Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T24H10_5
(729 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536497|ref|NP_495944.1| DNaJ domain (prokaryotic heat shock... 421 e-116
gi|39597573|emb|CAE59803.1| Hypothetical protein CBG03265 [Caeno... 334 1e-90
gi|45361439|ref|NP_989296.1| hypothetical protein MGC76175 [Xeno... 135 9e-31
gi|50539934|ref|NP_001002433.1| zgc:92648 [Danio rerio] >gnl|BL_... 129 5e-29
gi|50749186|ref|XP_421524.1| PREDICTED: similar to DnaJ homolog,... 128 1e-28
gi|23956266|ref|NP_598842.1| DnaJ homolog, subfamily C, member 9... 128 1e-28
gi|27597059|ref|NP_056005.1| DnaJ homolog, subfamily C, member 9... 125 1e-27
gi|34868976|ref|XP_344287.1| similar to J domain of DnaJ-like-pr... 125 1e-27
gi|26335859|dbj|BAC31630.1| unnamed protein product [Mus musculus] 124 2e-27
gi|25513803|pir||JC7707 J domain of DnaJ-like-protein 1 - rat 124 2e-27
gi|47218144|emb|CAG10064.1| unnamed protein product [Tetraodon n... 122 6e-27
gi|49388122|dbj|BAD25253.1| putative DnaJ homolog, subfamily C, ... 117 3e-25
gi|15230424|ref|NP_187824.1| DNAJ heat shock N-terminal domain-c... 113 3e-24
gi|31210751|ref|XP_314342.1| ENSANGP00000013114 [Anopheles gambi... 112 6e-24
gi|2689720|gb|AAB91418.1| DnaJ homologue [Arabidopsis thaliana] 111 1e-23
gi|15240212|ref|NP_196308.1| DNAJ heat shock protein, putative (... 108 1e-22
gi|32398706|emb|CAD98666.1| DNAJ protein-like, possible [Cryptos... 107 2e-22
gi|12322012|gb|AAG51050.1| DnaJ protein, putative, 3' partial; 1... 107 3e-22
gi|9971117|emb|CAC07197.1| dJ1099D15.1 (putative DNAJ protein) [... 106 4e-22
gi|48137997|ref|XP_393383.1| similar to CG6693-PA [Apis mellifera] 105 7e-22
gi|21356411|ref|NP_650052.1| CG6693-PA [Drosophila melanogaster]... 101 2e-20
gi|50257028|gb|EAL19746.1| hypothetical protein CNBG3740 [Crypto... 96 1e-18
gi|23478324|gb|EAA15443.1| 5702-7336, putative [Plasmodium yoeli... 91 2e-17
gi|49097820|ref|XP_410370.1| hypothetical protein AN6233.2 [Aspe... 86 8e-16
gi|46128755|ref|XP_388931.1| hypothetical protein FG08755.1 [Gib... 85 1e-15
gi|46437157|gb|EAK96508.1| hypothetical protein CaO19.2875 [Cand... 85 2e-15
gi|49076260|ref|XP_402127.1| hypothetical protein UM04512.1 [Ust... 84 4e-15
gi|50553244|ref|XP_504032.1| hypothetical protein [Yarrowia lipo... 82 1e-14
gi|19115271|ref|NP_594359.1| dnaj protein [Schizosaccharomyces p... 80 3e-14
gi|32413741|ref|XP_327350.1| hypothetical protein [Neurospora cr... 80 6e-14
gi|23613035|ref|NP_703357.1| heat shock protein, putative [Plasm... 75 2e-12
gi|38102527|gb|EAA49358.1| hypothetical protein MG01016.4 [Magna... 73 5e-12
gi|23509922|ref|NP_702589.1| hypothetical protein, conserved [Pl... 72 9e-12
gi|50421699|ref|XP_459405.1| unnamed protein product [Debaryomyc... 72 1e-11
gi|23509581|ref|NP_702248.1| hypothetical protein, conserved [Pl... 71 2e-11
gi|23490062|gb|EAA21924.1| DnaJ homolog [Plasmodium yoelii yoelii] 71 2e-11
gi|49075818|ref|XP_401947.1| hypothetical protein UM04332.1 [Ust... 71 3e-11
gi|7441928|pir||F71623 protein with DnaJ domain PFB0090c - malar... 70 3e-11
gi|50728194|ref|XP_416026.1| PREDICTED: similar to microvascular... 70 4e-11
gi|46227282|gb|EAK88232.1| DnaJ domain protein [Cryptosporidium ... 70 6e-11
gi|16805018|ref|NP_473047.1| heat shock 40 kDa protein, putative... 69 8e-11
gi|12044869|ref|NP_072679.1| heat shock protein (dnaJ) [Mycoplas... 69 8e-11
gi|28422711|gb|AAH46936.1| Dnajb9-prov protein [Xenopus laevis] 69 8e-11
gi|23593261|ref|NP_472947.2| hypothetical protein, conserved [Pl... 69 1e-10
gi|38111668|gb|EAA57211.1| hypothetical protein MG08180.4 [Magna... 69 1e-10
gi|40643395|emb|CAD55138.1| heat shock protein DnaJ [Fusobacteri... 68 2e-10
gi|2462052|emb|CAA72798.1| SIS1 protein [Cryptococcus curvatus] 68 2e-10
gi|46156765|ref|ZP_00132203.2| COG0484: DnaJ-class molecular cha... 68 2e-10
gi|23466915|ref|ZP_00122501.1| COG0484: DnaJ-class molecular cha... 68 2e-10
gi|41152000|ref|NP_958470.1| DnaJ (Hsp40) homolog, subfamily A, ... 68 2e-10
gi|16082112|ref|NP_394547.1| heat shock protein DnaJ related pro... 68 2e-10
gi|29841011|gb|AAP06024.1| similar to DnaJ (Hsp40 homolog, subfa... 67 3e-10
gi|13541318|ref|NP_111006.1| Molecular chaperone (DnaJ-related) ... 67 3e-10
gi|951451|gb|AAC18896.1| TCJ3 [Trypanosoma cruzi] 67 4e-10
gi|45201179|ref|NP_986749.1| AGR084Cp [Eremothecium gossypii] >g... 66 6e-10
gi|17554874|ref|NP_499759.1| DNaJ domain (prokaryotic heat shock... 66 8e-10
gi|31560085|ref|NP_076135.2| DnaJ (Hsp40) homolog, subfamily A, ... 66 8e-10
gi|30913111|sp|Q99M87|DJA3_MOUSE DnaJ homolog subfamily A member... 66 8e-10
gi|12836451|dbj|BAB23661.1| unnamed protein product [Mus musculus] 66 8e-10
gi|12963344|gb|AAK11222.1| tumorous imaginal discs protein Tid56... 66 8e-10
gi|26327155|dbj|BAC27321.1| unnamed protein product [Mus musculus] 66 8e-10
gi|13278151|gb|AAH03920.1| Dnaja3 protein [Mus musculus] 66 8e-10
gi|19703466|ref|NP_603028.1| Chaperone protein dnaJ [Fusobacteri... 66 8e-10
