 54 6e-06
gi|14530585|emb|CAA93879.2| C. elegans CLH-1 protein (correspond... 54 6e-06
gi|544028|sp|P35522|CICH_TORCA Chloride channel protein (ClC-0) ... 54 6e-06
gi|6467493|gb|AAF13163.1| CLC chloride channel protein [Caenorha... 54 6e-06
gi|25147789|ref|NP_741052.1| voltage gated CLC-type chloride cha... 54 6e-06
gi|17536549|ref|NP_496531.1| voltage gated CLC-type chloride cha... 54 6e-06
gi|17559050|ref|NP_506022.1| voltage gated CLC-type chloride cha... 53 8e-06
gi|7498377|pir||T15915 hypothetical protein E04F6.11 - Caenorhab... 53 8e-06
gi|7506396|pir||T24009 hypothetical protein R07B7.1 - Caenorhabd... 53 8e-06
gi|32563745|ref|NP_495506.3| voltage gated CLC-type chloride cha... 53 8e-06
gi|32563743|ref|NP_495507.3| voltage gated CLC-type chloride cha... 53 8e-06
gi|49097976|ref|XP_410448.1| hypothetical protein AN6311.2 [Aspe... 52 1e-05
gi|47221590|emb|CAF97855.1| unnamed protein product [Tetraodon n... 52 1e-05
gi|6467499|gb|AAF13166.1| CLC chloride channel protein [Caenorha... 52 2e-05
gi|32566096|ref|NP_508695.3| voltage gated CLC-type chloride cha... 52 2e-05
gi|7489227|pir||T07608 chloride channel protein homolog CLC1 - p... 52 2e-05
gi|32566094|ref|NP_508696.3| voltage gated CLC-type chloride cha... 52 2e-05
gi|7507320|pir||T16821 hypothetical protein T06F4.2 - Caenorhabd... 52 2e-05
gi|15011794|gb|AAK77627.1| Clc-type chloride channel protein 4,... 52 2e-05
gi|15011795|gb|AAK77628.1| Clc-type chloride channel protein 4,... 52 2e-05
gi|19113268|ref|NP_596476.1| putative chloride channel protein [... 52 2e-05
gi|30840141|gb|AAM77486.1| chloride channel isoform 2 [Rattus no... 51 3e-05
gi|4502867|ref|NP_000074.1| chloride channel 1, skeletal muscle ... 51 3e-05
gi|29789048|ref|NP_038519.1| chloride channel 1; arrested develo... 51 3e-05
gi|6978663|ref|NP_037279.1| chloride channel 1; Chloride channel... 51 3e-05
gi|30840143|gb|AAM77487.1| chloride channel isoform 3 [Rattus no... 51 3e-05
gi|30840145|gb|AAM77488.1| chloride channel isoform 4 [Rattus no... 51 3e-05
gi|50729474|ref|XP_425521.1| PREDICTED: similar to skeletal musc... 51 3e-05
gi|30840147|gb|AAM77489.1| chloride channel isoform 5 [Rattus no... 51 3e-05
gi|21913557|gb|AAL05908.1| chloride channel 1 isoform [Mus muscu... 51 3e-05
gi|21913555|gb|AAL05907.1| chloride channel 1 [Mus musculus] 51 3e-05
gi|30840139|gb|AAM77485.1| chloride channel isoform 1 [Rattus no... 51 3e-05
gi|4768916|gb|AAD29679.1| CLC-Nt2 protein [Nicotiana tabacum] 50 5e-05
gi|13124069|sp|Q64347|CLC1_MOUSE Chloride channel protein, skele... 50 5e-05
gi|39592158|emb|CAE75378.1| Hypothetical protein CBG23365 [Caeno... 50 7e-05
gi|39597825|emb|CAE68517.1| Hypothetical protein CBG14338 [Caeno... 50 7e-05
gi|7489108|pir||T02939 chloride channel protein ClC-1 - common t... 50 7e-05
gi|9058659|gb|AAF82606.1| skeletal muscle chloride channel ClC-1... 50 9e-05
gi|21321022|dbj|BAB97267.1| chloride channel [Oryza sativa (japo... 49 1e-04
gi|1619956|gb|AAB17007.1| voltage-gated chloride channel [Arabid... 49 1e-04
gi|1742953|emb|CAA96057.1| CLC-a chloride channel protein [Arabi... 49 1e-04
