Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T24H7_7
(861 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536479|ref|NP_495250.1| prohibitin precursor (2G543) [Caeno... 484 e-135
gi|39597046|emb|CAE59273.1| Hypothetical protein CBG02605 [Caeno... 470 e-131
gi|16769674|gb|AAL29056.1| LD46344p [Drosophila melanogaster] 333 3e-90
gi|31232288|ref|XP_318676.1| ENSANGP00000022240 [Anopheles gambi... 332 8e-90
gi|34858436|ref|XP_342756.1| similar to repressor of estrogen re... 313 4e-84
gi|6005854|ref|NP_009204.1| repressor of estrogen receptor activ... 312 7e-84
gi|6671622|ref|NP_031557.1| B-cell receptor-associated protein 3... 308 1e-82
gi|41152494|ref|NP_955975.1| Unknown (protein for MGC:73150) [Da... 304 2e-81
gi|50540430|ref|NP_001002681.1| zgc:86841 [Danio rerio] >gnl|BL_... 299 5e-80
gi|50417418|gb|AAH77216.1| Unknown (protein for MGC:79025) [Xeno... 298 8e-80
gi|49522786|gb|AAH74451.1| Unknown (protein for MGC:84728) [Xeno... 296 4e-79
gi|24655276|ref|NP_725831.1| CG15081-PA [Drosophila melanogaster... 276 4e-73
gi|7716456|gb|AAF68384.1| prohibitin [Zea mays] 276 5e-73
gi|34394832|dbj|BAC84245.1| putative prohibitin [Oryza sativa (j... 271 1e-71
gi|50428673|gb|AAT77024.1| putative prohibitin [Oryza sativa (ja... 268 1e-70
gi|50260702|gb|EAL23352.1| hypothetical protein CNBA0060 [Crypto... 267 2e-70
gi|19075644|ref|NP_588144.1| putative prohibitin [Schizosaccharo... 265 7e-70
gi|50547337|ref|XP_501138.1| hypothetical protein [Yarrowia lipo... 265 1e-69
gi|15235317|ref|NP_194580.1| prohibitin, putative [Arabidopsis t... 261 1e-68
gi|21593626|gb|AAM65593.1| prohibitin-like protein [Arabidopsis ... 261 1e-68
gi|15219569|ref|NP_171882.1| prohibitin, putative [Arabidopsis t... 260 2e-68
gi|12751303|gb|AAK07610.1| prohibitin 1-like protein [Brassica n... 259 4e-68
gi|49097500|ref|XP_410210.1| hypothetical protein AN6073.2 [Aspe... 258 2e-67
gi|50309305|ref|XP_454659.1| unnamed protein product [Kluyveromy... 257 2e-67
gi|7716462|gb|AAF68387.1| prohibitin [Zea mays] 257 2e-67
gi|45187732|ref|NP_983955.1| ADL141Wp [Eremothecium gossypii] >g... 256 4e-67
gi|32420605|ref|XP_330746.1| hypothetical protein [Neurospora cr... 256 4e-67
gi|38099306|gb|EAA46665.1| hypothetical protein MG09886.4 [Magna... 256 6e-67
gi|46108474|ref|XP_381295.1| conserved hypothetical protein [Gib... 254 1e-66
gi|15225374|ref|NP_179643.1| prohibitin, putative [Arabidopsis t... 254 2e-66
gi|23507948|ref|NP_700618.1| prohibitin, putative [Plasmodium fa... 254 2e-66
gi|50293291|ref|XP_449057.1| unnamed protein product [Candida gl... 254 2e-66
gi|49077610|ref|XP_402645.1| hypothetical protein UM05030.1 [Ust... 254 2e-66
gi|50593217|ref|NP_011747.2| Possible role in aging; Phb2p [Sacc... 251 1e-65
gi|1723751|sp|P50085|YG4W_YEAST Hypothetical 34.9 kDa protein in... 251 1e-65
