Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T27E4_8
(438 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17562026|ref|NP_505354.1| heat shock protein (hsp-16.1) [Caen... 287 3e-77
gi|156334|gb|AAA28066.1| heat shock protein 16-1 [Caenorhabditis... 283 7e-76
gi|17562028|ref|NP_503507.1| heat shock protein (hsp-16.2) [Caen... 266 5e-71
gi|39594517|emb|CAE72095.1| Hypothetical protein CBG19186 [Caeno... 221 2e-57
gi|39589895|emb|CAE60893.1| Hypothetical protein CBG04608 [Caeno... 212 1e-54
gi|39589881|emb|CAE60879.1| Hypothetical protein CBG04591 [Caeno... 212 1e-54
gi|39594515|emb|CAE72093.1| Hypothetical protein CBG19184 [Caeno... 207 5e-53
gi|17559396|ref|NP_506586.1| alpha crystallin family member (5O9... 160 5e-39
gi|39589893|emb|CAE60891.1| Hypothetical protein CBG04606 [Caeno... 160 7e-39
gi|39594516|emb|CAE72094.1| Hypothetical protein CBG19185 [Caeno... 122 2e-27
gi|17562034|ref|NP_505355.1| heat shock protein (16.3 kD) (hsp-1... 118 3e-26
gi|6757|emb|CAA25731.1| C-terminal fragment of hsp 16-48 [Caenor... 118 3e-26
gi|39589892|emb|CAE60890.1| Hypothetical protein CBG04605 [Caeno... 117 4e-26
gi|156335|gb|AAA28067.1| heat shock protein 16-48a [Caenorhabdit... 117 5e-26
gi|39594518|emb|CAE72096.1| Hypothetical protein CBG19187 [Caeno... 117 5e-26
gi|39589882|emb|CAE60880.1| Hypothetical protein CBG04592 [Caeno... 114 3e-25
gi|39589894|emb|CAE60892.1| Hypothetical protein CBG04607 [Caeno... 114 5e-25
gi|123542|sp|P06581|HS16_CAEEL Heat shock protein HSP16-41 >gnl|... 112 1e-24
gi|156339|gb|AAA28070.1| heat shock protein 16-41 112 2e-24
gi|32566121|ref|NP_872116.1| heat shock protein (hsp-16.41) [Cae... 111 3e-24
gi|33413599|gb|AAN05752.1| heat shock protein 20 [Haemonchus con... 111 4e-24
gi|780186|emb|CAA25732.1| unnamed protein product [Caenorhabditi... 110 5e-24
gi|46020007|emb|CAG25499.1| heat shock protein 20 [Ostertagia os... 105 3e-22
gi|39591876|emb|CAE71454.1| Hypothetical protein CBG18371 [Caeno... 104 4e-22
gi|17554792|ref|NP_499316.1| stress Induced Protein SIP-1, heat ... 104 4e-22
gi|17559394|ref|NP_506585.1| heat shock protein family member (5... 101 3e-21
gi|585269|sp|Q07160|HS20_NIPBR HEAT SHOCK PROTEIN HOMOLOG (HSP20... 93 1e-18
gi|50344355|emb|CAF02105.1| alphaB-crystallin [Tachyglossus acul... 77 6e-14
gi|50344353|emb|CAF02104.1| alphaB-crystallin [Ornithorhynchus a... 77 1e-13
gi|47678126|emb|CAE83570.1| small heat shock protein 24.1 [Branc... 76 2e-13
gi|45384008|ref|NP_990507.1| alpha B-crystallin [Gallus gallus] ... 76 2e-13
gi|6166128|sp|Q05713|CRAB_CHICK Alpha crystallin B chain (Alpha(... 76 2e-13
gi|1518125|gb|AAB07020.1| small heat shock protein [Brugia malayi] 76 2e-13
gi|6014726|sp|Q91312|CRAB_RANCA Alpha crystallin B chain (Alpha(... 75 4e-13
gi|544093|sp|Q05557|CRAB_ANAPL Alpha crystallin B chain (Alpha(B... 74 5e-13
gi|50344361|emb|CAF02108.1| alphaB-crystallin [Elephas maximus] 74 8e-13
gi|50344357|emb|CAF02106.1| alphaB-crystallin [Didelphis marsupi... 73 1e-12
gi|27805849|ref|NP_776715.1| crystallin, alpha polypeptide 2 [Bo... 72 2e-12
gi|17561234|ref|NP_505165.1| heat shock protein (17.6 kD) (hsp-1... 72 3e-12
gi|34146976|gb|AAQ62453.1| Heat shock protein protein 17, isofor... 72 3e-12
gi|13162243|emb|CAC33095.1| alphaB-crystallin [Nannospalax ehren... 71 4e-12
gi|30387800|gb|AAP31996.1| alpha B-crystallin [Rattus sp.] 71 4e-12
gi|16905067|ref|NP_037067.1| crystallin, alpha B; Crystallin, al... 71 4e-12
gi|57580|emb|CAA42911.1| alpha B-crystallin [Rattus rattus] 71 4e-12
gi|50344359|emb|CAF02107.1| alphaB-crystallin [Macropus rufus] 71 5e-12
gi|2119188|pir||I48171 alpha-crystallin B chain - golden hamster... 71 5e-12
gi|117386|sp|P05811|CRAB_MESAU Alpha crystallin B chain (Alpha(B... 71 5e-12
gi|17550410|ref|NP_509045.1| heat shock protein (43.2 kD) (hsp-4... 70 7e-12
gi|729207|sp|P41316|CRAB_RABIT Alpha crystallin B chain (Alpha(B... 70 7e-12
gi|30584657|gb|AAP36581.1| Homo sapiens crystallin, alpha B [syn... 70 1e-11
gi|2852648|gb|AAC19161.1| unknown [Homo sapiens] 70 1e-11
gi|7441290|pir||JC5971 alpha-b crystallin - pig 70 1e-11
gi|4503057|ref|NP_001876.1| crystallin, alpha B; heat-shock 20 k... 70 1e-11
gi|6753530|ref|NP_034094.1| crystallin, alpha B; crystallin, alp... 70 1e-11
gi|31199319|ref|XP_308607.1| ENSANGP00000019412 [Anopheles gambi... 69 2e-11
gi|39585802|emb|CAE61215.1| Hypothetical protein CBG05009 [Caeno... 69 2e-11
gi|48141961|ref|XP_397286.1| similar to ENSANGP00000018891 [Apis... 69 2e-11
gi|46576644|sp|Q9EPF3|CRAB_SPAJD Alpha crystallin B chain (Alpha... 69 2e-11