gi|15237514|ref|NP_198905.1| chloride channel protein (CLC-a) [A... 49 1e-04
gi|16604693|gb|AAL24139.1| putative anion channel protein [Arabi... 49 1e-04
gi|34907322|ref|NP_915008.1| putative chloride channel protein [... 49 2e-04
gi|15232105|ref|NP_189353.1| chloride channel protein (CLC-b) [A... 48 3e-04
gi|15240576|ref|NP_199800.1| chloride channel protein (CLC-c) [A... 48 3e-04
gi|5531486|emb|CAB51058.1| chloride channel [Xenopus laevis] 47 5e-04
gi|1705860|sp|P51804|CICL_RABIT Chloride channel protein CLC-K2 ... 47 5e-04
gi|1705858|sp|P51803|CICK_RABIT Chloride channel protein CLC-K1 ... 47 5e-04
gi|423800|pir||A45483 chloride channel, CLC-K1 - rat 46 0.001
gi|2143659|pir||A57713 chloride channel ClC-K1 - rat >gnl|BL_ORD... 46 0.001
gi|50759433|ref|XP_417644.1| PREDICTED: similar to Chloride chan... 46 0.001
gi|16758030|ref|NP_445779.1| chloride channel K1 [Rattus norvegi... 46 0.001
gi|34015349|gb|AAQ56538.1| putative chloride channel [Oryza sati... 46 0.001
gi|27552547|gb|AAO19370.1| putative CLC-d chloride channel prote... 46 0.001
gi|28828126|gb|AAO50809.1| similar to Dictyostelium discoideum (... 45 0.002
gi|45774104|emb|CAD86774.1| chloride channel type CLC [Entamoeba... 45 0.002
gi|38344896|emb|CAD41919.2| OSJNBa0033G05.20 [Oryza sativa (japo... 45 0.002
gi|31981386|ref|NP_077723.2| chloride channel Ka; chloride chann... 45 0.002
gi|34733332|gb|AAQ81628.1| chloride channel CLCK1 [Mus musculus] 45 0.002
gi|4455115|gb|AAD21083.1| putative basolateral cTAL chloride cha... 45 0.002
gi|46390910|dbj|BAD16425.1| chloride channel [Oryza sativa (japo... 45 0.003
gi|48374433|gb|AAP04392.2| chloride channel [Zea mays] 45 0.003
gi|21321026|dbj|BAB97269.1| chloride channel [Oryza sativa (japo... 45 0.003
gi|21321024|dbj|BAB97268.1| chloride channel [Oryza sativa (japo... 45 0.003
gi|6753434|ref|NP_036059.1| chloride channel 6 [Mus musculus] >g... 44 0.004
gi|38503250|sp|Q9TT16|CLC6_RABIT Chloride channel protein 6 (ClC... 44 0.004
gi|4502873|ref|NP_001277.1| chloride channel 6 isoform ClC-6a [H... 44 0.004
gi|1770376|emb|CAA67836.1| chloride channel [Homo sapiens] 44 0.004
gi|42733862|gb|AAS38780.1| similar to chloride channel [Caenorha... 44 0.004
gi|12025671|ref|NP_068504.1| chloride channel 6 isoform ClC-6c [... 44 0.004
gi|34872458|ref|XP_227870.2| similar to putative chloride channe... 44 0.004
gi|3171891|emb|CAA15953.1| dJ934G17.1.3 (variant 3) [Homo sapiens] 44 0.004
gi|3171889|emb|CAA15951.1| dJ934G17.1.1 (chloride chanel protein... 44 0.004
gi|40789076|dbj|BAA05836.4| KIAA0046 [Homo sapiens] 44 0.004
gi|18043439|gb|AAH19983.1| Clcnkb protein [Mus musculus] 44 0.005
gi|9789909|ref|NP_062675.1| chloride channel Kb; putative basola... 44 0.005
gi|15242770|ref|NP_198313.1| chloride channel-like (CLC) protein... 44 0.007
gi|27465537|ref|NP_775126.1| chloride channel K1-like [Rattus no... 43 0.011
gi|12025668|ref|NP_068503.1| chloride channel 6 isoform ClC-6b [... 43 0.011
gi|50759375|ref|XP_425749.1| PREDICTED: similar to chloride chan... 43 0.011