gi|46436002|gb|EAK95372.1| hypothetical protein CaO19.3592 [Cand... 65 1e-09
gi|46436057|gb|EAK95426.1| hypothetical protein CaO19.11074 [Can... 65 1e-09
gi|50762286|ref|XP_425006.1| PREDICTED: hypothetical protein XP_... 65 1e-09
gi|15231993|ref|NP_187509.1| DNAJ heat shock N-terminal domain-c... 65 1e-09
gi|12963346|gb|AAK11223.1| tumorous imaginal discs protein Tid56... 65 1e-09
gi|39586922|emb|CAE62857.1| Hypothetical protein CBG07036 [Caeno... 65 1e-09
gi|50291453|ref|XP_448159.1| unnamed protein product [Candida gl... 65 1e-09
gi|28422242|gb|AAH44298.1| Flj14281-prov protein [Xenopus laevis] 65 1e-09
gi|23508810|ref|NP_701478.1| heat shock protein DNAJ homolog Pfj... 65 2e-09
gi|15643612|ref|NP_228658.1| dnaJ protein [Thermotoga maritima M... 65 2e-09
gi|20878421|ref|XP_131212.1| RIKEN cDNA 5730496F10 [Mus musculus] 65 2e-09
gi|23503241|ref|NP_699161.1| DnaJ homolog, subfamily B, member 8... 65 2e-09
gi|41351330|gb|AAH65745.1| Unknown (protein for IMAGE:6498385) [... 64 2e-09
gi|46121509|ref|XP_385309.1| hypothetical protein FG05133.1 [Gib... 64 2e-09
gi|49089298|ref|XP_406375.1| hypothetical protein AN2238.2 [Aspe... 64 2e-09
gi|34811736|gb|AAQ82701.1| potyviral capsid protein interacting ... 64 2e-09
gi|34868661|ref|XP_340756.1| similar to tumorous imaginal discs ... 64 3e-09
gi|48098825|ref|XP_394833.1| similar to CG5504-PC [Apis mellifera] 64 3e-09
gi|15231803|ref|NP_188036.1| DNAJ heat shock N-terminal domain-c... 64 3e-09
gi|23485645|gb|EAA20515.1| heat shock protein DnaJ homologue Pfj... 64 3e-09
gi|47221273|emb|CAG13209.1| unnamed protein product [Tetraodon n... 64 3e-09
gi|50259141|gb|EAL21818.1| hypothetical protein CNBC5200 [Crypto... 64 3e-09
gi|50259142|gb|EAL21819.1| hypothetical protein CNBC5200 [Crypto... 64 3e-09
gi|31542691|ref|NP_079196.3| hypothetical protein FLJ14281 [Homo... 64 4e-09
gi|7484474|pir||T09295 probable heat shock protein EMB1 - white ... 64 4e-09
gi|29250418|gb|EAA41912.1| GLP_39_30615_31604 [Giardia lamblia A... 64 4e-09
gi|34904486|ref|NP_913590.1| putative heat shock protein 40 [Ory... 64 4e-09
gi|38077700|ref|XP_356831.1| similar to CG2790-PA [Mus musculus] 64 4e-09
gi|18490411|gb|AAH22248.1| Similar to DnaJ (Hsp40) homolog, subf... 64 4e-09
gi|23508689|ref|NP_701358.1| hypothetical protein [Plasmodium fa... 64 4e-09
gi|32404842|ref|XP_323034.1| hypothetical protein ( (AL513467) r... 64 4e-09
gi|37181664|gb|AAQ88639.1| EGNR9427 [Homo sapiens] 64 4e-09
gi|465872|sp|P34408|YLW5_CAEEL Hypothetical protein F22B7.5 in c... 63 5e-09
gi|17553096|ref|NP_498902.1| DNaJ domain (prokaryotic heat shock... 63 5e-09
gi|28200375|gb|AAO31693.1| DnaJ-like [Homo sapiens] 63 5e-09
gi|17553098|ref|NP_498901.1| DNaJ domain (prokaryotic heat shock... 63 5e-09
gi|19855061|sp|O54946|DJB6_MOUSE DnaJ homolog subfamily B member... 63 5e-09
gi|34853488|ref|XP_342608.1| similar to mDj4 [Rattus norvegicus] 63 5e-09
gi|6754736|ref|NP_035977.1| DnaJ (Hsp40) homolog, subfamily B, m... 63 5e-09
gi|13277586|gb|AAH03702.1| DnaJ (Hsp40) homolog, subfamily B, me... 63 5e-09
gi|47215594|emb|CAG11625.1| unnamed protein product [Tetraodon n... 63 5e-09
gi|50751414|ref|XP_422386.1| PREDICTED: similar to DnaJ (Hsp40) ... 63 5e-09
gi|12838381|dbj|BAB24183.1| unnamed protein product [Mus musculus] 63 5e-09
gi|39587365|emb|CAE75019.1| Hypothetical protein CBG22923 [Caeno... 63 5e-09
gi|6226597|sp|P77866|DNAJ_ACTAC Chaperone protein dnaJ >gnl|BL_O... 63 5e-09
gi|48870606|ref|ZP_00323327.1| COG0484: DnaJ-class molecular cha... 63 7e-09
gi|6680299|ref|NP_032325.1| DnaJ (Hsp40) homolog, subfamily B, m... 63 7e-09
gi|12838396|dbj|BAB24188.1| unnamed protein product [Mus musculus] 63 7e-09
gi|46228849|gb|EAK89719.1| DNAJ like chaperone [Cryptosporidium ... 63 7e-09
gi|3372677|gb|AAC29066.1| tumorous imaginal discs protein Tid56 ... 62 9e-09
gi|31542539|ref|NP_005138.2| DnaJ (Hsp40) homolog, subfamily A, ... 62 9e-09
gi|17066575|gb|AAL35323.1| DnaJ protein Tid-1 [Homo sapiens] >gn... 62 9e-09
gi|23485800|gb|EAA20579.1| DnaJ domain, putative [Plasmodium yoe... 62 9e-09
gi|34762775|ref|ZP_00143763.1| Chaperone protein dnaJ [Fusobacte... 62 9e-09
gi|13938209|gb|AAH07225.1| Unknown (protein for IMAGE:3161441) [... 62 9e-09
gi|9910416|ref|NP_064348.1| DnaJ homolog, subfamily B, member 8;... 62 9e-09
gi|50539774|ref|NP_001002353.1| zgc:92148 [Danio rerio] >gnl|BL_... 62 9e-09
gi|21593202|gb|AAM65151.1| putative heat-shock protein [Arabidop... 62 9e-09
gi|48716890|dbj|BAD23586.1| putative DnaJ-like protein [Oryza sa... 62 9e-09
gi|15218515|ref|NP_172506.1| DNAJ heat shock protein, putative [... 62 9e-09
gi|40225932|gb|AAH14062.1| DNAJA3 protein [Homo sapiens] >gnl|BL... 62 9e-09
gi|23612369|ref|NP_703949.1| DNAJ domain protein, putative [Plas... 62 9e-09
gi|50421801|ref|XP_459458.1| unnamed protein product [Debaryomyc... 62 9e-09
gi|15616772|ref|NP_239984.1| DnaJ protein [Buchnera aphidicola s... 62 9e-09
gi|7441914|pir||JC5609 heat shock protein dnaJ - Buchnera sp >gn... 62 9e-09