gi|48103834|ref|XP_395659.1| similar to ENSANGP00000018891 [Apis... 69 3e-11
gi|11120618|gb|AAG30944.1| heat shock protein hsp20.8 [Bombyx mo... 69 3e-11
gi|266715|sp|P29779|OV22_ONCVO SMALL HEAT SHOCK PROTEIN OV25-2 68 3e-11
gi|345387|pir||S29693 OV25-2 protein - nematode (Onchocerca volv... 68 3e-11
gi|117389|sp|P02512|CRAB_SQUAC Alpha crystallin B chain (Alpha(B... 68 3e-11
gi|31199323|ref|XP_308609.1| ENSANGP00000018813 [Anopheles gambi... 67 6e-11
gi|49036077|gb|AAG30945.2| heat shock protein hsp20.4 [Bombyx mori] 67 8e-11
gi|31213211|ref|XP_315549.1| ENSANGP00000017611 [Anopheles gambi... 67 8e-11
gi|31213213|ref|XP_315550.1| ENSANGP00000017610 [Anopheles gambi... 67 8e-11
gi|10242308|gb|AAG15376.1| small heat shock protein [Anopheles g... 67 1e-10
gi|1362582|pir||S57399 small heat shock protein - nematode (Brug... 66 1e-10
gi|31199317|ref|XP_308606.1| ENSANGP00000018891 [Anopheles gambi... 66 1e-10
gi|117370|sp|P02505|CRAA_RHEAM Alpha crystallin A chain >gnl|BL_... 66 2e-10
gi|224131|prf||1010303Q crystallin alphaA 66 2e-10
gi|23308655|ref|NP_694482.1| crystallin, alpha A; [a]A-crystalli... 65 2e-10
gi|224125|prf||1010303J crystallin alphaA 65 2e-10
gi|45384222|ref|NP_990621.1| inhibitor of actin polymerization [... 65 3e-10
gi|17737499|ref|NP_523827.1| CG4533-PA [Drosophila melanogaster]... 65 3e-10
gi|6014722|sp|O93591|CRAA_ASTFA Alpha crystallin A chain >gnl|BL... 65 3e-10
gi|3913373|sp|Q90497|CRAA_EUDEL ALPHA CRYSTALLIN A CHAIN >gnl|BL... 65 4e-10
gi|48095014|ref|XP_394333.1| similar to ENSANGP00000018891 [Apis... 65 4e-10
gi|47226771|emb|CAG06613.1| unnamed protein product [Tetraodon n... 64 5e-10
gi|1706113|sp|P02488|CRAA_MACMU Alpha crystallin A chain 64 5e-10
gi|17737553|ref|NP_523999.1| CG4463-PA [Drosophila melanogaster]... 64 5e-10
gi|50344349|emb|CAF02102.1| alphaA-crystallin [Sphenodon punctatus] 64 6e-10
gi|224117|prf||1010303A crystallin alphaA 64 6e-10
gi|6016257|sp|O13224|HSB1_POELU Heat-shock protein beta-1 (HspB1... 64 8e-10
gi|3913363|sp|O12988|CRAA_COLLI ALPHA CRYSTALLIN A CHAIN >gnl|BL... 63 1e-09
gi|50344351|emb|CAF02103.1| alphaA-crystallin [Lygodactylus pict... 63 1e-09
gi|47223753|emb|CAF98523.1| unnamed protein product [Tetraodon n... 63 1e-09
gi|4589828|dbj|BAA76897.1| alpha A crystallin [Xenopus laevis] 63 1e-09
gi|71455|pir||CYMQAA alpha-crystallin chain A - rhesus macaque (... 63 1e-09
gi|117336|sp|P02482|CRAA_ARTJA Alpha crystallin A chain >gnl|BL_... 63 1e-09
gi|29825385|gb|AAO92281.1| putative heat shock-related protein [... 63 1e-09
gi|39590320|emb|CAE66059.1| Hypothetical protein CBG11272 [Caeno... 63 1e-09
gi|266714|sp|P29778|OV21_ONCVO SMALL HEAT SHOCK PROTEIN OV25-1 63 1e-09
gi|345386|pir||S29692 OV25-1 protein - nematode (Onchocerca volv... 63 1e-09
gi|117381|sp|P02506|CRAA_TUPTE Alpha crystallin A chain >gnl|BL_... 63 1e-09
gi|224121|prf||1010303E crystallin alphaA >gnl|BL_ORD_ID|254561 ... 63 1e-09
gi|50344345|emb|CAF02100.1| alphaA-crystallin [Ornithorhynchus a... 62 2e-09
gi|50730021|ref|XP_416753.1| PREDICTED: similar to Alpha crystal... 62 2e-09
gi|71489|pir||HHFF23 heat shock protein 23 - fruit fly (Drosophi... 62 2e-09
gi|117346|sp|P02503|CRAA_DIDMA Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|224129|prf||1010303N crystallin alphaA 62 2e-09
gi|117344|sp|P02504|CRAA_CHICK Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|3121936|sp|Q91517|CRAA_TRASC ALPHA CRYSTALLIN A CHAIN >gnl|BL... 62 2e-09
gi|345374|pir||S29691 AV25 protein - nematode (Acanthocheilonema... 62 2e-09
gi|224123|prf||1010303G crystallin alphaA 62 2e-09
gi|117356|sp|P02492|CRAA_OCHPR Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|224120|prf||1010303D crystallin alphaA >gnl|BL_ORD_ID|1815255... 62 2e-09
gi|1706114|sp|P02493|CRAA_RABIT Alpha crystallin A chain >gnl|BL... 62 2e-09
gi|224118|prf||1010303B crystallin alphaA 62 2e-09
gi|71464|pir||CYRBAA alpha-crystallin chain A - rabbit >gnl|BL_O... 62 2e-09
gi|117350|sp|P02494|CRAA_EULFU Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|117342|sp|P02491|CRAA_CAVPO Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|224130|prf||1010303P crystallin alphaA 62 2e-09
gi|224119|prf||1010303C crystallin alphaA 62 2e-09
gi|117353|sp|P02502|CRAA_MACRU Alpha crystallin A chain >gnl|BL_... 62 2e-09
gi|117339|sp|P02487|CRAA_BRAVA Alpha crystallin A chain >gnl|BL_... 62 3e-09
gi|6014725|sp|Q64211|CRAA_SPAEH Alpha crystallin A chain, major ... 62 3e-09
gi|123569|sp|P15991|HSB1_CRILO Heat-shock protein beta-1 (HspB1)... 61 4e-09
gi|49670440|gb|AAH75197.1| Unknown (protein for MGC:83413) [Xeno... 61 4e-09
