Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T28D9_5
(381 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536583|ref|NP_495306.1| small nuclear ribonucleoprotein, sm... 173 6e-43
gi|39597102|emb|CAE59329.1| Hypothetical protein CBG02671 [Caeno... 172 1e-42
gi|49250837|gb|AAH74514.1| Unknown (protein for MGC:69276) [Xeno... 144 4e-34
gi|5902102|ref|NP_008869.1| small nuclear ribonucleoprotein D1 p... 143 7e-34
gi|17864386|ref|NP_524774.1| CG10753-PA [Drosophila melanogaster... 142 2e-33
gi|31199215|ref|XP_308555.1| ENSANGP00000009562 [Anopheles gambi... 142 2e-33
gi|32959908|emb|CAE11897.1| small nuclear ribonucleoprotein Sm D... 142 2e-33
gi|27545253|ref|NP_775359.1| small nuclear ribonucleoprotein D1 ... 140 6e-33
gi|17945870|gb|AAL48981.1| RE39488p [Drosophila melanogaster] 139 2e-32
gi|50732862|ref|XP_418799.1| PREDICTED: similar to KIAA0851 prot... 136 8e-32
gi|15235510|ref|NP_192193.1| small nuclear ribonucleoprotein D1,... 128 2e-29
gi|19115525|ref|NP_594613.1| small nuclear ribonucleoprotein smd... 128 2e-29
gi|38344744|emb|CAE03048.2| OSJNBa0089K21.2 [Oryza sativa (japon... 127 7e-29
gi|15231485|ref|NP_187416.1| small nuclear ribonucleoprotein D1,... 127 7e-29
gi|46806276|dbj|BAD17484.1| putative small nuclear ribonucleopro... 125 2e-28
gi|49073013|ref|XP_400757.1| hypothetical protein UM03142.1 [Ust... 123 7e-28
gi|34874855|ref|XP_346027.1| similar to Small nuclear ribonucleo... 122 2e-27
gi|46105460|ref|XP_380534.1| conserved hypothetical protein [Gib... 114 3e-25
gi|49088946|ref|XP_406242.1| conserved hypothetical protein [Asp... 113 8e-25
gi|50543206|ref|XP_499769.1| hypothetical protein [Yarrowia lipo... 111 4e-24
gi|38104411|gb|EAA50982.1| hypothetical protein MG04741.4 [Magna... 109 1e-23
gi|46227255|gb|EAK88205.1| small nuclear ribonucleoprotein D1. S... 108 2e-23
gi|23490523|gb|EAA22278.1| small nuclear riboprotein Sm-D1-like ... 106 9e-23
gi|50259704|gb|EAL22374.1| hypothetical protein CNBB5470 [Crypto... 102 1e-21
gi|32408407|ref|XP_324685.1| hypothetical protein [Neurospora cr... 102 1e-21
gi|23508457|ref|NP_701126.1| small nuclear ribonucleoprotein D1,... 96 1e-19
gi|47229386|emb|CAF99374.1| unnamed protein product [Tetraodon n... 90 9e-18
gi|46441248|gb|EAL00547.1| hypothetical protein CaO19.7673 [Cand... 76 2e-13
gi|6321510|ref|NP_011588.1| Homolog of human core snRNP protein ... 69 3e-11
gi|50410121|ref|XP_456936.1| unnamed protein product [Debaryomyc... 69 3e-11
gi|45190808|ref|NP_985062.1| AER205Wp [Eremothecium gossypii] >g... 68 4e-11
gi|50306519|ref|XP_453233.1| unnamed protein product [Kluyveromy... 67 6e-11
gi|8745056|emb|CAB95310.1| possible small nuclear riboprotein SM... 66 2e-10
gi|50291695|ref|XP_448280.1| unnamed protein product [Candida gl... 65 4e-10
gi|9837174|gb|AAG00461.1| Sm-D1 [Trypanosoma brucei] 65 4e-10