gi|15645945|ref|NP_208124.1| co-chaperone and heat shock protein... 62 9e-09
gi|23483973|gb|EAA19462.1| DnaJ domain, putative [Plasmodium yoe... 62 9e-09
gi|38105573|gb|EAA51986.1| hypothetical protein MG03581.4 [Magna... 62 9e-09
gi|24654066|ref|NP_725541.1| CG8448-PA [Drosophila melanogaster]... 62 9e-09
gi|44889077|sp|Q9QYI8|DJB7_MOUSE DnaJ homolog subfamily B member... 62 1e-08
gi|50306857|ref|XP_453404.1| unnamed protein product [Kluyveromy... 62 1e-08
gi|34811740|gb|AAQ82703.1| potyviral capsid protein interacting ... 62 1e-08
gi|50798535|ref|XP_424018.1| PREDICTED: similar to DnaJ homolog ... 62 1e-08
gi|41054517|ref|NP_955917.1| Unknown (protein for MGC:56703); wu... 62 1e-08
gi|31215420|ref|XP_316024.1| ENSANGP00000010793 [Anopheles gambi... 62 1e-08
gi|26399923|sp|O94625|SPJ1_SCHPO DnaJ-related protein spj1 >gnl|... 62 1e-08
gi|41053303|ref|NP_956338.1| Unknown (protein for MGC:63563); wu... 62 1e-08
gi|19113489|ref|NP_596697.1| dnaj related protein. [Schizosaccha... 62 1e-08
gi|6179940|gb|AAF05720.1| DnaJ-like protein [Nicotiana tabacum] 62 1e-08
gi|11496245|ref|NP_067292.1| DnaJ (Hsp40) homolog, subfamily B, ... 62 1e-08
gi|15963936|ref|NP_384289.1| PROBABLE CHAPERONE PROTEIN [Sinorhi... 62 1e-08
gi|13473985|ref|NP_105553.1| heat shock protein dnaJ (40) [Mesor... 62 2e-08
gi|18422864|ref|NP_568690.1| DNAJ heat shock protein, mitochondr... 62 2e-08
gi|21429604|gb|AAM49801.1| GFA2 [Arabidopsis thaliana] 62 2e-08
gi|47777312|ref|NP_001001394.1| DnaJ-like protein [Homo sapiens]... 62 2e-08
gi|50418455|gb|AAH77166.1| Unknown (protein for MGC:91922) [Dani... 62 2e-08
gi|12838392|dbj|BAB24186.1| unnamed protein product [Mus musculus] 62 2e-08
gi|50415468|gb|AAH78100.1| Unknown (protein for MGC:83507) [Xeno... 62 2e-08
gi|47219032|emb|CAG00171.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|15612317|ref|NP_223970.1| co-chaperone with DnaK [Helicobacte... 62 2e-08
gi|10177754|dbj|BAB11067.1| DnaJ protein-like [Arabidopsis thali... 62 2e-08
gi|15799695|ref|NP_285707.1| chaperone with DnaK; heat shock pro... 61 2e-08
gi|17737735|ref|NP_524213.1| CG6395-PA [Drosophila melanogaster]... 61 2e-08
gi|28574723|ref|NP_730714.2| CG6395-PC [Drosophila melanogaster]... 61 2e-08
gi|2731574|gb|AAC27389.1| DnaJ homolog [Babesia bovis] 61 2e-08
gi|47497362|dbj|BAD19401.1| DNAJ heat shock N-terminal domain-co... 61 2e-08
gi|50310423|ref|XP_455231.1| unnamed protein product [Kluyveromy... 61 2e-08
gi|34811738|gb|AAQ82702.1| potyviral capsid protein interacting ... 61 2e-08
gi|50307369|ref|XP_453663.1| unnamed protein product [Kluyveromy... 61 2e-08
gi|50288975|ref|XP_446917.1| unnamed protein product [Candida gl... 61 2e-08
gi|6324321|ref|NP_014391.1| HSP40 family chaperone; Sis1p [Sacch... 61 2e-08
gi|48861837|ref|ZP_00315736.1| COG0484: DnaJ-class molecular cha... 61 2e-08
gi|50419165|ref|XP_458105.1| unnamed protein product [Debaryomyc... 61 2e-08
gi|15829204|ref|NP_326564.1| HEAT SHOCK PROTEIN DNAJ (activation... 61 2e-08
gi|11863723|emb|CAC16088.2| DnaJ like protein [Lycopersicon escu... 61 2e-08
gi|24668523|ref|NP_730713.1| CG6395-PB [Drosophila melanogaster]... 61 2e-08
gi|50254787|gb|EAL17532.1| hypothetical protein CNBM0990 [Crypto... 61 2e-08
gi|34912486|ref|NP_917590.1| heat shock protein-like [Oryza sati... 61 2e-08
gi|29249429|gb|EAA40941.1| GLP_186_64698_63613 [Giardia lamblia ... 61 2e-08
gi|16120798|ref|NP_404111.1| chaperone protein DnaJ [Yersinia pe... 61 2e-08
gi|21553335|ref|NP_660157.1| DnaJ (Hsp40) homolog, subfamily B, ... 61 3e-08
gi|33151439|ref|NP_872792.1| chaperone protein DnaJ [Haemophilus... 61 3e-08
gi|33519590|ref|NP_878422.1| DnaJ protein [Candidatus Blochmanni... 61 3e-08
gi|21553367|gb|AAM62460.1| DnaJ protein-like [Arabidopsis thaliana] 61 3e-08
gi|16759006|ref|NP_454623.1| DnaJ protein [Salmonella enterica s... 61 3e-08
gi|6572224|emb|CAB63052.1| dJ408N23.4 (novel DnaJ domain protein... 61 3e-08
gi|32414441|ref|XP_327700.1| hypothetical protein [Neurospora cr... 61 3e-08
gi|17507263|ref|NP_493570.1| DNaJ domain (prokaryotic heat shock... 61 3e-08
gi|50289051|ref|XP_446955.1| unnamed protein product [Candida gl... 61 3e-08
gi|3122004|sp|O33529|DNAJ_RHILE Chaperone protein dnaJ >gnl|BL_O... 61 3e-08
gi|45191028|ref|NP_985282.1| AER427Wp [Eremothecium gossypii] >g... 61 3e-08
gi|34905276|ref|NP_913985.1| putative heat shock protein 40 [Ory... 61 3e-08
gi|34861654|ref|XP_227809.2| similar to DnaJ homolog subfamily B... 61 3e-08
gi|37524584|ref|NP_927928.1| heat shock protein dnaJ (HSP40) (ch... 61 3e-08
gi|47223452|emb|CAG04313.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|48096650|ref|XP_392495.1| similar to CG8448-PA [Apis mellifera] 61 3e-08
gi|50355737|gb|AAT75262.1| putative DnaJ like protein [Oryza sa... 60 3e-08
gi|27375791|ref|NP_767320.1| chaperone protein [Bradyrhizobium j... 60 3e-08
gi|50308607|ref|XP_454306.1| unnamed protein product [Kluyveromy... 60 3e-08