gi|2459696|gb|AAC36146.1| alpha-crystallin cognate protein 25 [P... 61 4e-09
gi|18858475|ref|NP_571232.1| crystallin, alpha B [Danio rerio] >... 61 4e-09
gi|7305173|ref|NP_038588.1| heat shock protein 1; heat shock pro... 61 4e-09
gi|424145|gb|AAA18336.1| heat shock protein HSP27 61 4e-09
gi|1170367|sp|P42930|HSB1_RAT Heat-shock protein beta-1 (HspB1) ... 61 4e-09
gi|3913361|sp|O12984|CRAA_ANAPL ALPHA CRYSTALLIN A CHAIN >gnl|BL... 61 4e-09
gi|547679|sp|P14602|HSB1_MOUSE Heat-shock protein beta-1 (HspB1)... 61 4e-09
gi|10946521|gb|AAG23867.1| alpha-B crystallin [Clarias batrachus... 61 4e-09
gi|424147|gb|AAA18337.1| heat shock protein 27 61 4e-09
gi|32697971|emb|CAA83227.2| Hypothetical protein ZK1128.7 [Caeno... 61 4e-09
gi|27805855|ref|NP_776714.1| crystallin, alpha A [Bos taurus] >g... 61 4e-09
gi|117347|sp|P02471|CRAA_GIRCA Alpha crystallin A chain >gnl|BL_... 61 4e-09
gi|117359|sp|P02477|CRAA_PHOPH Alpha crystallin A chain >gnl|BL_... 61 4e-09
gi|117354|sp|P02484|CRAA_MANJA Alpha crystallin A chain >gnl|BL_... 61 4e-09
gi|14010865|ref|NP_114176.1| heat shock 27kDa protein 1; Heat sh... 61 4e-09
gi|117334|sp|P15990|CRA2_SPAEH Alpha crystallin A chain, minor c... 61 4e-09
gi|117360|sp|P02475|CRAA_PIG Alpha crystallin A chain >gnl|BL_OR... 61 4e-09
gi|224128|prf||1010303M crystallin alphaA 61 4e-09
gi|117337|sp|P02474|CRAA_BALAC Alpha crystallin A chain >gnl|BL_... 61 4e-09
gi|13431419|sp|P82531|CRAA_PTEPO Alpha crystallin A chain 61 4e-09
gi|12743945|gb|AAK06407.1| alpha-crystallin [Bombyx mori] 61 5e-09
gi|13625983|gb|AAK35217.1| unknown [Paragonimus westermani] 61 5e-09
gi|42540942|gb|AAS19361.1| egg antigen [Paragonimus westermani] 61 5e-09
gi|48141959|ref|XP_393576.1| similar to ENSANGP00000018891 [Apis... 61 5e-09
gi|15126735|gb|AAH12292.1| Heat shock 27kDa protein 1 [Homo sapi... 61 5e-09
gi|117358|sp|P02495|CRAA_PERPO Alpha crystallin A chain >gnl|BL_... 61 5e-09
gi|662841|gb|AAA62175.1| heat shock protein 27 [Homo sapiens] 60 7e-09
gi|15928913|gb|AAH14920.1| Unknown (protein for IMAGE:3906970) [... 60 7e-09
gi|809074|emb|CAA24530.1| crystallin [Rattus norvegicus] 60 7e-09
gi|1170366|sp|P42929|HSB1_CANFA Heat-shock protein beta-1 (HspB1... 60 7e-09
gi|387134|gb|AAA37471.1| alpha-A-crystallin 60 7e-09
gi|71468|pir||CYRTAM alpha-crystallin chain A, minor component -... 60 7e-09
gi|117343|sp|P02479|CRAA_CERSI Alpha crystallin A chain >gnl|BL_... 60 7e-09
gi|19526477|ref|NP_036666.2| crystallin, alpha A; Crystallin, al... 60 7e-09
gi|117373|sp|P02476|CRAA_TAPIN Alpha crystallin A chain >gnl|BL_... 60 7e-09
gi|30794510|ref|NP_038529.1| crystallin, alpha A; lens opacity 1... 60 7e-09
gi|117333|sp|P24623|CRA2_RAT Alpha crystallin A chain, minor com... 60 7e-09
gi|4504517|ref|NP_001531.1| heat shock 27kDa protein 1; heat sho... 60 7e-09
gi|17647527|ref|NP_523994.1| CG4190-PA [Drosophila melanogaster]... 60 9e-09
gi|39590666|emb|CAE65036.1| Hypothetical protein CBG09876 [Caeno... 60 9e-09
gi|71469|pir||CYHYAM alpha-crystallin chain A, minor component -... 60 9e-09
gi|117382|sp|P02480|CRAA_URSUR Alpha crystallin A chain >gnl|BL_... 60 9e-09
gi|117331|sp|P02497|CRA2_MESAU Alpha crystallin A chain, minor c... 60 9e-09
gi|4503055|ref|NP_000385.1| crystallin, alpha A; crystallin, alp... 60 9e-09
gi|117345|sp|P02486|CRAA_CHOHO Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|16751536|gb|AAL27682.1| HR-29-like protein [Ciona intestinalis] 60 1e-08
gi|123581|sp|P05812|HS6A_DROME Heat shock protein 67B1 >gnl|BL_O... 60 1e-08
gi|117341|sp|P02473|CRAA_CANFA Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|117340|sp|P02472|CRAA_CAMDR Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|117351|sp|P02498|CRAA_LOXAF Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|117383|sp|P02481|CRAA_ZALCA Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|117355|sp|P02483|CRAA_MUSVI Alpha crystallin A chain >gnl|BL_... 60 1e-08
gi|10946519|gb|AAG23866.1| alpha-A crystallin [Clarias fuscus] 60 1e-08
gi|16751540|gb|AAL27684.1| heat shock protein HSP27-like protein... 59 2e-08
gi|117368|sp|P02508|CRAA_RANTE ALPHA CRYSTALLIN A CHAIN >gnl|BL_... 59 2e-08
gi|50760210|ref|XP_417935.1| PREDICTED: small heat shock protein... 59 2e-08
gi|2058737|gb|AAC63387.1| 23kDa heat shock protein ScHSP23 [Sarc... 59 2e-08
gi|117348|sp|P02478|CRAA_HORSE Alpha crystallin A chain >gnl|BL_... 59 2e-08
gi|6014724|sp|Q91311|CRAA_RANCA Alpha crystallin A chain >gnl|BL... 59 2e-08
gi|17647521|ref|NP_524000.1| CG4466-PA [Drosophila melanogaster]... 59 2e-08
gi|17557147|ref|NP_499252.1| alpha crystallin (3L227) [Caenorhab... 59 2e-08