gi|3171890|emb|CAA15952.1| dJ934G17.1.2 (variant 2) [Homo sapiens] 43 0.011
gi|12025673|ref|NP_068505.1| chloride channel 6 isoform ClC-6d [... 43 0.011
gi|3171892|emb|CAA15954.1| dJ934G17.1.4 (variant 4) [Homo sapiens] 43 0.011
gi|6382041|gb|AAC26247.2| Arabidopsis thaliana CLC-d chloride ch... 42 0.019
gi|48122777|ref|XP_396520.1| similar to ENSANGP00000019052 [Apis... 42 0.019
gi|7484866|pir||T01843 chloride channel protein homolog F9D12.10... 42 0.019
gi|26337613|dbj|BAC32492.1| unnamed protein product [Mus musculus] 42 0.019
gi|49119243|gb|AAH73264.1| Unknown (protein for MGC:80627) [Xeno... 42 0.019
gi|15240276|ref|NP_197996.1| chloride channel protein (CLC-d) [A... 42 0.019
gi|1742959|emb|CAA96065.1| CLC-d chloride channel protein [Arabi... 42 0.019
gi|50755960|ref|XP_414953.1| PREDICTED: similar to putative chlo... 42 0.025
gi|47212083|emb|CAF90577.1| unnamed protein product [Tetraodon n... 42 0.025
gi|4557475|ref|NP_000076.1| chloride channel Kb; Chloride channe... 41 0.042
gi|41055239|ref|NP_956676.1| hypothetical protein MGC64141 [Dani... 40 0.055
gi|20849056|ref|XP_144070.1| similar to chloride channel K1 [Mus... 40 0.055
gi|31753083|gb|AAH53869.1| Chloride channel Ka [Homo sapiens] 40 0.055
gi|14336753|gb|AAK61282.1| putative chloride channel protein 7 [... 40 0.055
gi|2143662|pir||S68426 chloride channel protein CLC-7 - rat 40 0.055
gi|1705857|sp|P51800|CICK_HUMAN Chloride channel protein CLC-KA ... 40 0.055
gi|31542311|ref|NP_004061.2| chloride channel Ka; Chloride chann... 40 0.055
gi|13928770|ref|NP_113756.1| chloride channel 7 [Rattus norvegic... 40 0.055
gi|6753436|ref|NP_036060.1| chloride channel 7 [Mus musculus] >g... 40 0.055
gi|14149607|ref|NP_001278.1| chloride channel 7 [Homo sapiens] >... 40 0.055
gi|2134912|pir||S68427 chloride channel protein 7 (ClC-7) - huma... 40 0.055
gi|18088621|gb|AAH20873.1| Unknown (protein for MGC:24087) [Homo... 39 0.12
gi|12311826|emb|CAC22644.1| chloride channel protein [Leishmania... 39 0.12
gi|20334298|dbj|BAB91147.1| OmCLC-K [Oreochromis mossambicus] 39 0.16
gi|31198861|ref|XP_308378.1| ENSANGP00000019052 [Anopheles gambi... 38 0.28
gi|19922112|ref|NP_610798.1| CG8594-PA [Drosophila melanogaster]... 36 1.0
gi|48855275|ref|ZP_00309434.1| COG0038: Chloride channel protein... 36 1.4
gi|15778438|gb|AAL07438.1| chloride channel protein ClcA [Dictyo... 35 1.8
gi|41017246|sp|Q9ZAA7|GCDC_ACIFE Glutaconyl-CoA decarboxylase ga... 35 1.8
gi|26449822|dbj|BAC42034.1| putative CLC-d chloride channel prot... 35 2.3
gi|31195859|ref|XP_306877.1| ENSANGP00000000377 [Anopheles gambi... 34 4.0
gi|50803706|ref|XP_424284.1| PREDICTED: similar to chloride chan... 34 4.0
gi|94804|pir||A35384 pilB protein - Pseudomonas aeruginosa >gnl|... 34 5.2
gi|15599722|ref|NP_253216.1| type 4 fimbrial biogenesis protein ... 34 5.2
gi|46164946|ref|ZP_00138017.2| COG2804: Type II secretory pathwa... 34 5.2
gi|23104249|ref|ZP_00090717.1| COG2804: Type II secretory pathwa... 33 6.8
gi|11496744|ref|NP_045557.1| multidrug-efflux transporter [Borre... 33 6.8
gi|46441815|gb|EAL01109.1| hypothetical protein CaO19.270 [Candi... 33 6.8
