Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= T27F2_4
         (498 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17564822|ref|NP_505951.1| putative protein, with a coiled coi...   238   3e-62
gi|39592100|emb|CAE75320.1| Hypothetical protein CBG23294 [Caeno...   170   1e-41
gi|8924246|ref|NP_061134.1| Jun dimerization protein p21SNFT [Ho...    42   0.004
gi|48142135|ref|XP_397304.1| similar to USF [Apis mellifera]           38   0.079
gi|20129955|ref|NP_610880.1| CG13330-PA [Drosophila melanogaster...    38   0.079
gi|31230092|ref|XP_318333.1| ENSANGP00000014048 [Anopheles gambi...    37   0.18
gi|29823886|emb|CAD56862.1| fra1 protein [Takifugu rubripes]           37   0.23
gi|39593141|emb|CAE64610.1| Hypothetical protein CBG09366 [Caeno...    36   0.30
gi|542479|pir||S41864 kinesin light chain (isoform 1) - Caenorha...    36   0.39
gi|542480|pir||S41865 kinesin light chain (isoform 2) - Caenorha...    36   0.39
gi|32566817|ref|NP_504471.2| kinesin light chain (58.7 kD) (klc-...    36   0.39
gi|48128426|ref|XP_396629.1| similar to ENSANGP00000020736 [Apis...    36   0.39
gi|42733675|gb|AAO50853.2| similar to Dictyostelium discoideum (...    36   0.39
gi|1078876|pir||S47997 kinesin light chain (isoform 1) - Caenorh...    36   0.39
gi|13938657|gb|AAH07485.1| Golga4 protein [Mus musculus]               35   0.51
gi|31419321|gb|AAH53000.1| Golga4 protein [Mus musculus]               35   0.51
gi|20127150|ref|NP_061218.2| golgi autoantigen, golgin subfamily...    35   0.51
gi|38050353|ref|XP_355224.1| similar to KIAA0445 protein [Mus mu...    35   0.51
gi|7513666|pir||T14265 golgin-245 - mouse                              35   0.51
gi|40458416|ref|NP_954737.1| NADH dehydrogenase subunit 2 [Vargu...    35   0.67
gi|50760431|ref|XP_418019.1| PREDICTED: similar to hypothetical ...    35   0.67
gi|33338911|gb|AAQ14222.1| NADH dehydrogenase subunit B [Pisum s...    35   0.67
gi|23469198|ref|ZP_00124533.1| COG0419: ATPase involved in DNA r...    35   0.67
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ...    35   0.87
gi|28850438|gb|AAO53202.1| similar to Plasmodium falciparum. Hyp...    35   0.87
gi|171959|gb|AAA34783.1| myosin-like protein                           34   1.1
gi|6322948|ref|NP_013021.1| Mlp proteins restrict telomere lengt...    34   1.1
gi|32566815|ref|NP_504470.2| kinesin light chain (62.6 kD) (klc-...    34   1.1
gi|14018161|gb|AAK52182.1| Kinesin light chain protein 2, isofor...    34   1.1
gi|29840824|sp|P46822|KLC_CAEEL Kinesin light chain (KLC) >gnl|B...    34   1.1
gi|50058073|gb|AAT68902.1| Kinesin light chain protein 2, isofor...    34   1.1
gi|25350487|pir||H89052 protein C18C4.10 [imported] - Caenorhabd...    34   1.1
gi|50304743|ref|XP_452327.1| unnamed protein product [Kluyveromy...    34   1.1
gi|26251656|gb|AAN84863.1| Kinesin light chain protein 2, isofor...    34   1.1
gi|6110365|gb|AAF03789.1| Traf2 and NCK interacting kinase, spli...    34   1.5
gi|38077770|ref|XP_130797.3| Traf2 and NCK interacting kinase-li...    34   1.5
gi|6110350|gb|AAF03783.1| Traf2 and NCK interacting kinase, spli...    34   1.5
gi|6110357|gb|AAF03786.1| Traf2 and NCK interacting kinase, spli...    34   1.5
gi|50305331|ref|XP_452625.1| unnamed protein product [Kluyveromy...    34   1.5
gi|6110360|gb|AAF03787.1| Traf2 and NCK interacting kinase, spli...    34   1.5