gi|6014723|sp|O73919|CRAA_ORYLA ALPHA CRYSTALLIN A CHAIN >gnl|BL... 59 2e-08
gi|13431421|sp|P82533|CRAA_ERIEU Alpha crystallin A chain 59 2e-08
gi|224126|prf||1010303K crystallin alphaA 59 2e-08
gi|48374049|ref|NP_001001527.1| small heat shock protein B2 [Gal... 59 3e-08
gi|50344347|emb|CAF02101.1| alphaA-crystallin [Elephas maximus] 58 4e-08
gi|545503|gb|AAB29956.1| HSP2Dt=small heat shock protein {C-term... 58 4e-08
gi|117361|sp|P02499|CRAA_PROCA Alpha crystallin A chain >gnl|BL_... 58 4e-08
gi|117372|sp|P02485|CRAA_TAMME Alpha crystallin A chain >gnl|BL_... 58 5e-08
gi|1072001|pir||B39644 actin polymerization inhibitor - turkey (... 58 5e-08
gi|4504519|ref|NP_001532.1| heat shock 27kDa protein 2; heat sho... 58 5e-08
gi|223333|prf||0708219B crystallin alphaA 57 6e-08
gi|117335|sp|P06904|CRAA_ALLMI Alpha crystallin A chain >gnl|BL_... 57 6e-08
gi|48427994|sp|Q04757|HR29_HALRO Body wall muscle protein HR-29 ... 57 8e-08
gi|17553934|ref|NP_498776.1| heat shock protein (hsp-12.2) [Caen... 57 8e-08
gi|39594095|emb|CAE70205.1| Hypothetical protein CBG16680 [Caeno... 57 8e-08
gi|117357|sp|P02501|CRAA_ORYAF Alpha crystallin A chain >gnl|BL_... 57 1e-07
gi|17647523|ref|NP_523998.1| CG4167-PA [Drosophila melanogaster]... 56 1e-07
gi|19168452|dbj|BAB85811.1| newt alpha A-crystallin [Cynops pyrr... 56 1e-07
gi|40795763|gb|AAR91597.1| intracellular estradiol-binding prote... 56 1e-07
gi|1835585|gb|AAB46594.1| low molecular weight heat shock protei... 56 2e-07
gi|38048135|gb|AAR09970.1| similar to Drosophila melanogaster Hs... 56 2e-07
gi|17647519|ref|NP_523997.1| CG4183-PA [Drosophila melanogaster]... 55 2e-07
gi|50540408|ref|NP_001002670.1| zgc:91937 [Danio rerio] >gnl|BL_... 55 2e-07
gi|41394383|gb|AAS02295.1| Hsp20/alpha-crystallin [Tigriopus jap... 55 2e-07
gi|224133|prf||1010303T crystallin alphaA 55 2e-07
gi|224122|prf||1010303F crystallin alphaA 55 2e-07
gi|1174256|gb|AAB04143.1| heat shock protein 30 55 2e-07
gi|1170369|sp|P42931|HS30_ONCTS HEAT SHOCK PROTEIN 30 (HSP 30) >... 55 2e-07
gi|49250492|gb|AAH74681.1| Unknown (protein for MGC:69432) [Xeno... 55 2e-07
gi|47225579|emb|CAG12062.1| unnamed protein product [Tetraodon n... 55 2e-07
gi|13324714|ref|NP_077761.1| heat shock protein 2; heat shock 27... 55 3e-07
gi|39850111|gb|AAH64051.1| Unknown (protein for MGC:73576) [Mus ... 55 3e-07
gi|32450600|gb|AAH54225.1| MGC64408 protein [Xenopus laevis] 55 3e-07
gi|117371|sp|P02509|CRAA_SQUAC Alpha crystallin A chain >gnl|BL_... 55 3e-07
gi|47221506|emb|CAG08168.1| unnamed protein product [Tetraodon n... 55 4e-07
gi|18426864|ref|NP_569115.1| heat shock 27kD protein 2 [Rattus n... 55 4e-07
gi|23208546|gb|AAN15790.1| heat shock-like protein [Galleria mel... 55 4e-07
gi|71490|pir||HHFF26 heat shock protein 26 - fruit fly (Drosophi... 55 4e-07
gi|13431418|sp|P82530|CRAA_ELERU Alpha crystallin A chain 55 4e-07
gi|31199321|ref|XP_308608.1| ENSANGP00000019416 [Anopheles gambi... 54 5e-07
gi|55516|emb|CAA32818.1| unnamed protein product [Mus sp.] >gnl|... 54 7e-07
gi|91319|pir||S02143 stress protein, 25K - mouse 54 7e-07
gi|7441291|pir||T00703 probable alpha A-crystallin - human >gnl|... 54 9e-07
gi|42524139|ref|NP_969519.1| probable HspC2 heat shock protein [... 54 9e-07
gi|50756697|ref|XP_415280.1| PREDICTED: similar to Heat-shock pr... 53 1e-06
gi|30250014|ref|NP_842084.1| Heat shock hsp20 (alpha crystallin)... 53 1e-06
gi|50760879|ref|XP_425870.1| PREDICTED: similar to heat shock 20... 53 1e-06
gi|2655270|gb|AAB87967.1| small heat shock/alpha-crystallin prot... 52 2e-06
gi|47221507|emb|CAG08169.1| unnamed protein product [Tetraodon n... 52 3e-06
gi|71491|pir||HHFF27 heat shock protein 27 - fruit fly (Drosophi... 52 3e-06
gi|34557661|ref|NP_907476.1| hypothetical protein WS1299 [Woline... 52 3e-06
gi|41054471|ref|NP_955948.1| Unknown (protein for MGC:64202); wu... 52 3e-06
gi|21389433|ref|NP_653218.1| heat shock protein, alpha-crystalli... 52 3e-06
gi|45786106|gb|AAH68046.1| Heat shock protein, alpha-crystallin-... 52 3e-06
gi|20302069|ref|NP_620242.1| heat shock 20-kDa protein [Rattus n... 52 3e-06
gi|38426810|gb|AAR20447.1| protein kinase H11 [Macaca mulatta] 51 4e-06
gi|13507646|ref|NP_109629.1| heat shock protein 20-like protein;... 51 4e-06
gi|39579361|emb|CAE56912.1| Hypothetical protein CBG24755 [Caeno... 51 4e-06
gi|29743324|ref|XP_293276.1| similar to Heat shock 27 kDa protei... 51 4e-06
gi|17509129|ref|NP_492770.1| crystallin alpha B family member (1... 51 6e-06
gi|24661523|ref|NP_648304.1| CG4461-PA [Drosophila melanogaster]... 51 6e-06