gi|41688286|dbj|BAD08534.1| prohibitin-like protein [Theileria o... 251 2e-65
gi|23484625|gb|EAA19893.1| SPFH domain / Band 7 family, putative... 249 4e-65
gi|46445050|gb|EAL04321.1| hypothetical protein CaO19.13394 [Can... 249 5e-65
gi|34901014|ref|NP_911853.1| putative prohibitin [Oryza sativa (... 244 2e-63
gi|15241424|ref|NP_199227.1| prohibitin, putative [Arabidopsis t... 244 2e-63
gi|50416722|ref|XP_457574.1| unnamed protein product [Debaryomyc... 243 4e-63
gi|46227259|gb|EAK88209.1| putative prohibitin with PHB domain [... 236 5e-61
gi|1673514|gb|AAC51639.1| B-cell receptor associated protein [Ho... 232 9e-60
gi|7489185|pir||T03843 prohibitin - common tobacco >gnl|BL_ORD_I... 223 3e-57
gi|42571329|ref|NP_973755.1| prohibitin, putative [Arabidopsis t... 222 7e-57
gi|50552159|ref|XP_503554.1| hypothetical protein [Yarrowia lipo... 222 9e-57
gi|47207431|emb|CAF94465.1| unnamed protein product [Tetraodon n... 221 1e-56
gi|49073888|ref|XP_401118.1| hypothetical protein UM03503.1 [Ust... 220 3e-56
gi|50251706|dbj|BAD27627.1| putative prohibitin [Oryza sativa (j... 220 4e-56
gi|7716458|gb|AAF68385.1| prohibitin [Zea mays] 219 8e-56
gi|32421789|ref|XP_331338.1| hypothetical protein [Neurospora cr... 218 1e-55
gi|23612725|ref|NP_704264.1| prohibitin, putative [Plasmodium fa... 216 4e-55
gi|29409366|gb|AAM29179.1| prohibitin protein Wph [Triticum aest... 216 5e-55
gi|45198831|ref|NP_985860.1| AFR313Cp [Eremothecium gossypii] >g... 216 7e-55
gi|46137581|ref|XP_390482.1| conserved hypothetical protein [Gib... 215 9e-55
gi|7716460|gb|AAF68386.1| prohibitin [Zea mays] 215 1e-54
gi|15237488|ref|NP_198893.1| prohibitin [Arabidopsis thaliana] >... 215 1e-54
gi|31202089|ref|XP_309992.1| ENSANGP00000022464 [Anopheles gambi... 215 1e-54
gi|20883496|ref|XP_137762.1| similar to PROHIBITIN (B-CELL RECEP... 214 1e-54
gi|27694751|gb|AAH43806.1| MGC53103 protein [Xenopus laevis] 214 2e-54
gi|48097857|ref|XP_391959.1| similar to prohibitin protein Wph [... 214 2e-54
gi|21592895|gb|AAM64845.1| prohibitin, putative [Arabidopsis tha... 214 3e-54
gi|23484082|gb|EAA19538.1| prohibitin [Plasmodium yoelii yoelii] 214 3e-54
gi|42820757|emb|CAF32070.1| prohibitin, putative [Aspergillus fu... 213 3e-54
gi|15232129|ref|NP_189364.1| prohibitin, putative [Arabidopsis t... 213 4e-54
gi|38106586|gb|EAA52876.1| hypothetical protein MG06004.4 [Magna... 213 4e-54
gi|24585145|ref|NP_724165.1| CG10691-PA [Drosophila melanogaster... 213 4e-54
gi|50260776|gb|EAL23426.1| hypothetical protein CNBA0760 [Crypto... 213 4e-54
gi|50290527|ref|XP_447695.1| unnamed protein product [Candida gl... 213 6e-54
gi|39589300|emb|CAE74329.1| Hypothetical protein CBG22042 [Caeno... 212 1e-53
gi|27765032|gb|AAO23637.1| At3g27280 [Arabidopsis thaliana] 211 1e-53
gi|6679299|ref|NP_032857.1| prohibitin [Mus musculus] >gnl|BL_OR... 211 1e-53