gi|4322315|gb|AAD16010.1| DnaJ-like 2 protein [Homo sapiens] 60 3e-08
gi|31198721|ref|XP_308308.1| ENSANGP00000010875 [Anopheles gambi... 60 3e-08
gi|42742432|gb|AAS45274.1| microvascular endothelial differentia... 60 3e-08
gi|41471290|gb|AAS07393.1| unknown [Homo sapiens] 60 3e-08
gi|49522038|gb|AAH74594.1| Unknown (protein for MGC:69460) [Xeno... 60 3e-08
gi|34861860|ref|XP_344988.1| similar to mDj4 [Rattus norvegicus] 60 3e-08
gi|34497100|ref|NP_901315.1| heat shock protein dnaJ; chaperone ... 60 3e-08
gi|23490649|gb|EAA22376.1| protein with DnaJ domain-related [Pla... 60 3e-08
gi|48095627|ref|XP_392331.1| similar to pDJA1 chaperone [Apis me... 60 3e-08
gi|15595000|ref|NP_212789.1| heat shock protein (dnaJ-2) [Borrel... 60 3e-08
gi|31198607|ref|XP_308251.1| ENSANGP00000010799 [Anopheles gambi... 60 3e-08
gi|23508181|ref|NP_700851.1| hypothetical protein [Plasmodium fa... 60 3e-08
gi|17388799|ref|NP_490647.1| DnaJ (Hsp40) homolog, subfamily B, ... 60 3e-08
gi|45187616|ref|NP_983839.1| ADL257Cp [Eremothecium gossypii] >g... 60 3e-08
gi|21914368|gb|AAM81355.1| heat shock protein 40 [Steinernema fe... 60 3e-08
gi|39597945|emb|CAE68637.1| Hypothetical protein CBG14527 [Caeno... 60 3e-08
gi|23104784|ref|ZP_00091244.1| COG0484: DnaJ-class molecular cha... 60 3e-08
gi|11277165|pir||T48660 heat shock protein dnaJ [validated] - Ca... 60 3e-08
gi|4885495|ref|NP_005485.1| DnaJ (Hsp40) homolog, subfamily B, m... 60 3e-08
gi|39584440|emb|CAE72578.1| Hypothetical protein CBG19766 [Caeno... 60 5e-08
gi|46116558|ref|XP_384297.1| hypothetical protein FG04121.1 [Gib... 60 5e-08
gi|48847091|ref|ZP_00301349.1| COG2214: DnaJ-class molecular cha... 60 5e-08
gi|28211652|ref|NP_782596.1| chaperone protein dnaJ [Clostridium... 60 5e-08
gi|11132612|sp|Q9ZFC5|DNAJ_METSS Chaperone protein dnaJ >gnl|BL_... 60 5e-08
gi|27806965|ref|NP_776957.1| DnaJ (Hsp40) homolog, subfamily B, ... 60 5e-08
gi|46141598|ref|ZP_00146910.2| COG0484: DnaJ-class molecular cha... 60 5e-08
gi|50406873|ref|XP_456669.1| unnamed protein product [Debaryomyc... 60 5e-08
gi|46228629|gb|EAK89499.1| DNAJ'DNAJ protein' [Cryptosporidium p... 60 5e-08
gi|16128009|ref|NP_414556.1| chaperone with DnaK; heat shock pro... 60 5e-08
gi|15226572|ref|NP_179746.1| DNAJ heat shock N-terminal domain-c... 60 5e-08
gi|30061585|ref|NP_835756.1| chaperone with DnaK; heat shock pro... 60 5e-08
gi|32395918|gb|AAP41819.1| P58IPK [Nicotiana benthamiana] 60 5e-08
gi|29840996|gb|AAP06009.1| similar to GenBank Accession Number Q... 60 5e-08
gi|46142067|ref|ZP_00147640.2| COG0484: DnaJ-class molecular cha... 60 5e-08
gi|28897428|ref|NP_797033.1| DnaJ protein [Vibrio parahaemolytic... 60 5e-08
gi|27363826|ref|NP_759354.1| DnaJ chaperone [Vibrio vulnificus C... 60 5e-08
gi|17510057|ref|NP_493010.1| DNaJ domain (prokaryotic heat shock... 60 5e-08
gi|37679017|ref|NP_933626.1| chaperone protein DnaJ [Vibrio vuln... 60 5e-08
gi|19112890|ref|NP_596098.1| DNA J domain protein [Schizosacchar... 60 5e-08
gi|24111464|ref|NP_705974.1| chaperone with DnaK; heat shock pro... 60 5e-08
gi|41152223|ref|NP_958499.1| DnaJ (Hsp40) homolog, subfamily A, ... 60 5e-08
gi|21357547|ref|NP_650283.1| CG8863-PA [Drosophila melanogaster]... 60 5e-08
gi|15792584|ref|NP_282407.1| chaperone DnaJ [Campylobacter jejun... 60 5e-08
gi|15602605|ref|NP_245677.1| DnaJ [Pasteurella multocida Pm70] >... 60 5e-08
gi|5542127|pdb|1BQZ| J-Domain (Residues 1-77) Of The Escherichi... 60 5e-08
gi|5542126|pdb|1BQ0| J-Domain (Residues 1-77) Of The Escherichi... 60 5e-08
gi|1942570|pdb|1XBL| Nmr Structure Of The J-Domain (Residues 2-... 60 5e-08
gi|1169384|sp|P43644|DNJH_ATRNU DnaJ protein homolog ANJ1 >gnl|B... 60 6e-08
gi|31234504|ref|XP_319073.1| ENSANGP00000013296 [Anopheles gambi... 60 6e-08
gi|15679295|ref|NP_276412.1| DnaJ protein [Methanothermobacter t... 60 6e-08
gi|10798648|emb|CAC12824.1| putative DNAJ protein [Nicotiana tab... 60 6e-08
gi|40253343|dbj|BAD05275.1| putative DnaJ, heat shock protein hs... 60 6e-08
gi|50732259|ref|XP_418551.1| PREDICTED: similar to DnaJ (Hsp40) ... 60 6e-08
gi|21674304|ref|NP_662369.1| DnaJ protein [Chlorobium tepidum TL... 60 6e-08
gi|21672435|ref|NP_660502.1| DnaJ protein [Buchnera aphidicola s... 60 6e-08
gi|46201302|ref|ZP_00055306.2| COG0484: DnaJ-class molecular cha... 60 6e-08
gi|47212097|emb|CAF93917.1| unnamed protein product [Tetraodon n... 60 6e-08
gi|5802244|gb|AAD51625.1| seed maturation protein PM37 [Glycine ... 59 8e-08
gi|15231987|ref|NP_187503.1| DNAJ heat shock protein, putative [... 59 8e-08
gi|41055347|ref|NP_956694.1| hypothetical protein MGC63689 [Dani... 59 8e-08
gi|21618097|gb|AAM67147.1| putative heat shock protein [Arabidop... 59 8e-08
gi|15235310|ref|NP_194577.1| DNAJ heat shock family protein [Ara... 59 8e-08
gi|50290913|ref|XP_447889.1| unnamed protein product [Candida gl... 59 8e-08
gi|23619246|ref|NP_705208.1| DNAJ-like protein, putative [Plasmo... 59 8e-08
gi|461944|sp|Q04960|DNJH_CUCSA DnaJ protein homolog (DNAJ-1) >gn... 59 8e-08