gi|23475620|ref|ZP_00130904.1| COG0071: Molecular chaperone (sma... 50 7e-06
gi|20825064|ref|XP_145511.1| similar to heat shock 20-kDa protei... 50 7e-06
gi|42524973|ref|NP_970353.1| low molecular weight heat shock pro... 50 7e-06
gi|30583967|gb|AAP36232.1| Homo sapiens protein kinase H11 [synt... 50 1e-05
gi|22038137|gb|AAM90297.1| H11 kinase [Canis familiaris] 50 1e-05
gi|5901655|gb|AAD55359.1| protein kinase [Homo sapiens] 50 1e-05
gi|7657146|ref|NP_055180.1| heat shock 27kDa protein 8; protein ... 50 1e-05
gi|16758408|ref|NP_446064.1| crystallin, alpha C [Rattus norvegi... 50 1e-05
gi|48096158|ref|XP_392405.1| similar to CG14207-PB [Apis mellifera] 49 2e-05
gi|24661515|ref|NP_729477.1| CG32041-PB [Drosophila melanogaster... 49 2e-05
gi|47606341|sp||P02500_3 [Segment 3 of 3] Alpha crystallin A chain 49 2e-05
gi|12743949|gb|AAK06409.1| alpha-crystallin [Bombyx mori] 49 2e-05
gi|38075302|ref|XP_357224.1| similar to heat shock 27kD protein ... 49 2e-05
gi|15643142|ref|NP_228185.1| heat shock protein, class I [Thermo... 49 2e-05
gi|42522487|ref|NP_967867.1| small heat shock protein [Bdellovib... 48 4e-05
gi|232279|sp|P30218|HS3C_XENLA HEAT SHOCK PROTEIN 30C >gnl|BL_OR... 48 4e-05
gi|34580701|ref|ZP_00142181.1| heat shock protein [Rickettsia si... 48 5e-05
gi|15892286|ref|NP_360000.1| heat shock protein [Rickettsia cono... 48 5e-05
gi|50876755|emb|CAG36595.1| related to low molecular weight heat... 48 5e-05
gi|24643312|ref|NP_728275.1| CG14207-PB [Drosophila melanogaster... 47 6e-05
gi|47575337|ref|ZP_00245372.1| COG0071: Molecular chaperone (sma... 47 6e-05
gi|19920346|ref|NP_608326.1| CG14207-PA [Drosophila melanogaster... 47 6e-05
gi|48834677|ref|ZP_00291683.1| COG0071: Molecular chaperone (sma... 47 8e-05
gi|47221332|emb|CAF97250.1| unnamed protein product [Tetraodon n... 47 8e-05
gi|1206025|gb|AAB08736.1| p27 47 8e-05
gi|9910272|ref|NP_064344.1| heat shock protein 3; small heat sho... 47 8e-05
gi|17541102|ref|NP_501668.1| heat shock protein (12.6 kD) (hsp-1... 47 8e-05
gi|26990030|ref|NP_745455.1| heat shock protein, putative [Pseud... 47 1e-04
gi|13124733|sp|P02515|HS22_DROME Heat shock protein 22 47 1e-04
gi|71488|pir||HHFF22 heat shock protein 22 - fruit fly (Drosophi... 47 1e-04
gi|161038|gb|AAA29903.1| major egg antigen 46 1e-04
gi|71479|pir||CYFGAA alpha-crystallin chain A - edible frog (ten... 46 1e-04
gi|47606343|sp||P02507_2 [Segment 2 of 2] Alpha crystallin A chain 46 1e-04
gi|129359|sp|P12812|P40_SCHMA Major egg antigen (P40) 46 1e-04
gi|627088|pir||A54521 40k egg antigen (clone 10F5) - fluke (Schi... 46 1e-04
gi|49903676|gb|AAH76806.1| Unknown (protein for MGC:83758) [Xeno... 46 1e-04
gi|15604143|ref|NP_220658.1| HEAT SHOCK PROTEIN (hsp22) [Rickett... 46 1e-04
gi|13929052|ref|NP_113938.1| heat shock 27kD protein family, mem... 46 2e-04
gi|232280|sp|P30219|HS3D_XENLA HEAT SHOCK PROTEIN 30D >gnl|BL_OR... 46 2e-04
gi|34558826|gb|AAQ75170.1| heat shock protein class I [Alvinella... 45 2e-04
gi|548963|sp|Q06823|SP21_STIAU Spore protein SP21 >gnl|BL_ORD_ID... 45 3e-04
gi|9501702|emb|CAB99442.1| HspA protein [Stigmatella aurantiaca] 45 3e-04
gi|46199559|ref|YP_005226.1| small heat shock protein [Thermus t... 45 4e-04
gi|35182|emb|CAA34498.1| p24k-1 (AA 1-91) [Homo sapiens] 45 4e-04
gi|241307|gb|AAB20722.1| estrogen receptor-related protein; HSP2... 45 4e-04
gi|39586355|emb|CAE74012.1| Hypothetical protein CBG21660 [Caeno... 44 5e-04
gi|84991|pir||A20647 heat shock protein 22 - fruit fly (Drosophi... 44 7e-04
gi|21750828|dbj|BAC03846.1| unnamed protein product [Homo sapiens] 44 9e-04
gi|25012203|gb|AAN71217.1| GM22862p [Drosophila melanogaster] 44 9e-04
gi|7657202|ref|NP_055239.1| heat shock 27kDa protein family, mem... 44 9e-04
gi|29170428|emb|CAD80062.1| small heat shock protein B3 [Physete... 44 9e-04
gi|7529575|emb|CAB86671.1| dJ336M4.5 (cardiovascular heat shock ... 44 9e-04
gi|17550276|ref|NP_509009.1| heat shock protein (hsp-25) [Caenor... 43 0.001
gi|39598163|emb|CAE68855.1| Hypothetical protein CBG14817 [Caeno... 43 0.001
gi|28894835|gb|AAO61437.1| Heat shock protein protein 25, isofor... 43 0.001
gi|23618982|ref|NP_704944.1| small heat shock protein, putative ... 43 0.001
gi|537532|gb|AAA60267.1| alpha-B-crystallin 43 0.001
gi|46580845|ref|YP_011653.1| heat shock protein, Hsp20 family [D... 43 0.001
gi|5453688|ref|NP_006299.1| heat shock 27kDa protein 3; heat sho... 43 0.001
gi|24762361|ref|NP_726354.1| CG4533-PB [Drosophila melanogaster]... 43 0.002
gi|39580138|emb|CAE56258.1| Hypothetical protein CBG23899 [Caeno... 43 0.002
