Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T25E12_3
(1092 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17564684|ref|NP_507234.1| c-type lectin family member (5R217)... 694 0.0
gi|33300107|emb|CAE17834.1| Hypothetical protein F49A5.9 [Caenor... 380 e-104
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family... 358 2e-97
gi|34556084|emb|CAA19438.2| Hypothetical protein Y102A5B.2 [Caen... 353 5e-96
gi|17561198|ref|NP_507262.1| receptor 1 family member (5R344) [C... 346 6e-94
gi|50507778|emb|CAB04419.2| Hypothetical protein F49A5.7 [Caenor... 346 6e-94
gi|17566360|ref|NP_507256.1| predicted CDS, c-type lectin family... 335 1e-90
gi|32567058|ref|NP_507235.2| c-type lectin family member (41.9 k... 326 7e-88
gi|34556083|emb|CAA19437.2| Hypothetical protein Y102A5B.3 [Caen... 318 1e-85
gi|7508450|pir||T25279 hypothetical protein T25E12.9 - Caenorhab... 312 1e-83
gi|17564688|ref|NP_507233.1| c-type lectin family member (5R214)... 292 8e-78
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen... 291 2e-77
gi|17566362|ref|NP_507255.1| c-type lectin family member (5R330)... 289 9e-77
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)... 286 4e-76
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor... 284 2e-75
gi|34555888|emb|CAB04740.2| Hypothetical protein T20B3.12 [Caeno... 283 5e-75
gi|17564682|ref|NP_507236.1| predicted CDS, c-type lectin family... 280 3e-74
gi|17564474|ref|NP_507254.1| predicted CDS, c-type lectin family... 275 2e-72
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)... 258 2e-67
gi|17564472|ref|NP_507253.1| predicted CDS, c-type lectin family... 258 2e-67
gi|17561192|ref|NP_507260.1| c-type lectin family member (5R341)... 252 1e-65
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno... 221 2e-56
gi|17561190|ref|NP_507259.1| predicted CDS, c-type lectin family... 211 2e-53
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)... 198 2e-49
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno... 198 2e-49
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU... 195 1e-48
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno... 192 9e-48
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai... 189 1e-46
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 187 4e-46
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 187 4e-46
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai... 186 6e-46
gi|39582412|emb|CAE74796.1| Hypothetical protein CBG22627 [Caeno... 185 1e-45
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai... 185 1e-45
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai... 182 1e-44
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab... 181 3e-44
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno... 181 3e-44
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno... 179 8e-44
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 177 5e-43
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU... 175 2e-42
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno... 172 1e-41
gi|17537003|ref|NP_496687.1| CUB Sushi multiple domains 1 family... 170 5e-41
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai... 168 2e-40
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 165 2e-39
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai... 164 3e-39
gi|39587832|emb|CAE67850.1| Hypothetical protein CBG13437 [Caeno... 163 7e-39
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd... 160 5e-38
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai... 160 5e-38
gi|39593191|emb|CAE64660.1| Hypothetical protein CBG09432 [Caeno... 158 2e-37
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 157 5e-37
gi|39585605|emb|CAE65365.1| Hypothetical protein CBG10310 [Caeno... 156 9e-37
gi|39587833|emb|CAE67851.1| Hypothetical protein CBG13439 [Caeno... 154 5e-36
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 153 6e-36
gi|17507931|ref|NP_493198.1| c-type lectin family member (1N229)... 148 2e-34
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 145 1e-33
gi|39587021|emb|CAE62956.1| Hypothetical protein CBG07170 [Caeno... 145 2e-33
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d... 145 2e-33
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ... 145 2e-33
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 140 4e-32
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 140 5e-32
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 140 7e-32
gi|17559776|ref|NP_507557.1| c-type lectin and CUB domain contai... 138 3e-31
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 134 3e-30
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 130 7e-29
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd... 124 4e-27
gi|17566216|ref|NP_507227.1| c-type lectin and CUB domain contai... 120 7e-26
gi|39587020|emb|CAE62955.1| Hypothetical protein CBG07169 [Caeno... 118 3e-25
gi|17533765|ref|NP_494066.1| c-type lectin family member (2C33) ... 114 3e-24
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 114 3e-24
gi|39583087|emb|CAE60627.1| Hypothetical protein CBG04270 [Caeno... 112 2e-23