gi|421809|pir||S35581 dnaJ protein homolog DnaJ-1 - cucumber 59 8e-08
gi|47226293|emb|CAG09261.1| unnamed protein product [Tetraodon n... 59 8e-08
gi|46228157|gb|EAK89056.1| DNAj domain, possible transmembrane d... 59 8e-08
gi|15228802|ref|NP_191819.1| DNAJ heat shock family protein [Ara... 59 8e-08
gi|4210948|gb|AAD12055.1| DnaJ protein [Hevea brasiliensis] 59 8e-08
gi|4008159|dbj|BAA35121.1| DnaJ homolog [Salix gilgiana] 59 8e-08
gi|1706173|sp|Q03751|CSP_DROME Cysteine string protein >gnl|BL_O... 59 8e-08
gi|20807437|ref|NP_622608.1| Molecular chaperones (contain C-ter... 59 8e-08
gi|46912327|emb|CAG19119.1| putative DnaJ protein, DnaJ-class mo... 59 8e-08
gi|11132181|sp|O87385|DNAJ_VIBHA Chaperone protein dnaJ >gnl|BL_... 59 8e-08
gi|7488735|pir||T09338 DnaJ-like protein MsJ1 - alfalfa >gnl|BL_... 59 1e-07
gi|46436837|gb|EAK96193.1| hypothetical protein CaO19.7175 [Cand... 59 1e-07
gi|23593332|ref|NP_473112.2| hypothetical protein [Plasmodium fa... 59 1e-07
gi|40362978|gb|AAR84666.1| DnaJ [Agrobacterium tumefaciens] 59 1e-07
gi|2984740|gb|AAC08023.1| heat shock protein [Campylobacter jejuni] 59 1e-07
gi|34583424|gb|AAP49705.1| ARG1-like protein 2 [Arabidopsis thal... 59 1e-07
gi|47206629|emb|CAF95110.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|30696376|ref|NP_176206.2| DNAJ heat shock N-terminal domain-c... 59 1e-07
gi|39588984|emb|CAE69614.1| Hypothetical protein CBG15846 [Caeno... 59 1e-07
gi|41053503|ref|NP_956599.1| hypothetical protein MGC56709 [Dani... 59 1e-07
gi|41149466|ref|XP_370665.1| similar to DnaJ (Hsp40) homolog, su... 59 1e-07
gi|49070786|ref|XP_399682.1| hypothetical protein UM02067.1 [Ust... 59 1e-07
gi|6324103|ref|NP_014172.1| Protein that may function as a cocha... 59 1e-07
gi|15233838|ref|NP_192673.1| DNAJ heat shock N-terminal domain-c... 59 1e-07
gi|25296041|pir||A96624 hypothetical protein T2K10.3 [imported] ... 59 1e-07
gi|48975929|emb|CAD99040.1| putative scj1 protein [Yarrowia lipo... 59 1e-07
gi|50086568|ref|YP_048078.1| heat shock protein (Hsp40), co-chap... 59 1e-07
gi|7494396|pir||H71602 protein with DnaJ domain (RESA-like) PFB0... 59 1e-07
gi|50292765|ref|XP_448815.1| unnamed protein product [Candida gl... 59 1e-07
gi|50555818|ref|XP_505317.1| hypothetical protein [Yarrowia lipo... 59 1e-07
gi|15218901|ref|NP_176181.1| DNAJ heat shock protein, putative [... 59 1e-07
gi|45552811|ref|NP_995931.1| CG5504-PC [Drosophila melanogaster]... 59 1e-07
gi|15887475|ref|NP_353156.1| AGR_C_192p [Agrobacterium tumefacie... 59 1e-07
gi|1487966|emb|CAA64531.1| Tid56 protein [Drosophila melanogaste... 59 1e-07
gi|542596|pir||S42091 Tid(56) protein - fruit fly (Drosophila me... 59 1e-07
gi|46849521|dbj|BAD17849.1| putative chaperone DnaJ [Hydrogenoba... 59 1e-07
gi|39933411|ref|NP_945687.1| heat shock protein DnaJ (40) [Rhodo... 59 1e-07
gi|50553292|ref|XP_504057.1| hypothetical protein [Yarrowia lipo... 59 1e-07
gi|45549272|ref|NP_524932.2| CG5504-PA [Drosophila melanogaster]... 59 1e-07
gi|15228294|ref|NP_190377.1| DNAJ heat shock protein, putative [... 59 1e-07
gi|17863042|gb|AAL39998.1| SD10289p [Drosophila melanogaster] 59 1e-07
gi|47226687|emb|CAG07846.1| unnamed protein product [Tetraodon n... 59 1e-07
gi|45552813|ref|NP_995932.1| CG5504-PB [Drosophila melanogaster]... 59 1e-07
gi|34924896|sp|Q27237|TID_DROME Tumorous imaginal discs protein,... 59 1e-07
gi|6320888|ref|NP_010967.1| Homologous to E. coli DnaJ; contains... 59 1e-07
gi|31544354|ref|NP_852932.1| DnaJ [Mycoplasma gallisepticum R] >... 59 1e-07
gi|2494151|sp|Q45552|DNAJ_BACST Chaperone protein dnaJ >gnl|BL_O... 59 1e-07
gi|6782421|gb|AAF28382.1| DnaJ-like protein [Lycopersicon escule... 59 1e-07
gi|7441932|pir||T01643 DnaJ protein homolog ZMDJ1 - maize >gnl|B... 59 1e-07
gi|50552988|ref|XP_503904.1| hypothetical protein [Yarrowia lipo... 59 1e-07
gi|29367357|gb|AAO72551.1| DNAJ-like protein [Oryza sativa (japo... 58 2e-07
gi|37362683|ref|NP_013941.2| dnaJ homolog; Scj1p [Saccharomyces ... 58 2e-07
gi|7441927|pir||T09133 heat shock protein homolog DNAJ - Trypano... 58 2e-07
gi|11061652|emb|CAC14528.1| DNAJ protein [Leishmania major] 58 2e-07
gi|50122802|ref|YP_051969.1| chaperone protein DnaJ [Erwinia car... 58 2e-07
gi|19115249|ref|NP_594337.1| putative DNA-J-like protein. [Schiz... 58 2e-07
gi|50549673|ref|XP_502307.1| hypothetical protein [Yarrowia lipo... 58 2e-07
gi|46439171|gb|EAK98492.1| hypothetical protein CaO19.8136 [Cand... 58 2e-07
gi|134297|sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 >gnl|BL... 58 2e-07
gi|15894565|ref|NP_347914.1| Molecular chaperones DnaJ (HSP40 fa... 58 2e-07
gi|30691988|ref|NP_850653.1| DNAJ heat shock protein, putative (... 58 2e-07
gi|50306601|ref|XP_453274.1| unnamed protein product [Kluyveromy... 58 2e-07
gi|32398844|emb|CAD98554.1| heat shock protein DNAJ homologue pf... 58 2e-07
gi|15606104|ref|NP_213481.1| chaperone DnaJ [Aquifex aeolicus VF... 58 2e-07
gi|2129577|pir||S71199 dnaJ protein homolog atj3 - Arabidopsis t... 58 2e-07