gi|49085396|ref|XP_404823.1| conserved hypothetical protein [Asp... 211 2e-53
gi|50760715|ref|XP_418103.1| PREDICTED: similar to prohibitin [G... 211 2e-53
gi|45360729|ref|NP_989038.1| hypothetical protein MGC75944 [Xeno... 210 4e-53
gi|4505773|ref|NP_002625.1| prohibitin [Homo sapiens] >gnl|BL_OR... 210 4e-53
gi|6321571|ref|NP_011648.1| antiproliferative protein involved i... 209 6e-53
gi|41152028|ref|NP_958454.1| prohibitin [Danio rerio] >gnl|BL_OR... 209 6e-53
gi|2055454|gb|AAB53231.1| prohibitin-like molecule TC-PRO-1 [Tox... 209 8e-53
gi|49456373|emb|CAG46507.1| PHB [Homo sapiens] 208 1e-52
gi|34873234|ref|XP_220756.2| similar to PROHIBITIN (B-CELL RECEP... 208 1e-52
gi|32766612|gb|AAH54971.1| MGC64447 protein [Xenopus laevis] 208 1e-52
gi|2582388|gb|AAB82549.1| prohibitin [Pneumocystis carinii] 207 2e-52
gi|46441902|gb|EAL01196.1| hypothetical protein CaO19.357 [Candi... 206 4e-52
gi|46360168|gb|AAS88903.1| prohibitin [Homo sapiens] 206 5e-52
gi|571500|gb|AAA53144.1| prohibitin 206 5e-52
gi|50416310|ref|XP_457543.1| unnamed protein product [Debaryomyc... 206 7e-52
gi|46434118|gb|EAK93537.1| hypothetical protein CaO19.14206 [Can... 205 9e-52
gi|17509869|ref|NP_490929.1| prohibitin (30.0 kD) (1C641) [Caeno... 204 2e-51
gi|19115625|ref|NP_594713.1| putative prohibitin [Schizosaccharo... 204 3e-51
gi|40786578|gb|AAR89853.1| putative prohibitin [Oryza sativa (ja... 202 6e-51
gi|46229824|gb|EAK90642.1| prohibitin domain protein [Cryptospor... 193 5e-48
gi|34880106|ref|XP_228944.2| similar to PROHIBITIN (B-CELL RECEP... 186 6e-46
gi|50760717|ref|XP_418104.1| PREDICTED: similar to prohibitin [G... 186 7e-46
gi|15241367|ref|NP_196934.1| prohibitin, putative [Arabidopsis t... 184 2e-45
gi|38567717|emb|CAE76006.1| B1358B12.15 [Oryza sativa (japonica ... 181 2e-44
gi|2952299|gb|AAC05496.1| prohibitin [Trypanosoma brucei rhodesi... 175 1e-42
gi|38086455|ref|XP_141875.2| similar to PROHIBITIN (B-CELL RECEP... 171 2e-41
gi|50307599|ref|XP_453779.1| unnamed protein product [Kluyveromy... 170 3e-41
gi|47207127|emb|CAF90031.1| unnamed protein product [Tetraodon n... 167 3e-40
gi|34881313|ref|XP_228492.2| similar to PROHIBITIN (B-CELL RECEP... 154 3e-36
gi|34880727|ref|XP_242408.2| similar to PROHIBITIN (B-CELL RECEP... 147 3e-34
gi|34881329|ref|XP_228515.2| similar to PROHIBITIN (B-CELL RECEP... 143 5e-33
gi|38086852|ref|XP_142216.3| similar to PROHIBITIN (B-CELL RECEP... 134 3e-30
gi|3642683|gb|AAC36528.1| BAP37 [Mus musculus] 120 5e-26
gi|22970800|ref|ZP_00017829.1| hypothetical protein [Chloroflexu... 115 9e-25
gi|15559750|gb|AAH14228.1| Unknown (protein for MGC:20874) [Homo... 112 8e-24
gi|13477237|gb|AAH05085.1| ZNF607 protein [Homo sapiens] 112 1e-23
gi|23113086|ref|ZP_00098493.1| COG0330: Membrane protease subuni... 110 4e-23
gi|125880|sp|P24156|L2CC_DROME L(2)37CC PROTEIN >gnl|BL_ORD_ID|1... 107 4e-22