gi|19075064|ref|NP_586665.1| SMALL NUCLEAR RIBONUCLEOPROTEIN (U1... 63 2e-09
gi|19112491|ref|NP_595699.1| probable small nuclear ribonucleopr... 52 4e-06
gi|50555508|ref|XP_505162.1| hypothetical protein [Yarrowia lipo... 52 4e-06
gi|46227630|gb|EAK88565.1| small nucealr riboprotein SMD3, SM do... 50 1e-05
gi|45200940|ref|NP_986510.1| AGL157Cp [Eremothecium gossypii] >g... 50 1e-05
gi|50260161|gb|EAL22822.1| hypothetical protein CNBB0430 [Crypto... 50 1e-05
gi|48106301|ref|XP_396083.1| similar to CG10418-PA [Apis mellifera] 49 2e-05
gi|21358381|ref|NP_648570.1| CG10418-PA [Drosophila melanogaster... 49 2e-05
gi|50310953|ref|XP_455499.1| unnamed protein product [Kluyveromy... 49 2e-05
gi|13812103|ref|NP_113140.1| probable small nuclear ribonucleopr... 49 3e-05
gi|31210107|ref|XP_314020.1| ENSANGP00000010025 [Anopheles gambi... 48 4e-05
gi|10863977|ref|NP_067000.1| LSM2 homolog, U6 small nuclear RNA ... 48 4e-05
gi|46439086|gb|EAK98408.1| hypothetical protein CaO19.514 [Candi... 48 4e-05
gi|11138539|gb|AAG31434.1| snRNP core protein SMX5d [Mus musculus] 48 5e-05
gi|46237602|emb|CAE83980.1| LSM2 homolog, U6 small nuclear RNA a... 48 5e-05
gi|13994221|ref|NP_085100.1| snRNP core protein SMX5; dystrophia... 48 5e-05
gi|28828063|gb|AAO50746.1| similar to expressed protein; protein... 47 7e-05
gi|6319445|ref|NP_009527.1| Like Sm-D1 protein; Lsm2p [Saccharom... 47 9e-05
gi|50294275|ref|XP_449549.1| unnamed protein product [Candida gl... 47 9e-05
gi|14249632|ref|NP_116270.1| LSM10, U7 small nuclear RNA associa... 46 2e-04
gi|50759758|ref|XP_417768.1| PREDICTED: similar to U7 snRNP-spec... 46 2e-04
gi|50259170|gb|EAL21847.1| hypothetical protein CNBC5480 [Crypto... 46 2e-04
gi|50307679|ref|XP_453819.1| unnamed protein product [Kluyveromy... 46 2e-04
gi|50413178|ref|XP_457218.1| unnamed protein product [Debaryomyc... 46 2e-04
gi|49079848|ref|XP_403524.1| hypothetical protein UM05909.1 [Ust... 45 3e-04
gi|33337945|gb|AAQ13594.1| MSTP074 [Homo sapiens] 45 3e-04
gi|45198700|ref|NP_985729.1| AFR182Cp [Eremothecium gossypii] >g... 45 3e-04
gi|34902916|ref|NP_912805.1| unnamed protein product [Oryza sati... 45 4e-04
gi|47212040|emb|CAF92642.1| unnamed protein product [Tetraodon n... 45 4e-04
gi|12230291|sp|Q9LGE6|LSM4_ORYSA Probable U6 snRNA-associated Sm... 45 4e-04
gi|34871191|ref|XP_345582.1| similar to U7 snRNP-specific Sm-lik... 44 6e-04
gi|20270251|ref|NP_620046.1| U7 snRNP-specific Sm-like protein L... 44 6e-04
gi|15241028|ref|NP_198124.1| small nuclear ribonucleoprotein, pu... 44 6e-04
gi|20260282|gb|AAM13039.1| unknown protein [Arabidopsis thaliana... 44 6e-04
gi|21593495|gb|AAM65462.1| glycine rich protein-like [Arabidopsi... 44 6e-04
gi|2113818|emb|CAB05859.1| AmphiBrf43 [Branchiostoma floridae] 44 6e-04