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ...    34   1.5
gi|18310267|ref|NP_562201.1| hypothetical protein CPE1285 [Clost...    34   1.5
gi|47219689|emb|CAG12611.1| unnamed protein product [Tetraodon n...    34   1.5
gi|23113972|ref|ZP_00099302.1| COG0419: ATPase involved in DNA r...    34   1.5
gi|48893587|ref|ZP_00326785.1| COG0419: ATPase involved in DNA r...    33   1.9
gi|17506289|ref|NP_493610.1| CEll death Specification CES-2, PAR...    33   1.9
gi|48103924|ref|XP_395673.1| similar to CG11620-PA [Apis mellifera]    33   1.9
gi|48770310|ref|ZP_00274653.1| COG0699: Predicted GTPases (dynam...    33   1.9
gi|11037065|ref|NP_061132.1| disrupted in schizophrenia 1 [Homo ...    33   1.9
gi|17366990|sp|Q9NRI5|DIS1_HUMAN Disrupted in schizophrenia 1 pr...    33   1.9
gi|50309143|ref|XP_454577.1| unnamed protein product [Kluyveromy...    33   1.9
gi|24412747|emb|CAD44631.1| disrupted in schizophrenia 1 [Homo s...    33   1.9
gi|7512989|pir||T00071 hypothetical protein KIAA0457 - human (fr...    33   1.9
gi|28204909|gb|AAH46392.1| 4930562D19Rik protein [Mus musculus]        33   2.5
gi|33318761|gb|AAQ05284.1| NADH dehydrogenase subunit B [Podocar...    33   2.5
gi|50749859|ref|XP_421787.1| PREDICTED: similar to eukaryotic tr...    33   2.5
gi|47209228|emb|CAF93215.1| unnamed protein product [Tetraodon n...    33   2.5
gi|29243994|ref|NP_808284.1| hypothetical protein 4930562D19 [Mu...    33   2.5
gi|35505404|gb|AAH57711.1| MGC68848 protein [Xenopus laevis]           33   2.5
gi|45185159|ref|NP_982876.1| ABL071Wp [Eremothecium gossypii] >g...    33   2.5
gi|40458386|gb|AAR87133.1| type I polyketide synthase; Mnp2 [Str...    33   2.5
gi|23612550|ref|NP_704111.1| hypothetical protein [Plasmodium fa...    33   2.5
gi|39939179|ref|NP_950945.1| chromosome segregation ATPase homol...    33   3.3
gi|50510383|dbj|BAD32177.1| mKIAA0139 protein [Mus musculus]           33   3.3
gi|17549986|ref|NP_509564.1| membrane-associated nucleic acid bi...    33   3.3
gi|30249193|ref|NP_841263.1| HlyD family secretion protein [Nitr...    33   3.3
gi|29248005|gb|EAA39550.1| GLP_203_48161_44385 [Giardia lamblia ...    33   3.3
gi|46121547|ref|XP_385328.1| hypothetical protein FG05152.1 [Gib...    33   3.3
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco...    33   3.3
gi|46575903|ref|NP_034253.2| eukaryotic translation initiation f...    33   3.3
gi|8051702|dbj|BAA96082.1| HES6 [Homo sapiens]                         33   3.3
gi|21361763|ref|NP_061115.2| hairy and enhancer of split 6 [Homo...    33   3.3
gi|28436851|gb|AAH46638.1| Myo18a protein [Mus musculus]               32   4.3
gi|22094119|ref|NP_035716.1| myosin XVIIIa; myosin XVIIIb; myosi...    32   4.3
gi|18202719|sp|Q9B149|NU2C_LOTJA NAD(P)H-quinone oxidoreductase ...    32   4.3
gi|49118234|gb|AAH73238.1| Unknown (protein for IMAGE:5440135) [...    32   4.3
gi|19113921|ref|NP_593009.1| hypothetical coiled-coil protein [S...    32   4.3
gi|29251055|gb|EAA42540.1| GLP_165_11606_4440 [Giardia lamblia A...    32   4.3
gi|48840079|ref|ZP_00297007.1| COG1196: Chromosome segregation A...    32   4.3
gi|16904563|dbj|BAB71953.1| male enhanced antigen-2 [Homo sapiens]     32   4.3
gi|6320855|ref|NP_010934.1| Spindle Pole Component of molecular ...    32   4.3
gi|32398858|emb|CAD98568.1| kinesin heavy chain, possible [Crypt...    32   4.3
gi|34877826|ref|XP_237413.2| similar to KIAA0445 protein [Rattus...    32   4.3