gi|1666876|gb|AAB18746.1| B-cell receptor associated protein 37 ... 104 2e-21
gi|40786574|gb|AAR89849.1| putative prohibitin [Oryza sativa (ja... 96 1e-18
gi|16329361|ref|NP_440089.1| prohibitin [Synechocystis sp. PCC 6... 87 4e-16
gi|23128015|ref|ZP_00109872.1| COG0330: Membrane protease subuni... 85 2e-15
gi|45528001|ref|ZP_00179200.1| COG0330: Membrane protease subuni... 84 3e-15
gi|22299303|ref|NP_682550.1| ORF_ID:tlr1760~probable prohibitin ... 84 3e-15
gi|48893508|ref|ZP_00326744.1| COG0330: Membrane protease subuni... 84 3e-15
gi|23125460|ref|ZP_00107392.1| COG0330: Membrane protease subuni... 79 2e-13
gi|17228790|ref|NP_485338.1| prohibitin homolog [Nostoc sp. PCC ... 78 2e-13
gi|47208724|emb|CAF91106.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|15805509|ref|NP_294205.1| B-cell receptor associated protein-... 75 2e-12
gi|12751119|gb|AAK07552.1| PNAS-141 [Homo sapiens] 67 7e-10
gi|18138428|ref|NP_542529.1| hypothetical conserved protein COG3... 63 9e-09
gi|33239932|ref|NP_874874.1| Membrane protease subunits [Prochlo... 62 2e-08
gi|47193073|emb|CAF87022.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|34556544|ref|NP_906359.1| conserved hypothetical protein [Wol... 61 3e-08
gi|15791639|ref|NP_281462.1| putative transmembrane protein [Cam... 60 5e-08
gi|15644876|ref|NP_207046.1| conserved hypothetical protein [Hel... 59 1e-07
gi|15611303|ref|NP_222954.1| putative [Helicobacter pylori J99] ... 59 1e-07
gi|33866441|ref|NP_898000.1| Band 7 family protein [Synechococcu... 58 2e-07
gi|33861039|ref|NP_892600.1| Band 7 protein [Prochlorococcus mar... 55 2e-06
gi|16329662|ref|NP_440390.1| unknown protein [Synechocystis sp. ... 55 3e-06
gi|48854094|ref|ZP_00308258.1| COG0330: Membrane protease subuni... 53 1e-05
gi|33863180|ref|NP_894740.1| Band 7 protein [Prochlorococcus mar... 52 2e-05
gi|16120147|ref|NP_395735.1| Vng6208c [Halobacterium sp. NRC-1] ... 52 2e-05
gi|33866084|ref|NP_897643.1| possible membrane protease complex ... 51 4e-05
gi|48831374|ref|ZP_00288441.1| COG0330: Membrane protease subuni... 50 6e-05
gi|37521414|ref|NP_924791.1| similar to prohibitin [Gloeobacter ... 49 1e-04
gi|33595151|ref|NP_882794.1| putative exported protein [Bordetel... 48 3e-04
gi|33591727|ref|NP_879371.1| putative exported protein [Bordetel... 48 3e-04
gi|41719510|ref|ZP_00148396.1| COG0330: Membrane protease subuni... 46 0.001
gi|15898972|ref|NP_343577.1| Erythrocyte band 7 membrane protein... 46 0.001
gi|50555892|ref|XP_505354.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|15643629|ref|NP_228675.1| conserved hypothetical protein [The... 44 0.003
gi|46190901|ref|ZP_00120853.2| COG0330: Membrane protease subuni... 44 0.005
gi|15922536|ref|NP_378205.1| 260aa long hypothetical erythrocyte... 42 0.017