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 109 1e-22
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai... 108 2e-22
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno... 107 4e-22
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno... 107 6e-22
gi|39587018|emb|CAE62953.1| Hypothetical protein CBG07167 [Caeno... 103 9e-21
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel... 100 1e-19
gi|39592788|emb|CAE62402.1| Hypothetical protein CBG06489 [Caeno... 97 7e-19
gi|39582434|emb|CAE74818.1| Hypothetical protein CBG22654 [Caeno... 94 4e-18
gi|39585608|emb|CAE65368.1| Hypothetical protein CBG10313 [Caeno... 88 4e-16
gi|39585600|emb|CAE65360.1| Hypothetical protein CBG10305 [Caeno... 82 2e-14
gi|39587831|emb|CAE67849.1| Hypothetical protein CBG13436 [Caeno... 79 1e-13
gi|39588704|emb|CAE58228.1| Hypothetical protein CBG01325 [Caeno... 75 2e-12
gi|39580712|emb|CAE64098.1| Hypothetical protein CBG08706 [Caeno... 72 2e-11
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 69 1e-10
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|39583086|emb|CAE60626.1| Hypothetical protein CBG04269 [Caeno... 68 4e-10
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami... 67 7e-10
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 66 1e-09
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 65 2e-09
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 65 2e-09
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 65 3e-09
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron... 64 5e-09
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 63 1e-08
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 63 1e-08
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 62 3e-08
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 62 3e-08
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 62 3e-08
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 61 5e-08
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 60 9e-08
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 59 2e-07
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 59 2e-07
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 59 2e-07
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 58 3e-07
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re... 58 4e-07
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 57 6e-07
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 57 6e-07
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 57 6e-07
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 57 8e-07
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 56 1e-06
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 56 1e-06
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 56 1e-06
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 56 1e-06
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 56 1e-06
gi|181168|gb|AAA35726.1| proteoglycan core protein 56 1e-06
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 56 1e-06
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 55 2e-06
gi|33243076|gb|AAQ01208.1| C-type lectin CTL-5 [Bitis arietans] 55 3e-06
gi|3287904|sp|P81398|RHCB_AGKRH Rhodocetin beta subunit 55 3e-06
gi|48476198|gb|AAT44374.1| REJ1CRD2 [Strongylocentrotus francisc... 55 4e-06
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre... 54 6e-06
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 54 6e-06
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 54 8e-06
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 54 8e-06
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 54 8e-06
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 54 8e-06
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno... 53 1e-05
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 53 1e-05
gi|48476190|gb|AAT44370.1| REJ1CRD2 [Hemicentrotus pulcherrimus] 53 1e-05
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 53 1e-05
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 53 1e-05
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis] 53 1e-05
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT... 52 2e-05
gi|48476194|gb|AAT44372.1| REJ1CRD2 [Strongylocentrotus droebach... 52 2e-05
gi|26344636|dbj|BAC35967.1| unnamed protein product [Mus musculus] 52 3e-05
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [... 52 3e-05
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 52 3e-05
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 51 4e-05
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 51 4e-05
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 51 5e-05
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 51 5e-05
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 51 5e-05
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 51 5e-05
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai... 50 7e-05
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 50 7e-05
gi|6980876|pdb|1QDD|A Chain A, Crystal Structure Of Human Lithos... 50 7e-05
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 50 7e-05
gi|1942639|pdb|1LIT| Human Lithostathine 50 9e-05