gi|39104508|dbj|BAC65744.3| mKIAA1187 protein [Mus musculus]           32   4.3
gi|29476980|gb|AAH48203.1| Unknown (protein for IMAGE:4139784) [...    32   4.3
gi|46132824|ref|ZP_00171547.2| COG0699: Predicted GTPases (dynam...    32   4.3
gi|478275|pir||JH0820 160K golgi antigen - human (fragment) >gnl...    32   4.3
gi|2662349|dbj|BAA23661.1| GCP170 [Homo sapiens]                       32   4.3
gi|37046947|gb|AAH57920.1| Myo18a protein [Mus musculus]               32   4.3
gi|50085229|ref|YP_046739.1| hypothetical protein; putative memb...    32   4.3
gi|30089940|ref|NP_005886.2| Golgi autoantigen, golgin subfamily...    32   4.3
gi|48477772|ref|YP_023478.1| hypothetical phosphoserine phosphat...    32   5.7
gi|26389677|dbj|BAC25772.1| unnamed protein product [Mus musculus]     32   5.7
gi|40675359|gb|AAH64926.1| EIF3S10 protein [Homo sapiens]              32   5.7
gi|22218336|ref|NP_032935.1| periplakin; 195-kD protein; 195kDa ...    32   5.7
gi|15241831|ref|NP_201047.1| SMC2-like condensin, putative (SMC2...    32   5.7
gi|12382276|gb|AAG53093.1| SMC2-1 [Arabidopsis thaliana]               32   5.7
gi|29826103|gb|AAO91768.1| IRF4-binding protein [Mus musculus]         32   5.7
gi|11497475|ref|NP_042265.1| unknown [Prototheca wickerhamii] >g...    32   5.7
gi|27734752|ref|NP_081461.1| differentially expressed in FDCP 6;...    32   5.7
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle...    32   5.7
gi|13449986|gb|AAG27593.2| SMC2-like condensin [Arabidopsis thal...    32   5.7
gi|40788877|dbj|BAA09488.2| KIAA0139 [Homo sapiens]                    32   5.7
gi|9628896|ref|NP_043924.1| gag-pol polyprotein [Snakehead retro...    32   5.7
gi|34868748|ref|XP_220174.2| similar to periplakin [Rattus norve...    32   5.7
gi|15921542|ref|NP_377211.1| 228aa long conserved hypothetical p...    32   5.7
gi|41059877|gb|AAF29436.2| periplakin [Mus musculus]                   32   5.7
gi|14133231|dbj|BAA82975.2| KIAA1023 protein [Homo sapiens]            32   5.7
gi|32408499|ref|XP_324731.1| hypothetical protein [Neurospora cr...    32   5.7
gi|48675825|ref|NP_689771.2| hypothetical protein DKFZp434I0118 ...    32   5.7
gi|10178881|emb|CAC08450.1| Def-6 protein [Homo sapiens]               32   5.7
gi|31542501|ref|NP_071330.2| differentially expressed in FDCP 6 ...    32   5.7
gi|38181796|gb|AAH61518.1| KIAA1023 protein [Homo sapiens]             32   5.7
gi|12053097|emb|CAB66726.1| hypothetical protein [Homo sapiens]        32   5.7
gi|9628895|ref|NP_043925.1| gag polyprotein [Snakehead retroviru...    32   5.7
gi|34864810|ref|XP_238649.2| similar to eukaryotic translation i...    32   5.7
gi|34852250|ref|XP_228031.2| similar to differentially expressed...    32   5.7
gi|32449796|gb|AAH54342.1| EIF3S10 protein [Homo sapiens]              32   5.7
gi|4503509|ref|NP_003741.1| eukaryotic translation initiation fa...    32   5.7
gi|22779868|ref|NP_683727.1| FYVE and coiled-coil domain contain...    32   7.4
gi|21909912|ref|NP_664180.1| putative chromosome condensation an...    32   7.4
gi|45184711|ref|NP_982429.1| AAL113Wp [Eremothecium gossypii] >g...    32   7.4
gi|32042339|ref|ZP_00139922.1| COG1196: Chromosome segregation A...    32   7.4
gi|17510019|ref|NP_491170.1| protein kinase alpha like (1E54) [C...    32   7.4
gi|31377634|ref|NP_443173.2| guanylate binding protein 4 [Homo s...    32   7.4