gi|12230258|sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm... 44 7e-04
gi|17561850|ref|NP_506348.1| u6 snRNA-associated Sm-like protein... 44 7e-04
gi|46123175|ref|XP_386141.1| hypothetical protein FG05965.1 [Gib... 44 0.001
gi|38101787|gb|EAA48697.1| hypothetical protein MG00355.4 [Magna... 44 0.001
gi|50288309|ref|XP_446583.1| unnamed protein product [Candida gl... 44 0.001
gi|49088696|ref|XP_406144.1| conserved hypothetical protein [Asp... 44 0.001
gi|18394883|ref|NP_564119.1| small nuclear ribonucleoprotein, pu... 44 0.001
gi|21555384|gb|AAM63846.1| small nuclear ribonucleoprotein, puta... 44 0.001
gi|38103648|gb|EAA50324.1| hypothetical protein MG04083.4 [Magna... 43 0.001
gi|27659256|ref|XP_226489.1| similar to snRNP core protein SMX5d... 43 0.001
gi|23613226|ref|NP_703548.1| u6 snRNA-associated sm-like protein... 43 0.001
gi|21703324|gb|AAM76159.1| U7 snRNP-specific SM-like protein [Bo... 43 0.001
gi|50309757|ref|XP_454891.1| unnamed protein product [Kluyveromy... 43 0.001
gi|32415822|ref|XP_328389.1| hypothetical protein [Neurospora cr... 43 0.002
gi|41052905|dbj|BAD07817.1| putative small nuclear ribonucleopro... 43 0.002
gi|19172997|ref|NP_597548.1| U6 snRNA ASSOCIATED SM-LIKE PROTEIN... 43 0.002
gi|23479567|gb|EAA16362.1| Sm protein, putative [Plasmodium yoel... 43 0.002
gi|23508277|ref|NP_700946.1| U6 snRNA associated Sm-like protein... 43 0.002
gi|12230329|sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm... 42 0.002
gi|46121885|ref|XP_385496.1| hypothetical protein FG05320.1 [Gib... 42 0.002
gi|38110088|gb|EAA55858.1| hypothetical protein MG01509.4 [Magna... 42 0.002
gi|15223010|ref|NP_177757.1| small nuclear ribonucleoprotein D3,... 42 0.002
gi|37806009|dbj|BAC99422.1| putative snRNP core protein SMX5d [O... 42 0.003
gi|39585219|emb|CAE57462.1| Hypothetical protein CBG00427 [Caeno... 42 0.003
gi|45270956|gb|AAS56859.1| YLR147C [Saccharomyces cerevisiae] 41 0.005
gi|6323176|ref|NP_013248.1| involved in snRNP biogenesis and pre... 41 0.005
gi|32404628|ref|XP_322927.1| hypothetical protein [Neurospora cr... 41 0.005
gi|46229862|gb|EAK90680.1| snRNP core protein homolog Sm-X5. SM... 41 0.006
gi|18379085|ref|NP_563682.1| small nuclear ribonucleoprotein D, ... 41 0.006
gi|31232706|ref|XP_318746.1| ENSANGP00000016613 [Anopheles gambi... 40 0.008
gi|23485036|gb|EAA20166.1| Sm protein, putative [Plasmodium yoel... 40 0.008
gi|49097780|ref|XP_410350.1| hypothetical protein AN6213.2 [Aspe... 40 0.008
gi|17542052|ref|NP_503027.1| small nuclear ribonucleoprotein, sm... 40 0.008
gi|25518743|pir||H86164 hypothetical protein F15K9.7 - Arabidops... 40 0.008
gi|46105464|ref|XP_380536.1| hypothetical protein FG00360.1 [Gib... 40 0.014
gi|27371312|gb|AAH40973.1| MGC52856 protein [Xenopus laevis] 39 0.018