gi|321190|pir||A45751 pancreatic stone protein precursor - human... 50 9e-05
gi|29725633|ref|NP_002900.2| regenerating islet-derived 1 alpha ... 50 9e-05
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 50 1e-04
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus] 49 2e-04
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 49 2e-04
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h... 49 2e-04
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 49 2e-04
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae... 49 2e-04
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|48476202|gb|AAT44376.1| REJ1CRD2 [Strongylocentrotus pallidus] 49 2e-04
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 49 3e-04
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 49 3e-04
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 49 3e-04
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 49 3e-04
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 49 3e-04
gi|26345454|dbj|BAC36378.1| unnamed protein product [Mus musculus] 49 3e-04
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 49 3e-04
gi|37993395|gb|AAR06853.1| C-type lectin-3 [Bitis gabonica] 49 3e-04
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 49 3e-04
gi|27670608|ref|XP_221686.1| similar to c-type lectin protein MT... 49 3e-04
gi|12851982|dbj|BAB29226.1| unnamed protein product [Mus musculus] 49 3e-04
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 49 3e-04
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 49 3e-04
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 49 3e-04
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 49 3e-04
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 49 3e-04
gi|26326981|dbj|BAC27234.1| unnamed protein product [Mus musculus] 49 3e-04
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 49 3e-04
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S... 48 3e-04
gi|33341192|gb|AAQ15157.1| factor IX/X binding protein beta chai... 48 5e-04
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 48 5e-04
gi|33341186|gb|AAQ15154.1| factor IX/X binding protein beta chai... 48 5e-04
gi|20977545|ref|NP_624360.1| chondrolectin [Mus musculus] >gnl|B... 48 5e-04
gi|10835248|ref|NP_006498.1| regenerating islet-derived 1 beta p... 48 5e-04
gi|190981|gb|AAA36559.1| regenerating protein (reg) 48 5e-04
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 47 6e-04
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 47 6e-04
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 47 8e-04
gi|48476214|gb|AAT44382.1| REJ3CRD [Allocentrotus fragilis] 47 8e-04
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 47 8e-04
gi|211655|gb|AAA48720.1| proteoglycan core protein 47 8e-04
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 47 0.001
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 47 0.001
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 47 0.001
gi|38493055|pdb|1UKM|A Chain A, Crystal Structure Of Ems16, An A... 47 0.001
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 47 0.001
gi|31879369|dbj|BAC77706.1| EMS16 A chain [Echis multisquamatus] 47 0.001
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 47 0.001
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 47 0.001
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 47 0.001
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 46 0.001
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 46 0.001
gi|38493075|pdb|1UOS|A Chain A, The Crystal Structure Of The Sna... 46 0.001
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 46 0.001
gi|25090033|sp|O93426|CVXA_CRODU Convulxin alpha precursor (CVX ... 46 0.001
gi|13445904|gb|AAK26430.1| agkisasin-b [Deinagkistrodon acutus] 46 0.001
gi|31559055|gb|AAP50528.1| agkisasin-b [Deinagkistrodon acutus] 46 0.001
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 46 0.002
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec... 46 0.002
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 46 0.002
gi|2851436|sp|P23807|IXB_TRIFL Coagulation factor IX/factor X-bi... 45 0.002
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 45 0.002
gi|39587017|emb|CAE62952.1| Hypothetical protein CBG07165 [Caeno... 45 0.002
gi|48110771|ref|XP_396277.1| similar to CG9138-PA [Apis mellifera] 45 0.002
gi|3212544|pdb|1IXX|B Chain B, Crystal Structure Of Coagulation ... 45 0.002
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 45 0.002
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 45 0.003
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 45 0.003
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 45 0.003
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 45 0.003
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 45 0.003
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 45 0.004
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 45 0.004
gi|33243102|gb|AAQ01221.1| C-type lectin CTL-7 [Echis pyramidum ... 45 0.004
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 44 0.005
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 44 0.005