gi|24216191|ref|NP_713672.1| conserved hypothetical protein [Lep... 40 0.086
gi|14150732|gb|AAK54610.1| hypersensitive-induced response prote... 39 0.11
gi|16763183|ref|NP_458800.1| HflC protein [Salmonella enterica s... 39 0.19
gi|37805955|dbj|BAC99370.1| hypersensitive-induced response prot... 39 0.19
gi|9998903|emb|CAC07434.1| putative membrane protein [Zea mays] 38 0.25
gi|7716466|gb|AAF68389.1| hypersensitive-induced response protei... 38 0.25
gi|7716468|gb|AAF68390.1| hypersensitive-induced response protei... 38 0.33
gi|46441903|gb|EAL01197.1| hypothetical protein CaO19.358 [Candi... 38 0.33
gi|15804764|ref|NP_290805.1| protease specific for phage lambda ... 37 0.42
gi|46434120|gb|EAK93539.1| hypothetical protein CaO19.14208 [Can... 37 0.55
gi|23345042|gb|AAN17462.1| hypersensitive-induced reaction prote... 37 0.72
gi|15965876|ref|NP_386229.1| PUTATIVE HYDROLASE SERINE PROTEASE ... 37 0.72
gi|47221084|emb|CAG12778.1| unnamed protein product [Tetraodon n... 36 0.95
gi|48838988|ref|ZP_00295924.1| COG0330: Membrane protease subuni... 36 0.95
gi|34500111|gb|AAQ73640.1| stomatin-like protein [Epichloe festu... 36 0.95
gi|47566841|ref|ZP_00237559.1| stomatin-like protein [Bacillus c... 35 1.6
gi|49481659|ref|YP_036221.1| stomatin-like protein [Bacillus thu... 35 1.6
gi|30020194|ref|NP_831825.1| Stomatin like protein [Bacillus cer... 35 1.6
gi|42781212|ref|NP_978459.1| SPFH domain/Band 7 family protein [... 35 1.6
gi|21399946|ref|NP_655931.1| Band_7, SPFH domain / Band 7 family... 35 1.6
gi|20806896|ref|NP_622067.1| Membrane protease subunits, stomati... 35 1.6
gi|50122851|ref|YP_052018.1| putative phage-related protein [Erw... 35 1.6
gi|45914660|ref|ZP_00196753.1| COG0330: Membrane protease subuni... 35 1.6
gi|15679768|ref|NP_276886.1| stomatin-like protein [Methanotherm... 35 2.1
gi|45358599|ref|NP_988156.1| Band 7 protein:Stomatin [Methanococ... 35 2.1
gi|15721878|dbj|BAB68403.1| stomatin-like protein [Gibberella fu... 35 2.1
gi|27228583|ref|NP_758633.1| probable protease [Pseudomonas resi... 35 2.1
gi|48893869|ref|ZP_00327067.1| COG0330: Membrane protease subuni... 35 2.8
gi|7494583|pir||T34324 erythrocyte band 7 intergral membrane pro... 35 2.8
gi|46365936|ref|ZP_00199200.2| COG0330: Membrane protease subuni... 35 2.8
gi|17570161|ref|NP_508202.1| UNCoordinated locomotion UNC-1, sto... 35 2.8
gi|39592500|emb|CAE63577.1| Hypothetical protein CBG08066 [Caeno... 35 2.8
gi|27381619|ref|NP_773148.1| bll6508 [Bradyrhizobium japonicum U... 35 2.8
gi|34856790|ref|XP_342507.1| similar to H63 breast cancer expres... 31 3.2
gi|46138789|ref|XP_391085.1| hypothetical protein FG10909.1 [Gib... 34 3.6
gi|21673626|ref|NP_661691.1| band 7 family protein [Chlorobium t... 34 3.6
gi|49076854|ref|XP_402357.1| hypothetical protein UM04742.1 [Ust... 34 3.6
gi|17230980|ref|NP_487528.1| unknown protein [Nostoc sp. PCC 712... 34 3.6