gi|47211785|emb|CAF93753.1| unnamed protein product [Tetraodon n... 39 0.024
gi|4759160|ref|NP_004166.1| small nuclear ribonucleoprotein poly... 39 0.024
gi|45550963|ref|NP_723584.2| CG31990-PA [Drosophila melanogaster... 39 0.024
gi|25012547|gb|AAN71375.1| RE35747p [Drosophila melanogaster] 39 0.024
gi|21553911|gb|AAM62994.1| snRNP core Sm protein Sm-X5-like prot... 39 0.024
gi|773428|gb|AAA65451.1| small nuclear ribonucleoprotein 39 0.024
gi|39582333|emb|CAE67582.1| Hypothetical protein CBG13115 [Caeno... 39 0.024
gi|38047763|gb|AAR09784.1| similar to Drosophila melanogaster CG... 39 0.024
gi|27668769|ref|XP_214318.1| similar to U6 snRNA-associated Sm-l... 39 0.032
gi|45361593|ref|NP_989371.1| hypothetical protein MGC76085 [Xeno... 39 0.032
gi|50761130|ref|XP_418245.1| PREDICTED: similar to Hypothetical ... 39 0.032
gi|15079335|gb|AAH11510.1| Small nuclear ribonucleoprotein D3 [M... 39 0.032
gi|29247528|gb|EAA39087.1| GLP_305_2464_2751 [Giardia lamblia AT... 39 0.032
gi|47217413|emb|CAG00773.1| unnamed protein product [Tetraodon n... 39 0.032
gi|41152340|ref|NP_956990.1| LSM4 homolog, U6 small nuclear RNA ... 39 0.032
gi|7657317|ref|NP_056631.1| LSM4 homolog, U6 small nuclear RNA a... 39 0.032
gi|6912486|ref|NP_036453.1| U6 snRNA-associated Sm-like protein ... 39 0.032
gi|13161882|emb|CAC33027.1| Lsm4 protein [Takifugu rubripes] 39 0.032
gi|1723680|sp|P53247|YG2E_YEAST HYPOTHETICAL 14.1 KD PROTEIN IN ... 38 0.041
gi|17533617|ref|NP_495514.1| u6 snRNA-associated Sm-like protein... 38 0.041
gi|13812341|ref|NP_113459.1| putative small nuclear ribonucleopr... 38 0.041
gi|24652901|ref|NP_725106.1| CG8427-PA [Drosophila melanogaster]... 38 0.041
gi|41054297|ref|NP_956054.1| small nuclear ribonucleoprotein D3 ... 38 0.041
gi|19113071|ref|NP_596279.1| putative small ribonuclear protein-... 38 0.041
gi|45200801|ref|NP_986371.1| AGL296Wp [Eremothecium gossypii] >g... 38 0.041
gi|19173042|ref|NP_597593.1| similarity to SMALL NUCLEAR RIBONUC... 38 0.054
gi|31239529|ref|XP_320178.1| ENSANGP00000011800 [Anopheles gambi... 37 0.070
gi|50344816|ref|NP_001002081.1| zgc:86943 [Danio rerio] >gnl|BL_... 37 0.070
gi|23613617|ref|NP_704638.1| small nuclear ribonucleoprotein (sn... 37 0.070
gi|12834762|dbj|BAB23033.1| unnamed protein product [Mus musculus] 37 0.092
gi|48477742|ref|YP_023448.1| snRNP Sm-like protein [Picrophilus ... 37 0.092
gi|19173302|ref|NP_597105.1| U6 snRNA-ASSOCIATED RIBONUCLEOPROTE... 37 0.12
gi|6730225|pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subc... 37 0.12
gi|46432646|gb|EAK92119.1| hypothetical protein CaO19.4146 [Cand... 37 0.12
gi|50259394|gb|EAL22067.1| hypothetical protein CNBC2050 [Crypto... 37 0.12
gi|29246503|gb|EAA38097.1| GLP_127_22232_21855 [Giardia lamblia ... 35 0.27
gi|23483747|gb|EAA19315.1| probable u6 snRNA-associated sm-like ... 35 0.35