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 44 0.005
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres... 44 0.005
gi|3287903|sp|P81397|RHCA_AGKRH Rhodocetin alpha subunit 44 0.005
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 44 0.005
gi|206105|gb|AAA41836.1| proteoglycan 44 0.005
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 44 0.007
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 44 0.007
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 44 0.007
gi|1143285|gb|AAA87847.1| brevican core protein 44 0.007
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 44 0.007
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 44 0.007
gi|48476210|gb|AAT44380.1| REJ2CRD [Strongylocentrotus francisca... 44 0.007
gi|33638231|gb|AAQ24216.1| coagulation factor IX-binding protein... 44 0.007
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 44 0.007
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 44 0.007
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 44 0.007
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 44 0.007
gi|12060181|dbj|BAB20441.1| anticoagulant protein-B [Deinagkistr... 44 0.009
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 44 0.009
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 44 0.009
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 44 0.009
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 44 0.009
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 44 0.009
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 44 0.009
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 44 0.009
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr... 44 0.009
gi|14719571|pdb|1IOD|B Chain B, Crystal Structure Of The Complex... 44 0.009
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 44 0.009
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 44 0.009
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 44 0.009
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ... 43 0.011
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 43 0.011
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 43 0.011
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 43 0.011
gi|8809812|gb|AAF79952.1| aggretin alpha chain [Calloselasma rho... 43 0.011
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 43 0.011
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 43 0.011
gi|7512195|pir||PC7027 aggretin alpha chain - Malayan pit viper ... 43 0.011
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 43 0.011
gi|17552078|ref|NP_499148.1| predicted CDS, lectin 2b like famil... 43 0.011
gi|665485|gb|AAA96811.1| tetranectin 43 0.011
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari... 43 0.011
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari... 43 0.011
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ... 43 0.011
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a... 43 0.011
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 43 0.011
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans] 43 0.015
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 43 0.015
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 43 0.015
gi|11093809|gb|AAG29426.1| immunoreceptor NKG2D [Sus scrofa] 43 0.015
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 43 0.015
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 43 0.015
gi|39580361|emb|CAE61466.1| Hypothetical protein CBG05359 [Caeno... 43 0.015
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 43 0.015
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno... 43 0.015
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 43 0.015
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 43 0.015
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 43 0.015
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 43 0.015
gi|189601|gb|AAA36415.1| pancreatitis associated protein 43 0.015
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 43 0.015
gi|3212622|pdb|1TN3| The C-Type Lectin Carbohydrate Recognition... 43 0.015
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 43 0.015
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 43 0.015
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 42 0.019
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 42 0.019
gi|4505605|ref|NP_002571.1| pancreatitis-associated protein prec... 42 0.019
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 42 0.019
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 42 0.019
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 42 0.019
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 42 0.019
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote... 42 0.019
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus] 42 0.019
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC... 42 0.019
gi|42543880|pdb|1UV0|A Chain A, Pancreatitis-Associated Protein ... 42 0.019
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp... 42 0.019
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus] 42 0.019