gi|15229874|ref|NP_189997.1| DNAJ heat shock protein, putative (... 58 2e-07
gi|15010708|gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thali... 58 2e-07
gi|7595798|gb|AAF64454.1| DnaJ protein [Euphorbia esula] 58 2e-07
gi|46439078|gb|EAK98400.1| hypothetical protein CaO19.506 [Candi... 58 2e-07
gi|49474890|ref|YP_032931.1| Heat shock protein DnaJ [Bartonella... 58 2e-07
gi|50552724|ref|XP_503772.1| hypothetical protein [Yarrowia lipo... 58 2e-07
gi|39589181|emb|CAE57914.1| Hypothetical protein CBG00965 [Caeno... 58 2e-07
gi|7441930|pir||T07371 dnaJ protein homolog - potato >gnl|BL_ORD... 58 2e-07
gi|24668492|ref|NP_649380.1| CG7130-PA [Drosophila melanogaster]... 58 2e-07
gi|33598001|ref|NP_885644.1| molecular chaperone [Bordetella par... 58 2e-07
gi|32395916|gb|AAP41818.1| P58IPK [Lycopersicon esculentum] 58 2e-07
gi|27151736|ref|NP_006727.2| DnaJ (Hsp40) homolog, subfamily B, ... 58 2e-07
gi|31204407|ref|XP_311152.1| ENSANGP00000020449 [Anopheles gambi... 58 2e-07
gi|28704053|gb|AAH47363.1| KIAA0962 protein [Homo sapiens] 58 2e-07
gi|30249896|ref|NP_841966.1| DnaJ molecular chaperone [Nitrosomo... 58 2e-07
gi|39995125|ref|NP_951076.1| phage prohead protease, HK97 family... 58 2e-07
gi|15234962|ref|NP_195626.1| DNAJ heat shock N-terminal domain-c... 58 2e-07
gi|2494161|sp|P56101|CSP_TORCA Cysteine string protein (CCCS1) >... 58 2e-07
gi|47523738|ref|NP_999504.1| pDJA1 chaperone [Sus scrofa] >gnl|B... 58 2e-07
gi|11496255|ref|NP_067397.1| heat shock protein, DNAJ-like 4 [Mu... 58 2e-07
gi|30583809|gb|AAP36153.1| Homo sapiens DnaJ (Hsp40) homolog, su... 58 2e-07
gi|34863417|ref|XP_217147.2| similar to mmDj4 [Rattus norvegicus] 58 2e-07
gi|29126218|ref|NP_149096.2| DnaJ (Hsp40) homolog, subfamily C, ... 58 2e-07
gi|20521712|dbj|BAA76806.2| KIAA0962 protein [Homo sapiens] 58 2e-07
gi|50308287|ref|XP_454145.1| unnamed protein product [Kluyveromy... 58 2e-07
gi|16273157|ref|NP_439394.1| heat shock protein [Haemophilus inf... 58 2e-07
gi|45184816|ref|NP_982534.1| AAL008Wp [Eremothecium gossypii] >g... 58 2e-07
gi|26787996|emb|CAA44969.2| HSJ1a protien [Homo sapiens] >gnl|BL... 58 2e-07
gi|250082|gb|AAA09034.1| HSJ1a [Homo sapiens] 58 2e-07
gi|6016273|sp|P25686|DJB2_HUMAN DnaJ homolog subfamily B member ... 58 2e-07
gi|284069|pir||S23508 dnaJ protein homolog - human >gnl|BL_ORD_I... 58 2e-07
gi|1169371|sp|P43735|DNAJ_HAEIN Chaperone protein dnaJ 58 2e-07
gi|33593481|ref|NP_881125.1| molecular chaperone [Bordetella per... 58 2e-07
gi|32267018|ref|NP_861050.1| co-chaperone and heat shock protein... 58 2e-07
gi|33602907|ref|NP_890467.1| molecular chaperone [Bordetella bro... 58 2e-07
gi|41723704|ref|ZP_00150614.1| COG0484: DnaJ-class molecular cha... 58 2e-07
gi|9309334|dbj|BAB03216.1| dnaJ [Geobacillus thermoglucosidasius] 58 2e-07
gi|15599954|ref|NP_253448.1| DnaJ protein [Pseudomonas aeruginos... 57 3e-07
gi|38605843|emb|CAD41609.2| OSJNBb0034G17.1 [Oryza sativa (japon... 57 3e-07
gi|41054455|ref|NP_955956.1| DnaJ (Hsp40) homolog, subfamily A, ... 57 3e-07
gi|34897648|ref|NP_910170.1| hypothetical protein [Oryza sativa]... 57 3e-07
gi|18203397|sp|Q9QYI6|DJB9_MOUSE DnaJ homolog subfamily B member... 57 3e-07
gi|48140695|ref|XP_393522.1| similar to Zgc:85806 [Apis mellifera] 57 3e-07
gi|48867977|ref|ZP_00321382.1| COG0484: DnaJ-class molecular cha... 57 3e-07
gi|11132092|sp|O52065|DNAJ_PASHA Chaperone protein dnaJ >gnl|BL_... 57 3e-07
gi|49090814|ref|XP_406868.1| hypothetical protein AN2731.2 [Aspe... 57 3e-07
gi|50754820|ref|XP_414517.1| PREDICTED: similar to hypothetical ... 57 3e-07
gi|27805462|sp|Q8WW22|DJA4_HUMAN DnaJ homolog subfamily A member... 57 3e-07
gi|50260032|gb|EAL22695.1| hypothetical protein CNBB1440 [Crypto... 57 3e-07
gi|26554350|ref|NP_758284.1| heat shock protein DnaJ [Mycoplasma... 57 3e-07
gi|45361185|ref|NP_989180.1| hypothetical protein MGC75796 [Xeno... 57 3e-07
gi|14140154|emb|CAC39071.1| DnaJ-like protein [Oryza sativa] 57 3e-07
gi|50555850|ref|XP_505333.1| hypothetical protein [Yarrowia lipo... 57 3e-07
gi|28378659|ref|NP_785551.1| chaperone protein DnaJ [Lactobacill... 57 3e-07
gi|49388562|dbj|BAD25681.1| putative DnaJ-like protein MsJ1 [Ory... 57 3e-07
gi|47210685|emb|CAG06349.1| unnamed protein product [Tetraodon n... 57 3e-07
gi|535588|gb|AAB86799.1| putative [Arabidopsis thaliana] >gnl|BL... 57 3e-07
gi|18420428|ref|NP_568412.1| DNAJ heat shock protein, putative [... 57 3e-07
gi|45199025|ref|NP_986054.1| AFR507Wp [Eremothecium gossypii] >g... 57 3e-07
gi|46133570|ref|ZP_00157396.2| COG0484: DnaJ-class molecular cha... 57 3e-07
gi|31196983|ref|XP_307439.1| ENSANGP00000023027 [Anopheles gambi... 57 4e-07
gi|28200377|gb|AAO31694.1| DnaJA2 [Homo sapiens] 57 4e-07
gi|47211102|emb|CAF90061.1| unnamed protein product [Tetraodon n... 57 4e-07
gi|31222162|ref|XP_317136.1| ENSANGP00000018254 [Anopheles gambi... 57 4e-07
gi|32880141|gb|AAP88901.1| DnaJ (Hsp40) homolog, subfamily A, me... 57 4e-07