gi|34872418|ref|XP_342967.1| similar to Heat-shock protein, beta... 43 0.002
gi|33285155|gb|AAF59604.2| Hypothetical protein Y55F3BR.6 [Caeno... 43 0.002
gi|29170454|emb|CAD80076.1| small heat shock protein B3 [Tupaia ... 42 0.002
gi|8134495|sp|O69241|HSPD_BRAJA Small heat shock protein hspD >g... 42 0.002
gi|27380330|ref|NP_771859.1| small heat shock protein [Bradyrhiz... 42 0.002
gi|48839798|ref|ZP_00296727.1| COG0071: Molecular chaperone (sma... 42 0.003
gi|29170434|emb|CAD80065.1| small heat shock protein B3 [Manis s... 42 0.003
gi|46105595|ref|ZP_00185714.2| COG0071: Molecular chaperone (sma... 42 0.003
gi|12644226|sp|P35385|HSB7_MOUSE Heat-shock protein beta-7 (HspB... 42 0.003
gi|31542970|ref|NP_038896.2| heat shock protein family, member 7... 42 0.003
gi|29170430|emb|CAD80063.1| small heat shock protein B3 [Sus scr... 41 0.004
gi|29170468|emb|CAD80084.1| small heat shock protein B3 [Erethiz... 41 0.004
gi|29170474|emb|CAD80087.1| small heat shock protein B3 [Sciurus... 41 0.004
gi|15838825|ref|NP_299513.1| low molecular weight heat shock pro... 41 0.004
gi|29170458|emb|CAD80078.1| small heat shock protein B3 [Ochoton... 41 0.004
gi|47574924|ref|ZP_00244959.1| COG0071: Molecular chaperone (sma... 41 0.006
gi|24660381|ref|NP_648155.1| CG7409-PA [Drosophila melanogaster]... 41 0.006
gi|29170456|emb|CAD80077.1| small heat shock protein B3 [Oryctol... 41 0.006
gi|29170442|emb|CAD80070.1| small heat shock protein B3 [Dasypus... 40 0.008
gi|29170444|emb|CAD80071.1| small heat shock protein B3 [Procavi... 40 0.008
gi|29169863|emb|CAD80069.1| small heat shock protein B3 [Bradypu... 40 0.008
gi|31874067|emb|CAD97949.1| hypothetical protein [Homo sapiens] 40 0.008
gi|29170472|emb|CAD80086.1| small heat shock protein B3 [Myoxus ... 40 0.008
gi|202620|gb|AAA40644.1| alpha A-crystallin 40 0.008
gi|29170438|emb|CAD80067.1| small heat shock protein B3 [Canis f... 40 0.010
gi|29170446|emb|CAD80072.1| small heat shock protein B3 [Orycter... 40 0.010
gi|29170436|emb|CAD80066.1| small heat shock protein B3 [Felis c... 40 0.010
gi|29170448|emb|CAD80073.1| small heat shock protein B3 [Macrosc... 40 0.010
gi|29170452|emb|CAD80075.1| small heat shock protein B3 [Cynocep... 40 0.010
gi|31200359|ref|XP_309127.1| ENSANGP00000020554 [Anopheles gambi... 40 0.010
gi|29170466|emb|CAD80083.1| small heat shock protein B3 [Cavia p... 40 0.010
gi|452947|gb|AAB28816.1| heat shock protein HSP72 homolog [Homo ... 40 0.010
gi|31200357|ref|XP_309126.1| ENSANGP00000022362 [Anopheles gambi... 40 0.010
gi|31200361|ref|XP_309128.1| ENSANGP00000023810 [Anopheles gambi... 40 0.010
gi|29170440|emb|CAD80068.1| small heat shock protein B3 [Erinace... 40 0.013
gi|22530880|gb|AAM96944.1| small heat shock protein [Lycopersico... 40 0.013
gi|22530884|gb|AAM96946.1| small heat shock protein [Lycopersico... 40 0.013
gi|7512479|pir||G01523 heat shock protein 27 - human 40 0.013
gi|29170470|emb|CAD80085.1| small heat shock protein B3 [Trichys... 40 0.013
gi|4105494|gb|AAD02433.1| truncated hsp25 [Mus musculus] 40 0.013
gi|584634|emb|CAA26348.1| unnamed protein product [Xenopus laevis] 40 0.013
gi|29170432|emb|CAD80064.1| small heat shock protein B3 [Equus c... 39 0.017
gi|29169865|emb|CAD80081.1| small heat shock protein B3 [Anomalu... 39 0.017
gi|29170464|emb|CAD80082.1| small heat shock protein B3 [Castor ... 39 0.017
gi|202622|gb|AAA40645.1| alpha A-crystallin 39 0.017
gi|1333849|emb|CAA26697.1| unnamed protein product [Mesocricetus... 39 0.017
gi|20089032|ref|NP_615107.1| small heat shock protein [Methanosa... 39 0.022
gi|22997469|ref|ZP_00041699.1| COG0071: Molecular chaperone (sma... 39 0.022
gi|48860114|ref|ZP_00314041.1| COG0071: Molecular chaperone (sma... 39 0.022
gi|22994423|ref|ZP_00038927.1| COG0071: Molecular chaperone (sma... 39 0.022
gi|45546955|ref|ZP_00187019.1| COG0071: Molecular chaperone (sma... 39 0.029
gi|34873844|ref|XP_343968.1| similar to small heat shock protein... 39 0.029
gi|38092035|ref|XP_126494.2| RIKEN cDNA 1700007H20 [Mus musculus] 39 0.029
gi|32476352|ref|NP_869346.1| heat shock protein SP21 [Pirellula ... 39 0.029
gi|42453504|ref|ZP_00153411.1| hypothetical protein Rick035401 [... 39 0.029
gi|46576643|sp|Q9DAM3|HSB9_MOUSE Heat-shock protein beta-9 (HspB... 39 0.029
gi|23130701|ref|ZP_00112514.1| COG0071: Molecular chaperone (sma... 39 0.029
gi|48788377|ref|ZP_00284356.1| COG0071: Molecular chaperone (sma... 38 0.038
gi|29170462|emb|CAD80080.1| small heat shock protein B3 [Dipodom... 38 0.038
gi|4996840|dbj|BAA78579.1| Dchsp-1 [Daucus carota] 38 0.038
gi|49616575|gb|AAT67148.1| heat shock protein 28 [Toxoplasma gon... 38 0.049