gi|47123304|gb|AAH70055.1| Guanylate binding protein 4 [Homo sap...    32   7.4
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    32   7.4
gi|50753035|ref|XP_413842.1| PREDICTED: similar to Lamin L(III) ...    32   7.4
gi|47230389|emb|CAF99582.1| unnamed protein product [Tetraodon n...    32   7.4
gi|48060108|gb|AAF60664.2| Hypothetical protein Y47G6A.17 [Caeno...    32   7.4
gi|15674632|ref|NP_268806.1| putative chromosome segregation SMC...    32   7.4
gi|34872793|ref|XP_340848.1| similar to myosin containing PDZ do...    32   7.4
gi|20094423|ref|NP_614270.1| Fe-S protein related to pyruvate fo...    31   9.7
gi|45822228|emb|CAF32691.1| variable membrane protein precursor ...    31   9.7
gi|23577825|ref|NP_703056.1| unknown [Rachiplusia ou multiple nu...    31   9.7
gi|21362836|sp|Q9HRW6|PSR2_HALN1 Proteasome-activating nucleotid...    31   9.7
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    31   9.7
gi|48731188|ref|ZP_00264934.1| COG3456: Uncharacterized conserve...    31   9.7
gi|1147800|gb|AAA85134.1| Sug2p                                        31   9.7
gi|24647285|ref|NP_732085.1| CG31291-PB [Drosophila melanogaster...    31   9.7
gi|6324833|ref|NP_014902.1| Proteasome Cap Subunit; Rpt4p [Sacch...    31   9.7
gi|32471719|ref|NP_864712.1| conserved hypothetical protein-puta...    31   9.7
gi|23124291|ref|ZP_00106289.1| COG1196: Chromosome segregation A...    31   9.7
gi|15897833|ref|NP_342438.1| Conserved hypothetical protein [Sul...    31   9.7
gi|19745654|ref|NP_606790.1| putative chromosome segregation SMC...    31   9.7
gi|50400945|sp|Q7TT16|IMPK_MOUSE Inositol polyphosphate multikin...    31   9.7
gi|31204847|ref|XP_311372.1| ENSANGP00000000514 [Anopheles gambi...    31   9.7
gi|26331850|dbj|BAC29655.1| unnamed protein product [Mus musculus]     31   9.7
gi|26331140|dbj|BAC29300.1| unnamed protein product [Mus musculus]     31   9.7
gi|33636587|gb|AAQ23591.1| RE13779p [Drosophila melanogaster]          31   9.7
gi|34877649|ref|XP_237395.2| similar to hairy/enhancer of split ...    31   9.7
gi|24647287|ref|NP_732086.1| CG31291-PA [Drosophila melanogaster...    31   9.7
gi|49093738|ref|XP_408330.1| hypothetical protein AN4193.2 [Aspe...    31   9.7
gi|33338927|gb|AAQ14234.1| NADH dehydrogenase subunit B [Sciadop...    31   9.7


>gi|17564822|ref|NP_505951.1| putative protein, with a coiled coil
           domain (18.3 kD) (5M130) [Caenorhabditis elegans]
 gi|7508601|pir||T25378 hypothetical protein T27F2.4 -
           Caenorhabditis elegans
 gi|3880310|emb|CAA98551.1| Hypothetical protein T27F2.4
           [Caenorhabditis elegans]
          Length = 165

 Score =  238 bits (608), Expect = 3e-62
 Identities = 126/165 (76%), Positives = 126/165 (76%)
 Frame = -1

Query: 498 MTTMTXXXXXXXXXXXXXXXXXXXSIHRPVAINPAMLAQFSINLPVLPFEXXXXXXXXXX 319
           MTTMT                   SIHRPVAINPAMLAQFSINLPVLPFE
Sbjct: 1   MTTMTNSLISNSVSSVPESLFSSASIHRPVAINPAMLAQFSINLPVLPFESSASLGTSTT 60

Query: 318 XXXXXXXXXXSAAPGKIRRGRPQQEIADGQDAHSQKKRHRRLYARQYRAQMRQKVENVKS 139
                     SAAPGKIRRGRPQQEIADGQDAHSQKKRHRRLYARQYRAQMRQKVENVKS
Sbjct: 61  SSSRCSSTESSAAPGKIRRGRPQQEIADGQDAHSQKKRHRRLYARQYRAQMRQKVENVKS 120

Query: 138 LHDEKEQLELEVKALRQAVSGLQQENAQKDFLISILQLNNQINHS 4
           LHDEKEQLELEVKALRQAVSGLQQENAQKDFLISILQLNNQINHS
Sbjct: 121 LHDEKEQLELEVKALRQAVSGLQQENAQKDFLISILQLNNQINHS 165




[DB home][top]