gi|33235569|dbj|BAB91324.2| Heat shock protein 40 [Colwellia maris] 57 4e-07
gi|34924888|sp|Q24331|TID_DROVI Tumorous imaginal discs protein,... 57 4e-07
gi|219588|dbj|BAA02656.1| DnaJ protein homolog [Homo sapiens] 57 4e-07
gi|15028450|gb|AAK81721.1| DnaJ-like protein [Cercopithecus aeth... 57 4e-07
gi|4504511|ref|NP_001530.1| DnaJ (Hsp40) homolog, subfamily A, m... 57 4e-07
gi|3859851|gb|AAC72887.1| heat shock protein Ddj1 [Dictyostelium... 57 4e-07
gi|7512480|pir||G02272 heat shock protein hsp40 homolog - human ... 57 4e-07
gi|45360863|ref|NP_989107.1| DnaJ homolog subfamily B member 6 [... 57 4e-07
gi|45915423|ref|ZP_00194061.2| COG0484: DnaJ-class molecular cha... 57 4e-07
gi|422811|pir||S34632 dnaJ protein homolog - human 57 4e-07
gi|19920464|ref|NP_608525.1| CG4164-PA [Drosophila melanogaster]... 57 4e-07
gi|48103935|ref|XP_395676.1| similar to CG2790-PA [Apis mellifera] 57 4e-07
gi|23613489|ref|NP_703333.1| protein with DNAJ domain, dnj1/sis1... 57 4e-07
gi|50425347|ref|XP_461267.1| unnamed protein product [Debaryomyc... 57 4e-07
gi|47211008|emb|CAF91048.1| unnamed protein product [Tetraodon n... 57 4e-07
gi|10945669|gb|AAG24642.1| J1P [Daucus carota] >gnl|BL_ORD_ID|56... 57 4e-07
gi|21313156|ref|NP_080202.1| DnaJ (Hsp40) homolog, subfamily B, ... 57 4e-07
gi|15611468|ref|NP_223119.1| putative co-chaperone with DnaK [He... 57 4e-07
gi|19075477|ref|NP_587977.1| hypothetical DNAJ domain protein [S... 57 4e-07
gi|6631085|ref|NP_008965.2| DnaJ (Hsp40) homolog, subfamily B, m... 57 4e-07
gi|15240968|ref|NP_195759.1| DNAJ heat shock protein, putative [... 57 4e-07
gi|15645638|ref|NP_207814.1| co-chaperone-curved DNA binding pro... 57 4e-07
gi|15640872|ref|NP_230503.1| dnaJ protein [Vibrio cholerae O1 bi... 57 4e-07
gi|50291421|ref|XP_448143.1| unnamed protein product [Candida gl... 57 4e-07
gi|18202967|sp|Q9HHB8|DNAJ_HALME Chaperone protein dnaJ (Heat sh... 57 4e-07
gi|49473744|ref|YP_031786.1| Heat shock protein DnaJ [Bartonella... 57 4e-07
gi|32034805|ref|ZP_00134923.1| COG0484: DnaJ-class molecular cha... 57 4e-07
gi|49235988|ref|ZP_00330051.1| COG0484: DnaJ-class molecular cha... 57 4e-07
gi|32403876|ref|XP_322551.1| hypothetical protein [Neurospora cr... 57 5e-07
gi|50413664|ref|XP_457297.1| unnamed protein product [Debaryomyc... 57 5e-07
gi|47222088|emb|CAG12114.1| unnamed protein product [Tetraodon n... 57 5e-07
gi|15792553|ref|NP_282376.1| putative curved-DNA binding protein... 57 5e-07
gi|48477913|ref|YP_023619.1| chaperone protein DnaJ [Picrophilus... 57 5e-07
gi|29246611|gb|EAA38201.1| GLP_13_7837_9549 [Giardia lamblia ATC... 57 5e-07
gi|27370020|ref|NP_766292.1| DnaJ (Hsp40) homolog, subfamily C, ... 57 5e-07
gi|128503|sp|P26508|NOLC_RHIFR NolC protein >gnl|BL_ORD_ID|51078... 57 5e-07
gi|44889076|sp|Q9NXW2|DJBC_HUMAN DnaJ homolog subfamily B member 12 57 5e-07
gi|7019854|dbj|BAA90896.1| unnamed protein product [Homo sapiens] 57 5e-07
gi|38086711|ref|XP_125441.3| similar to DnaJ-like protein 2 [Mus... 57 5e-07
gi|31199405|ref|XP_308650.1| ENSANGP00000011260 [Anopheles gambi... 57 5e-07
gi|41054844|ref|NP_060096.2| DnaJ (Hsp40) homolog, subfamily B, ... 57 5e-07
gi|48783682|ref|ZP_00280134.1| COG0484: DnaJ-class molecular cha... 57 5e-07
gi|47223894|emb|CAG06071.1| unnamed protein product [Tetraodon n... 57 5e-07
gi|26343261|dbj|BAC35287.1| unnamed protein product [Mus musculus] 57 5e-07
gi|50291189|ref|XP_448027.1| unnamed protein product [Candida gl... 57 5e-07
gi|33468635|emb|CAE30412.1| SI:zK105A6.1.1 (novel protein) [Dani... 57 5e-07
gi|32476331|ref|NP_869325.1| DnaJ1 protein [Pirellula sp. 1] >gn... 57 5e-07
gi|30017349|ref|NP_835156.1| DnaJ (Hsp40) homolog, subfamily B, ... 57 5e-07
gi|47940223|gb|AAH72042.1| MGC78895 protein [Xenopus laevis] 57 5e-07
gi|7507879|pir||T24938 hypothetical protein T15H9.1 - Caenorhabd... 57 5e-07
gi|27685061|ref|XP_217436.1| similar to DnaJ (Hsp40) homolog, su... 57 5e-07
gi|25152100|ref|NP_741036.1| DNaJ domain (prokaryotic heat shock... 57 5e-07
gi|27904644|ref|NP_777770.1| chaperone protein DnaJ [Buchnera ap... 57 5e-07
gi|31238236|ref|XP_319734.1| ENSANGP00000019419 [Anopheles gambi... 57 5e-07
gi|46226966|gb|EAK87932.1| DNAj domain protein having a signal p... 57 5e-07
gi|47086777|ref|NP_997796.1| similar to RIKEN cDNA E030019A03 ge... 57 5e-07
gi|23507862|ref|NP_700532.1| hypothetical protein [Plasmodium fa... 57 5e-07
gi|50876592|emb|CAG36432.1| related to heat shock protein DnaJ (... 57 5e-07
gi|32394528|gb|AAM93962.1| DnaJ protein [Griffithsia japonica] 57 5e-07
gi|50876371|emb|CAG36211.1| probable chaperone protein DnaJ [Des... 57 5e-07
gi|17534355|ref|NP_496468.1| DNaJ domain (prokaryotic heat shock... 56 7e-07
gi|11277163|pir||T43929 DnaJ protein homolog [imported] - Salix ... 56 7e-07
gi|1362225|pir||S55900 DNAJ-like protein homolog - fission yeast... 56 7e-07
gi|19075977|ref|NP_588477.1| psi protein [Schizosaccharomyces po... 56 7e-07
gi|26991409|ref|NP_746834.1| dnaJ protein [Pseudomonas putida KT... 56 7e-07