gi|16120711|ref|NP_404024.1| putative membrane protein [Yersinia... 34 4.7
gi|46434119|gb|EAK93538.1| hypothetical protein CaO19.14207 [Can... 34 4.7
gi|17569493|ref|NP_509281.1| stomatin (sto-1) [Caenorhabditis el... 34 4.7
gi|39936552|ref|NP_948828.1| putative hflC protein [Rhodopseudom... 34 4.7
gi|47575404|ref|ZP_00245439.1| COG0330: Membrane protease subuni... 34 4.7
gi|48892493|ref|ZP_00325861.1| hypothetical protein Tery02004163... 34 4.7
gi|41689141|ref|ZP_00145676.1| COG0330: Membrane protease subuni... 34 4.7
gi|15232875|ref|NP_189437.1| pectinesterase family protein [Arab... 33 6.1
gi|42561923|ref|NP_172625.3| pectin methylesterase, putative [Ar... 33 6.1
gi|50085990|ref|YP_047500.1| conserved hypothetical protein; put... 33 6.1
gi|15241939|ref|NP_201080.1| band 7 family protein [Arabidopsis ... 33 6.1
gi|6554192|gb|AAF16638.1| T23J18.25 [Arabidopsis thaliana] 33 6.1
gi|21228135|ref|NP_634057.1| stomatin-like protein [Methanosarci... 33 8.0
gi|50414782|gb|AAH77295.1| Unknown (protein for MGC:80155) [Xeno... 33 8.0
gi|27904984|ref|NP_778110.1| HflC [Buchnera aphidicola (Baizongi... 33 8.0
gi|21356845|ref|NP_650147.1| CG31358-PA [Drosophila melanogaster... 33 8.0
gi|7447613|pir||T15971 hypothetical protein F08C6.4 - Caenorhabd... 33 8.0
>gi|17536479|ref|NP_495250.1| prohibitin precursor (2G543)
[Caenorhabditis elegans]
gi|1731266|sp|P50093|YWB1_CAEEL Hypothetical 31.8 kDa protein in
chromosome II
gi|25314495|pir||H88175 protein T24H7.1 [imported] - Caenorhabditis
elegans
gi|861323|gb|AAA68353.1| Hypothetical protein T24H7.1
[Caenorhabditis elegans]
Length = 286
Score = 484 bits (1246), Expect = e-135
Identities = 250/286 (87%), Positives = 250/286 (87%)
Frame = +1
Query: 1 MKKAIQNARXXXXXXXXXXXXXXXXXXXXQSMFTVEAGHRAIMFNRIGGLSTDLYKEGLH 180
MKKAIQNAR QSMFTVEAGHRAIMFNRIGGLSTDLYKEGLH
Sbjct: 1 MKKAIQNARGAGVGLGLVAAAGAAVYGVAQSMFTVEAGHRAIMFNRIGGLSTDLYKEGLH 60
Query: 181 FRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWE 360
FRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWE
Sbjct: 61 FRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIYRTLGQNWE 120
Query: 361 ERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAF 540
ERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAF
Sbjct: 121 ERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAF 180
Query: 541 SPQYSXXXXXXXXXXXXXXXXTFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKNDPGFL 720
SPQYS TFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKNDPGFL
Sbjct: 181 SPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEAMKNDPGFL 240
Query: 721 KLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDYLNVTDKRR 858
KLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDYLNVTDKRR
Sbjct: 241 KLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDYLNVTDKRR 286