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 42 0.019
gi|11967287|gb|AAG42041.1| agkicetin beta subunit precursor [Dei... 42 0.025
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus] 42 0.025
gi|17540462|ref|NP_500454.1| c-type lectin and low density lipop... 42 0.025
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 42 0.025
gi|32264366|gb|AAP78681.1| MBCTL2 [Monosiga brevicollis] 42 0.025
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 42 0.025
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 42 0.025
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 42 0.025
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ... 42 0.025
gi|35396744|gb|AAQ84879.1| latrophilin-like protein LAT-2 [Caeno... 42 0.025
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 42 0.025
gi|7494834|pir||T15308 hypothetical protein B0286.2 - Caenorhabd... 42 0.025
gi|37993393|gb|AAR06852.1| C-type lectin-2 [Bitis gabonica] 42 0.025
gi|50744990|ref|XP_426207.1| PREDICTED: similar to collectin sub... 42 0.025
gi|38049424|ref|XP_283054.2| collectin sub-family member 11 [Mus... 42 0.033
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 42 0.033
gi|34851945|ref|XP_344774.1| similar to C-type lectin superfamil... 42 0.033
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 41 0.043
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 41 0.043
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus] 41 0.043
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre... 41 0.043
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 41 0.043
gi|17568961|ref|NP_508518.1| conglutinin like family member (35.... 41 0.043
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd... 41 0.043
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 41 0.056
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina] 41 0.056
gi|28488673|ref|XP_286121.1| similar to C-type lectin superfamil... 41 0.056
gi|34863397|ref|XP_345653.1| similar to hypothetical protein MGC... 40 0.073
gi|7512196|pir||JC7105 aggretin beta chain - Malayan pit viper >... 40 0.073
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ... 40 0.073
gi|1091923|prf||2022211A asialoglycoprotein receptor 40 0.073
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2) 40 0.073
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1 40 0.073
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 40 0.095
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof... 40 0.095
gi|13128972|ref|NP_076932.1| collectin sub-family member 11 isof... 40 0.095
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum] 40 0.095
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod... 40 0.095
gi|48476220|gb|AAT44385.1| REJ3CRD [Strongylocentrotus francisca... 40 0.095
gi|14579651|gb|AAK69351.1| akitonin precursor [Deinagkistrodon a... 40 0.095
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ... 40 0.095
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H... 40 0.12
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 40 0.12
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 40 0.12
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 40 0.12
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ... 40 0.12
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 40 0.12
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 40 0.12
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H... 40 0.12
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 40 0.12
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 40 0.12
gi|48476222|gb|AAT44386.1| REJ3CRD [Strongylocentrotus pallidus] 40 0.12
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl... 40 0.12
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 40 0.12
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 40 0.12
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 40 0.12
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 40 0.12
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 40 0.12
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 40 0.12
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 40 0.12
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus] 40 0.12
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 39 0.16
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 39 0.16
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an... 39 0.16
gi|37575443|gb|AAQ93686.1| mucrocetin alpha chain [Protobothrops... 39 0.16
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 39 0.16
gi|48476200|gb|AAT44375.1| REJ1CRD1 [Strongylocentrotus pallidus] 39 0.16
gi|444786|prf||1908220B pancreatitis-associated protein 39 0.21
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 39 0.21
gi|17560376|ref|NP_508027.1| bone morphogenetic protein 1 family... 39 0.21
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno... 39 0.21
gi|39655009|pdb|1V4L|A Chain A, Crystal Structure Of A Platelet ... 39 0.21
gi|25527245|pir||JC7786 lectin CEL-I, N-acetyl-D-galactosamine-s... 39 0.21
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 39 0.21
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 39 0.21