gi|15790882|ref|NP_280706.1| Vng2021c [Halobacterium sp. NRC-1] ... 33 8.9
gi|26353564|dbj|BAC40412.1| unnamed protein product [Mus musculus] 33 8.9
gi|47222773|emb|CAG01740.1| unnamed protein product [Tetraodon n... 33 8.9
>gi|17532615|ref|NP_495940.1| voltage gated CLC-type chloride
channel subunit (88.2 kD) (clh-5) [Caenorhabditis
elegans]
gi|6464026|dbj|BAA86959.1| clc chloride channel homologue
[Caenorhabditis elegans]
gi|14530332|emb|CAA92728.2| Hypothetical protein C07H4.2
[Caenorhabditis elegans]
gi|14530582|emb|CAA90949.2| Hypothetical protein C07H4.2
[Caenorhabditis elegans]
Length = 797
Score = 580 bits (1495), Expect = e-164
Identities = 277/304 (91%), Positives = 277/304 (91%)
Frame = -1
Query: 912 MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP 733
MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP
Sbjct: 1 MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP 60
Query: 732 DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF 553
DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF
Sbjct: 61 DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF 120
Query: 552 VGLXXXXXXXXXXXXARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW 373
VGL ARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW
Sbjct: 121 VGLAAGATAGIIDIGARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW 180
Query: 372 MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR 193
MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR
Sbjct: 181 MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR 240
Query: 192 GYLGKWTFIIKSVXXXXXXXXXXXXXXXGPMVHLACCIGNIFSYLFPKYGLNEAKKREIL 13
GYLGKWTFIIKSV GPMVHLACCIGNIFSYLFPKYGLNEAKKREIL
Sbjct: 241 GYLGKWTFIIKSVGLILSSASGLSLGKEGPMVHLACCIGNIFSYLFPKYGLNEAKKREIL 300
Query: 12 SASA 1
SASA
Sbjct: 301 SASA 304
>gi|6467501|gb|AAF13167.1| CLC chloride channel protein
[Caenorhabditis elegans]
Length = 796
Score = 580 bits (1495), Expect = e-164
Identities = 277/304 (91%), Positives = 277/304 (91%)
Frame = -1
Query: 912 MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP 733
MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP
Sbjct: 1 MERAGRSSTLGSTDDVELEPSGTSATIHLDMTAGGGSSSSDFNPFGAIDDVRFKTDDDLP 60
Query: 732 DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF 553
DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF
Sbjct: 61 DVMAPPFFSKYGDFHTIDWQRDLARDRLRHKMISKKKVDFPLGLLQSGWDAGAGWICVLF 120
Query: 552 VGLXXXXXXXXXXXXARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW 373
VGL ARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW
Sbjct: 121 VGLAAGATAGIIDIGARWMSDLKTGVCADRFWLDHEHCCWSSNDTFYKDDDCKAWTKWPW 180
Query: 372 MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR 193
MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR
Sbjct: 181 MLNYYNSSSFLFLFLEWIFYIGWAVAMSTLAVLFVKIFAPYACGSGIPEIKCILSGFVIR 240
Query: 192 GYLGKWTFIIKSVXXXXXXXXXXXXXXXGPMVHLACCIGNIFSYLFPKYGLNEAKKREIL 13
GYLGKWTFIIKSV GPMVHLACCIGNIFSYLFPKYGLNEAKKREIL
Sbjct: 241 GYLGKWTFIIKSVGLILSSASGLSLGKEGPMVHLACCIGNIFSYLFPKYGLNEAKKREIL 300
Query: 12 SASA 1
SASA
Sbjct: 301 SASA 304