gi|47678124|emb|CAE83569.1| small heat shock protein B3 [Xenopus... 38 0.049
gi|30064996|ref|NP_839167.1| heat shock protein [Shigella flexne... 38 0.049
gi|16762514|ref|NP_458131.1| heat shock protein B [Salmonella en... 38 0.049
gi|15804285|ref|NP_290324.1| heat shock protein [Escherichia col... 38 0.049
gi|46199418|ref|YP_005085.1| small heat shock protein [Thermus t... 38 0.049
gi|24115002|ref|NP_709512.1| heat shock protein [Shigella flexne... 38 0.049
gi|45915918|ref|ZP_00194722.2| COG0071: Molecular chaperone (sma... 37 0.084
gi|34496632|ref|NP_900847.1| probable small heat shock protein [... 37 0.084
gi|47222772|emb|CAG01739.1| unnamed protein product [Tetraodon n... 37 0.084
gi|2827909|gb|AAB99912.1| alpha-A-crystallin [Homo sapiens] 37 0.084
gi|48141957|ref|XP_393575.1| similar to ENSANGP00000018811 [Apis... 37 0.084
gi|688439|gb|AAC37570.1| alpha-A-crystallin 37 0.084
gi|1206023|gb|AAB08735.1| p27 37 0.084
gi|19075661|ref|NP_588161.1| putative heat shock protein 16-Hsp2... 37 0.084
gi|29170460|emb|CAD80079.1| small heat shock protein B3 [Dipus s... 37 0.084
gi|23123620|ref|ZP_00105694.1| COG0071: Molecular chaperone (sma... 37 0.084
gi|45526077|ref|ZP_00177290.1| COG0071: Molecular chaperone (sma... 37 0.084
gi|46322011|ref|ZP_00222384.1| COG0071: Molecular chaperone (sma... 37 0.11
gi|22298416|ref|NP_681663.1| 16.6 kDa small heat shock protein m... 37 0.11
gi|22970128|ref|ZP_00017273.1| hypothetical protein [Chloroflexu... 37 0.11
gi|21230505|ref|NP_636422.1| low molecular weight heat shock pro... 37 0.11
gi|4185758|gb|AAD09183.1| cytosolic I small heat shock protein H... 36 0.14
gi|18640734|ref|NP_570129.1| contactin associated protein-like 5... 36 0.14
gi|123560|sp|P12811|HS2C_CHLRE CHLOROPLAST HEAT SHOCK 22 KD PROT... 36 0.14
gi|13473957|ref|NP_105525.1| small heat shock protein (class I) ... 36 0.14
gi|47216905|emb|CAG02077.1| unnamed protein product [Tetraodon n... 36 0.14
gi|16422380|gb|AAL22667.1| small heat shock protein [Salmonella ... 36 0.19
gi|39546375|ref|NP_462708.2| small heat shock protein [Salmonell... 36 0.19
gi|41722891|ref|ZP_00149857.1| COG0071: Molecular chaperone (sma... 36 0.19
gi|29170450|emb|CAD80074.1| small heat shock protein B3 [Macropu... 35 0.25
gi|15082238|ref|NP_149971.1| heat shock protein, alpha-crystalli... 35 0.32
gi|156342|gb|AAA28072.1| heat shock protein; (hsp16-48) 35 0.32
gi|1170368|sp|P46254|HS2M_PEA Heat shock 22 kDa protein, mitocho... 35 0.32
gi|21068488|emb|CAC81965.1| small heat-shock protein [Funaria hy... 35 0.42
gi|48840669|ref|ZP_00297595.1| COG0071: Molecular chaperone (sma... 35 0.42
gi|48866149|ref|ZP_00320006.1| COG0071: Molecular chaperone (sma... 35 0.42
gi|7441300|pir||T06449 probable heat shock protein - garden pea ... 35 0.42
gi|21241905|ref|NP_641487.1| low molecular weight heat shock pro... 35 0.42
gi|26990031|ref|NP_745456.1| heat shock protein, putative [Pseud... 34 0.55
gi|21227521|ref|NP_633443.1| Small heat shock protein [Methanosa... 34 0.55
gi|7159338|gb|AAF37726.1| LMW heat shock protein [Euphorbia esula] 34 0.55
gi|48781287|ref|ZP_00277919.1| COG0071: Molecular chaperone (sma... 34 0.55
gi|41615132|ref|NP_963630.1| NEQ344 [Nanoarchaeum equitans Kin4-... 34 0.55
gi|39997505|ref|NP_953456.1| heat shock protein, Hsp20 family [G... 34 0.71
gi|39104609|dbj|BAC43654.2| putative heat shock protein 21 [Arab... 34 0.71
gi|15234240|ref|NP_194497.1| 25.3 kDa small heat shock protein, ... 34 0.71
gi|37904866|gb|AAP57477.1| small heat shock protein [Capsicum an... 34 0.71
gi|29841390|gb|AAP06422.1| similar to GenBank Accession Number P... 34 0.71
gi|48852684|ref|ZP_00306868.1| COG0071: Molecular chaperone (sma... 33 0.93
gi|27380341|ref|NP_771870.1| small heat shock protein [Bradyrhiz... 33 0.93
gi|7441305|pir||T07417 heat shock protein 20, chromoplast-associ... 33 0.93
gi|2495334|sp|Q95661|HS2C_LYCES Small heat shock protein, chloro... 33 0.93
gi|31559712|dbj|BAC77527.1| heat shock protein 26 [Drosophila tr... 33 0.93
gi|226281|prf||1504307A alphaA crystallin 33 1.2
gi|9965112|gb|AAG09956.1| unknown [Bacillus amyloliquefaciens] 33 1.2
gi|47575352|ref|ZP_00245387.1| COG0071: Molecular chaperone (sma... 33 1.2
gi|23619554|ref|NP_705516.1| polynucleotide kinase, putative [Pl... 33 1.2
gi|39933966|ref|NP_946242.1| small heat shock protein [Rhodopseu... 33 1.2
gi|41407796|ref|NP_960632.1| Hsp18_2 [Mycobacterium avium subsp.... 33 1.6
gi|17543692|ref|NP_499998.1| heat shock protein (4B586) [Caenorh... 33 1.6
gi|15923802|ref|NP_371336.1| hypothetical protein SAV0812 [Staph... 33 1.6