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno... 39 0.21
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 39 0.21
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 39 0.21
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 39 0.21
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 39 0.28
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho... 39 0.28
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 39 0.28
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 39 0.28
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 39 0.28
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien... 39 0.28
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg... 39 0.28
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu... 39 0.28
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ... 39 0.28
gi|14042980|ref|NP_114433.1| regenerating islet-derived family, ... 39 0.28
gi|21260582|gb|AAM43808.1| C-type lectin-like protein TMVA A cha... 39 0.28
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 39 0.28
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 39 0.28
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m... 39 0.28
gi|3023232|sp|P81114|ABA4_TRIAB Alboaggregin A subunit 4 39 0.28
gi|48476192|gb|AAT44371.1| REJ1CRD1 [Strongylocentrotus droebach... 39 0.28
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 39 0.28
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha... 38 0.36
gi|49456831|emb|CAG46736.1| UNQ429 [Homo sapiens] 38 0.36
gi|38348213|ref|NP_940850.1| LPPM429 [Homo sapiens] >gnl|BL_ORD_... 38 0.36
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula] 38 0.36
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 38 0.36
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ... 38 0.36
gi|16923238|gb|AAL29935.1| scarf3b [Girardia tigrina] 38 0.36
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ... 38 0.36
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres... 38 0.47
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres... 38 0.47
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2 38 0.47
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 38 0.47
gi|33341202|gb|AAQ15162.1| stejaggregin-B alpha chain-3 [Trimere... 38 0.47
gi|39587876|emb|CAE67894.1| Hypothetical protein CBG13490 [Caeno... 38 0.47
gi|6679052|ref|NP_031386.1| NKG2-D type II integral membrane pro... 37 0.62
gi|45430003|ref|NP_991356.1| pancreatic thread protein [Bos taur... 37 0.62
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 37 0.62
gi|17565466|ref|NP_507951.1| lithostathine like family member (5... 37 0.62
gi|5031637|ref|NP_005743.1| C-type lectin, superfamily member 1 ... 37 0.62
gi|399125|sp|P22029|BOTA_BOTJA Botrocetin, alpha chain (Platelet... 37 0.62
gi|26352257|dbj|BAC39765.1| unnamed protein product [Mus musculus] 37 0.62
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno... 37 0.62
gi|27734228|sp|P81508|CHBA_CROHO CHH-B alpha subunit 37 0.62
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O... 37 0.62
gi|38090330|ref|XP_146887.2| similar to layilin [Mus musculus] 37 0.62
gi|27465527|ref|NP_775120.1| pancreatitis-associated protein 3 [... 37 0.62
gi|135619|sp|P26258|TETN_CARSP Tetranectin-like protein >gnl|BL_... 37 0.62
gi|37181877|gb|AAQ88742.1| CLECSF1 [Homo sapiens] 37 0.62
gi|39597674|emb|CAE68365.1| Hypothetical protein CBG14118 [Caeno... 37 0.81
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina] 37 0.81
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub... 37 0.81
gi|48476216|gb|AAT44383.1| REJ3CRD [Hemicentrotus pulcherrimus] 37 0.81
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin... 37 0.81
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 37 0.81
gi|6754980|ref|NP_035166.1| pancreatitis-associated protein; Reg... 37 1.1
gi|9295443|gb|AAF86973.1| NK cell receptor D [Homo sapiens] 37 1.1
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus... 37 1.1
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens] 37 1.1
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II... 37 1.1
gi|39595091|emb|CAE60128.1| Hypothetical protein CBG03673 [Caeno... 37 1.1
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n... 37 1.1
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n... 36 1.4
gi|30749494|pdb|1MPU|A Chain A, Crystal Structure Of The Free Hu... 36 1.4
gi|225342|prf||1301209A lectin 36 1.4
gi|7387836|sp|Q26422|LFC_CARRO Limulus clotting factor C precurs... 36 1.4
gi|913964|gb|AAB34362.1| factor C [Carcinoscorpius rotundicauda] 36 1.4
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica] 36 1.4
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 36 1.4
gi|7507866|pir||T32254 hypothetical protein T15B7.9 - Caenorhabd... 36 1.4
gi|20562931|gb|AAM22783.1| C-type lectin [Deinagkistrodon acutus] 36 1.4
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 36 1.4
gi|18158646|pdb|1KCG|A Chain A, Nkg2d In Complex With Ulbp3 >gnl... 36 1.4
gi|40363429|dbj|BAD06213.1| pancreatitis-associated protein [Can... 36 1.4
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 36 1.4