gi|6680297|ref|NP_032324.1| DnaJ (Hsp40) homolog, subfamily A, m... 56 7e-07
gi|45187997|ref|NP_984220.1| ADR124Cp [Eremothecium gossypii] >g... 56 7e-07
gi|34557109|ref|NP_906924.1| CHAPERONE WITH DNAK, HEAT SHOCK PRO... 56 7e-07
gi|42476000|ref|NP_079765.2| DnaJ (Hsp40) homolog, subfamily C, ... 56 7e-07
gi|20137941|sp|Q9CQ94|DJ5B_MOUSE DnaJ homolog subfamily C member... 56 7e-07
gi|50749322|ref|XP_421586.1| PREDICTED: similar to DnaJ homolog ... 56 7e-07
gi|11125675|emb|CAC15494.1| dJ591C20.3.2 (novel DnaJ domain prot... 56 7e-07
gi|27806967|ref|NP_776958.1| DnaJ (Hsp40) homolog, subfamily C, ... 56 7e-07
gi|49523192|gb|AAH75137.1| Unknown (protein for MGC:81924) [Xeno... 56 7e-07
gi|34852494|ref|XP_215417.2| similar to DnaJ (Hsp40) homolog, su... 56 7e-07
gi|50426829|ref|XP_462012.1| unnamed protein product [Debaryomyc... 56 7e-07
gi|15225377|ref|NP_179646.1| DNAJ heat shock family protein [Ara... 56 7e-07
gi|50417181|gb|AAH77119.1| Unknown (protein for MGC:101068) [Dan... 56 7e-07
gi|46199427|ref|YP_005094.1| chaperone protein dnaJ [Thermus the... 56 7e-07
gi|3123215|sp|Q56237|DNAJ_THETH Chaperone protein dnaJ >gnl|BL_O... 56 7e-07
gi|50758813|ref|XP_417428.1| PREDICTED: similar to DnaJ homolog ... 56 7e-07
gi|1449142|gb|AAB04678.1| heat shock protein 56 7e-07
gi|15675997|ref|NP_273124.1| dnaJ protein [Neisseria meningitidi... 56 7e-07
gi|45504382|ref|NP_079495.1| DnaJ (Hsp40) homolog, subfamily C, ... 56 7e-07
gi|7949027|ref|NP_058055.1| DnaJ (Hsp40) homolog, subfamily C, m... 56 7e-07
gi|12643505|sp|Q29455|DJC5_BOVIN DnaJ homolog subfamily C member... 56 7e-07
gi|4097577|gb|AAD09517.1| NTFP2 [Nicotiana tabacum] 56 7e-07
gi|29250384|gb|EAA41879.1| GLP_158_63336_64565 [Giardia lamblia ... 56 9e-07
gi|46227086|gb|EAK88036.1| DNAj protein with possible transmembr... 56 9e-07
gi|16331768|ref|NP_442496.1| DnaJ protein [Synechocystis sp. PCC... 56 9e-07
gi|50752156|ref|XP_422682.1| PREDICTED: similar to DnaJ homolog ... 56 9e-07
gi|50427795|ref|XP_462510.1| unnamed protein product [Debaryomyc... 56 9e-07
gi|21758015|dbj|BAC05229.1| unnamed protein product [Homo sapiens] 56 9e-07
gi|6324252|ref|NP_014322.1| Putative chaperone of the HSP40 (DNA... 56 9e-07
gi|15239227|ref|NP_196194.1| DNAJ heat shock N-terminal domain-c... 56 9e-07
gi|23478094|gb|EAA15273.1| DnaJ homolog, putative [Plasmodium yo... 56 9e-07
gi|23508708|ref|NP_701376.1| protein with DNAJ domain (resa-like... 56 9e-07
gi|47222799|emb|CAG01766.1| unnamed protein product [Tetraodon n... 56 9e-07
gi|49078582|ref|XP_403030.1| hypothetical protein UM05415.1 [Ust... 56 9e-07
gi|33354249|ref|NP_061072.2| DnaJ (Hsp40) homolog, subfamily A, ... 56 9e-07
gi|46137749|ref|XP_390566.1| hypothetical protein FG10390.1 [Gib... 56 9e-07
gi|18203395|sp|Q9QYI4|DJBC_MOUSE DnaJ homolog subfamily B member... 56 9e-07
gi|31982701|ref|NP_064349.2| DnaJ (Hsp40) homolog, subfamily B, ... 56 9e-07
gi|50306743|ref|XP_453346.1| unnamed protein product [Kluyveromy... 56 9e-07
gi|2352904|gb|AAB69313.1| Dnj3/Cpr3 [Homo sapiens] 56 9e-07
gi|1169382|sp|P42824|DNJ2_ALLPO DnaJ protein homolog 2 >gnl|BL_O... 56 9e-07
gi|9558755|ref|NP_036460.1| DnaJ (Hsp40) homolog, subfamily B, m... 56 9e-07
gi|46390272|dbj|BAD15722.1| putative Altered Response to Gravity... 56 9e-07
gi|19112379|ref|NP_595587.1| DNAJ domain protein; no apparent S.... 56 9e-07
gi|47225843|emb|CAF98323.1| unnamed protein product [Tetraodon n... 56 9e-07
gi|45521649|ref|ZP_00173167.1| COG0484: DnaJ-class molecular cha... 56 9e-07
gi|26349771|dbj|BAC38525.1| unnamed protein product [Mus musculus] 56 9e-07
gi|16079600|ref|NP_390424.1| heat-shock protein [Bacillus subtil... 56 9e-07
>gi|17536497|ref|NP_495944.1| DNaJ domain (prokaryotic heat shock
protein) (28.2 kD) (dnj-23) [Caenorhabditis elegans]
gi|7508407|pir||T25252 hypothetical protein T24H10.3 -
Caenorhabditis elegans
gi|3880170|emb|CAA90945.1| Hypothetical protein T24H10.3
[Caenorhabditis elegans]
Length = 242
Score = 421 bits (1081), Expect = e-116
Identities = 213/242 (88%), Positives = 213/242 (88%)
Frame = -1
Query: 729 MFLEECKTHFNTDCLYELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKF 550
MFLEECKTHFNTDCLYELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKF
Sbjct: 1 MFLEECKTHFNTDCLYELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKF 60
Query: 549 QLLNKAYQILSDEEKRKIYDETGSVDDEAGELNEDALKAWRMIFKKVTKEDIDSFMKTYQ 370
QLLNKAYQILSDEEKRKIYDETGSVDDEAGELNEDALKAWRMIFKKVTKEDIDSFMKTYQ
Sbjct: 61 QLLNKAYQILSDEEKRKIYDETGSVDDEAGELNEDALKAWRMIFKKVTKEDIDSFMKTYQ 120
Query: 369 GSREQKDELVVHYEKFNGDIAKIREYAIGFDGVEELKEALDKLIDDGEIEKTKKYETSTS 190
GSREQKDELVVHYEKFNGDIAKIREYAIGFDGVEELKEALDKLIDDGEIEKTKKYETSTS
Sbjct: 121 GSREQKDELVVHYEKFNGDIAKIREYAIGFDGVEELKEALDKLIDDGEIEKTKKYETSTS 180
Query: 189 DXXXXXXXXXXXXXXXEVENMTQNNSDLVALIQGRQKERGTSFLDXXXXXXXXXXXXXXK 10
D EVENMTQNNSDLVALIQGRQKERGTSFLD K
Sbjct: 181 DKKMKAYKRKAEKEAIEVENMTQNNSDLVALIQGRQKERGTSFLDSLAAKYAPSSSKKAK 240
Query: 9 RQ 4
RQ
Sbjct: 241 RQ 242