gi|38105292|gb|EAA51734.1| hypothetical protein MG03329.4 [Magna... 33 1.6
gi|1945301|emb|CAA96917.1| POX1 [Saccharomyces cerevisiae] 32 2.1
gi|47497479|dbj|BAD19533.1| putative 17.8 kDa class II heat shoc... 32 2.1
gi|172217|gb|AAA34891.1| acyl-coenzyme A oxidase 32 2.1
gi|6321233|ref|NP_011310.1| Fatty-acyl coenzyme A oxidase, invol... 32 2.1
gi|50769084|ref|XP_423072.1| PREDICTED: similar to proteasome 26... 32 2.7
gi|48781285|ref|ZP_00277917.1| COG0071: Molecular chaperone (sma... 32 2.7
gi|123563|sp|P09887|HS2C_SOYBN Chloroplast small heat shock prot... 32 2.7
gi|11994156|dbj|BAB01185.1| unnamed protein product [Arabidopsis... 32 3.5
gi|50783410|ref|XP_427584.1| PREDICTED: similar to Myosin Vc (My... 32 3.5
gi|3451480|emb|CAA72158.1| alpha-A-crystallin [Astyanax mexicanus] 32 3.5
gi|30688556|ref|NP_189327.2| F-box family protein [Arabidopsis t... 32 3.5
gi|46228690|gb|EAK89560.1| hypothetical protein containing a sig... 32 3.5
gi|23097457|ref|NP_690923.1| DNA-directed DNA polymerase III bet... 32 3.5
gi|5921170|sp|Q12732|AVNA_ASPPA Averantin oxidoreductase (Cytoch... 32 3.5
gi|50302287|ref|XP_451078.1| unnamed protein product [Kluyveromy... 32 3.5
gi|44885890|dbj|BAD12046.1| heat shock protein 23 [Lucilia seric... 32 3.5
gi|29840587|ref|NP_829693.1| excinuclease ABC, subunit C [Chlamy... 32 3.5
gi|17864540|ref|NP_524877.1| CG1618-PA [Drosophila melanogaster]... 32 3.5
gi|16804505|ref|NP_465990.1| similar to chitinase and chitin bin... 31 4.6
gi|47096059|ref|ZP_00233660.1| chitin-binding protein/carbohydra... 31 4.6
gi|21068482|emb|CAC81962.1| small heat-shock protein [Picea glauca] 31 4.6
gi|7441313|pir||T09248 heat shock protein HSP23.5, mitochondrial... 31 4.6
gi|49474902|ref|YP_032943.1| Heat shock protein [Bartonella hens... 31 4.6
gi|49484604|ref|YP_041828.1| putative small heat shock protein [... 31 4.6
gi|4096392|gb|AAC99868.1| alpha A-crystallin [Sterna fuscata] 31 4.6
gi|28634|emb|CAA32891.1| crystallin [Homo sapiens] 31 4.6
gi|4096394|gb|AAC99869.1| alpha A-crystallin [Columba livia] 31 4.6
gi|46435587|gb|EAK94966.1| hypothetical protein CaO19.7776 [Cand... 31 4.6
gi|48781269|ref|ZP_00277901.1| COG0071: Molecular chaperone (sma... 31 4.6
gi|46227010|gb|EAK87960.1| possible SET domain containing protei... 31 6.0
gi|50425767|ref|XP_461480.1| unnamed protein product [Debaryomyc... 31 6.0
gi|16417609|gb|AAL18821.1| EpeA [Escherichia coli] 31 6.0
gi|15234627|ref|NP_193918.1| 26.5 kDa class P-related heat shock... 31 6.0
gi|50344365|emb|CAF02110.1| alphaA-crystallin [Caiman crocodilus] 31 6.0
gi|4096386|gb|AAC99865.1| alpha A-crystallin [Crotophaga sulciro... 31 6.0
gi|4096388|gb|AAC99866.1| alpha A-crystallin [Turdus merula] 31 6.0
gi|4096390|gb|AAC99867.1| alpha A-crystallin [Lophura nycthemera] 31 6.0
gi|39588856|emb|CAE69486.1| Hypothetical protein CBG15689 [Caeno... 30 7.9
gi|19338692|gb|AAL86770.1| N-acetylglutamate synthase [Mus muscu... 30 7.9
gi|15925377|ref|NP_372911.1| hypothetical protein SAV2387 [Staph... 30 7.9
gi|64787|emb|CAA26347.1| unnamed protein product [Xenopus laevis] 30 7.9
gi|123574|sp|P04120|HS3A_XENLA HEAT SHOCK PROTEIN 30A >gnl|BL_OR... 30 7.9
gi|48864144|ref|ZP_00318037.1| COG0714: MoxR-like ATPases [Micro... 30 7.9
gi|22003874|ref|NP_665828.1| N-acetylglutamate synthase; amino-a... 30 7.9
gi|30017345|ref|NP_835154.1| N-acetylglutamate synthase; amino-a... 30 7.9
>gi|17562026|ref|NP_505354.1| heat shock protein (hsp-16.1)
[Caenorhabditis elegans]
gi|17562030|ref|NP_505357.1| heat shock protein (hsp-16.11)
[Caenorhabditis elegans]
gi|462321|sp|P34696|HS11_CAEEL Heat shock protein HSP16-1
gi|418882|pir||B24289 heat shock protein 16-1 - Caenorhabditis
elegans
gi|156336|gb|AAA28068.1| heat shock protein 16-1a [Caenorhabditis
elegans]
gi|1458268|gb|AAB04839.1| Heat shock protein protein 16.1
[Caenorhabditis elegans]
gi|1458271|gb|AAB04842.1| Heat shock protein protein 16.11
[Caenorhabditis elegans]
Length = 145
Score = 287 bits (735), Expect = 3e-77
Identities = 145/145 (100%), Positives = 145/145 (100%)
Frame = +1
Query: 1 MSLYHYFRPAQRSVFGDLMRDMAQMERQFTPVCRGSPSESSEIVNNDQKFAINLNVSQFK 180
MSLYHYFRPAQRSVFGDLMRDMAQMERQFTPVCRGSPSESSEIVNNDQKFAINLNVSQFK
Sbjct: 1 MSLYHYFRPAQRSVFGDLMRDMAQMERQFTPVCRGSPSESSEIVNNDQKFAINLNVSQFK 60
Query: 181 PEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIE 360
PEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIE
Sbjct: 61 PEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIE 120
Query: 361 APKKEAIQGRSIPIQQAPVEQKTSE 435
APKKEAIQGRSIPIQQAPVEQKTSE
Sbjct: 121 APKKEAIQGRSIPIQQAPVEQKTSE 145