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 36 1.4
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 36 1.4
gi|14488773|pdb|1HYR|B Chain B, Crystal Structure Of Human Mica ... 36 1.4
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 36 1.8
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 36 1.8
gi|48476188|gb|AAT44369.1| REJ1CRD1 [Hemicentrotus pulcherrimus] 36 1.8
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno... 36 1.8
gi|50793953|ref|XP_423644.1| PREDICTED: similar to C-type lectin... 35 2.3
gi|27807147|ref|NP_777058.1| domain) lectin, superfamily member ... 35 2.3
gi|6677869|ref|NP_033157.1| stem cell growth factor precursor [M... 35 2.3
gi|47222448|emb|CAG12968.1| unnamed protein product [Tetraodon n... 35 2.3
gi|26335441|dbj|BAC31421.1| unnamed protein product [Mus musculus] 35 2.3
gi|20271378|gb|AAM18623.1| C-type lectin domain protein [Heterod... 35 2.3
gi|47195820|emb|CAF88787.1| unnamed protein product [Tetraodon n... 35 2.3
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 35 3.1
gi|399040|sp|Q01758|ANP_OSMMO Type II antifreeze protein precurs... 35 3.1
gi|7110216|gb|AAF36830.1| C-type lectin-like receptor-1 [Homo sa... 35 3.1
gi|37577103|ref|NP_057595.2| C-type lectin-like receptor-1 [Homo... 35 3.1
gi|21902299|gb|AAM78504.1| natural killer cell lectin-like recep... 35 3.1
gi|22760992|dbj|BAC11410.1| unnamed protein product [Homo sapien... 35 3.1
gi|47208881|emb|CAF98183.1| unnamed protein product [Tetraodon n... 35 3.1
gi|33417124|gb|AAH56052.1| Colec11-prov protein [Xenopus laevis] 35 3.1
gi|48476184|gb|AAT44367.1| REJ1CRD1 [Allocentrotus fragilis] 35 3.1
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 35 3.1
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 35 3.1
gi|27806737|ref|NP_776420.1| attractin [Bos taurus] >gnl|BL_ORD_... 35 3.1
gi|17551160|ref|NP_509202.1| lithostathine like precursor family... 35 3.1
gi|9295439|gb|AAF86971.1| NK cell receptor D [Pan troglodytes] 35 4.0
gi|21902297|gb|AAM78503.1| natural killer cell lectin-like recep... 35 4.0
gi|3108091|gb|AAC15766.1| neurocan [Rattus norvegicus] 35 4.0
gi|39590774|emb|CAE65147.1| Hypothetical protein CBG10013 [Caeno... 35 4.0
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 35 4.0
gi|34856178|ref|XP_344889.1| stem cell growth factor [Rattus nor... 35 4.0
gi|10445213|gb|AAG16631.1| proteoglycan PG-M V3 isoform [Rattus ... 35 4.0
gi|47214950|emb|CAG10772.1| unnamed protein product [Tetraodon n... 35 4.0
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 34 5.2
gi|48860746|ref|ZP_00314655.1| COG0424: Nucleotide-binding prote... 34 5.2
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus] 34 5.2
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B... 34 5.2
gi|4505501|ref|NP_002534.1| oxidised low density lipoprotein (le... 34 5.2
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 34 5.2
gi|17531273|ref|NP_494770.1| LATrophilin receptor homolog, Latro... 34 5.2
gi|24266774|gb|AAN52336.1| nematocyst outer wall antigen precurs... 34 5.2
gi|85534|pir||JH0626 antifreeze protein II precursor - rainbow s... 34 6.8
gi|16923227|gb|AAL29934.1| lectin 2b [Girardia tigrina] 34 6.8
gi|129626|sp|P25031|PAP1_RAT Pancreatitis-associated protein 1 p... 34 6.8
gi|254695|gb|AAB23103.1| Reg-2 [Rattus sp.] 34 6.8
gi|9800611|gb|AAB33848.2| peptide 23; pancreatitis-associated pr... 34 6.8
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor... 34 6.8
>gi|17564684|ref|NP_507234.1| c-type lectin family member (5R217)
[Caenorhabditis elegans]
gi|7508449|pir||T25278 hypothetical protein T25E12.8 - Caenorhabditis
elegans
gi|3880230|emb|CAB04826.1| Hypothetical protein T25E12.8
[Caenorhabditis elegans]
Length = 363
Score = 694 bits (1791), Expect = 0.0
Identities = 326/363 (89%), Positives = 326/363 (89%)
Frame = +1
Query: 1 MPGCLPSVFEKWSQFLKFHRRXXXXXXXXXXXXXXXXXXXXYCLTKQPACEIYTGTSSPA 180
MPGCLPSVFEKWSQFLKFHRR YCLTKQPACEIYTGTSSPA
Sbjct: 1 MPGCLPSVFEKWSQFLKFHRRIILIGGASEIIIITVAVIVTYCLTKQPACEIYTGTSSPA 60
Query: 181 FQTSTVSSFTESLSNSDXXXXXXXXXXXXXXXXXGKIPPNNITCAVGFTYINHKCWRLFT 360
FQTSTVSSFTESLSNSD GKIPPNNITCAVGFTYINHKCWRLFT
Sbjct: 61 FQTSTVSSFTESLSNSDTSPASTTTEPLPTSSTPGKIPPNNITCAVGFTYINHKCWRLFT 120
Query: 361 DLQTRENADGACMRYGGSTLFSIRNEQENNAMLGFMLNAGVDNLWTGLICVGKTTFSCTW 540
DLQTRENADGACMRYGGSTLFSIRNEQENNAMLGFMLNAGVDNLWTGLICVGKTTFSCTW
Sbjct: 121 DLQTRENADGACMRYGGSTLFSIRNEQENNAMLGFMLNAGVDNLWTGLICVGKTTFSCTW 180
Query: 541 DMESGTTSVYNSFASESPDNTYGNCVYFIITGTQAGQWKSGLCNMTMSFVCELPPTVHDK 720
DMESGTTSVYNSFASESPDNTYGNCVYFIITGTQAGQWKSGLCNMTMSFVCELPPTVHDK
Sbjct: 181 DMESGTTSVYNSFASESPDNTYGNCVYFIITGTQAGQWKSGLCNMTMSFVCELPPTVHDK 240
Query: 721 NCINNYNNHCYLRYDDSDTVVEAQRFCNTKCANLVSIHSANENRFIQTIYYVDGYIALGA 900
NCINNYNNHCYLRYDDSDTVVEAQRFCNTKCANLVSIHSANENRFIQTIYYVDGYIALGA
Sbjct: 241 NCINNYNNHCYLRYDDSDTVVEAQRFCNTKCANLVSIHSANENRFIQTIYYVDGYIALGA 300
Query: 901 VAPIIDYIVWMDGSPQLYNNIQDNSNGTCVFMRILWGGAGYWYTIDCVKRSWFLCKRPAG 1080
VAPIIDYIVWMDGSPQLYNNIQDNSNGTCVFMRILWGGAGYWYTIDCVKRSWFLCKRPAG
Sbjct: 301 VAPIIDYIVWMDGSPQLYNNIQDNSNGTCVFMRILWGGAGYWYTIDCVKRSWFLCKRPAG 360
Query: 1081 IVC 1089
IVC
Sbjct: 361 IVC 363