gi|8778615|gb|AAF79623.1| F5M15.9 [Arabidopsis thaliana] 35 0.45
gi|50543240|ref|XP_499786.1| hypothetical protein [Yarrowia lipo... 35 0.45
gi|31248054|ref|XP_316632.1| ENSANGP00000011511 [Anopheles gambi... 35 0.45
gi|6320958|ref|NP_011037.1| Like Sm-D3 protein; Lsm4p [Saccharom... 34 0.59
gi|49076098|ref|XP_402061.1| hypothetical protein UM04446.1 [Ust... 34 0.59
gi|605651|gb|AAA58257.1| regulatory protein 34 0.59
gi|38083018|ref|XP_359370.1| similar to LSM5 homolog, U6 small n... 34 0.59
gi|50732968|ref|XP_418849.1| PREDICTED: similar to LSM5 homolog,... 34 0.59
gi|23619200|ref|NP_705162.1| u6 snRNA-associated sm-like protein... 34 0.59
gi|47225103|emb|CAF98730.1| unnamed protein product [Tetraodon n... 34 0.59
gi|6912488|ref|NP_036454.1| U6 snRNA-associated Sm-like protein ... 34 0.59
gi|38074190|ref|XP_357162.1| similar to LSM5 homolog, U6 small n... 34 0.59
gi|38082325|ref|XP_356939.1| similar to LSM5 homolog, U6 small n... 34 0.59
gi|49110192|ref|XP_411726.1| hypothetical protein AN7589.2 [Aspe... 34 0.78
gi|24656550|ref|NP_611528.1| CG9344-PA [Drosophila melanogaster]... 34 0.78
gi|48838252|ref|ZP_00295198.1| COG1958: Small nuclear ribonucleo... 34 0.78
gi|39582859|emb|CAE71635.1| Hypothetical protein CBG18602 [Caeno... 34 0.78
gi|21228485|ref|NP_634407.1| Small nuclear riboprotein-like prot... 34 0.78
gi|48097428|ref|XP_393781.1| similar to LSM5 homolog, U6 small n... 33 1.0
gi|25350049|pir||D89269 protein T10G3.6 [imported] - Caenorhabdi... 33 1.0
gi|47218886|emb|CAG05652.1| unnamed protein product [Tetraodon n... 33 1.3
gi|17560310|ref|NP_506870.1| u6 snRNA-associated Sm-like protein... 33 1.3
gi|27574150|pdb|1N9S|A Chain A, Crystal Structure Of Yeast Smf I... 33 1.3
gi|50545437|ref|XP_500256.1| hypothetical protein [Yarrowia lipo... 33 1.3
gi|50288171|ref|XP_446514.1| unnamed protein product [Candida gl... 33 1.7
gi|1401208|gb|AAD05369.1| small nucleolar ribonucleoprotein E ho... 33 1.7
gi|21554327|gb|AAM63434.1| U6 snRNA-associated Sm-like protein [... 33 1.7
gi|19115292|ref|NP_594380.1| small nuclear ribonucleoprotein, F-... 33 1.7
gi|19074364|ref|NP_585870.1| U6-snRNA ASSOCIATED SMALL NUCLEAR R... 33 1.7
gi|21358059|ref|NP_648022.1| CG6610-PA [Drosophila melanogaster]... 33 1.7
gi|15232179|ref|NP_191540.1| small nuclear ribonucleoprotein F, ... 33 1.7
gi|20090273|ref|NP_616348.1| Sm protein [Methanosarcina acetivor... 33 1.7
gi|19112893|ref|NP_596101.1| small nuclear ribonucleoprotein F [... 32 2.3
gi|11602707|emb|CAC18540.1| putative U6-snRNA-associated protein... 32 2.3
gi|15920992|ref|NP_376661.1| 79aa long hypothetical small nuclea... 32 2.9
gi|27574143|pdb|1N9R|A Chain A, Crystal Structure Of A Heptameri... 32 2.9
gi|6325440|ref|NP_015508.1| Sm or Sm-like snRNP protein; Smx3p [... 32 2.9
gi|29654773|ref|NP_820465.1| SPFH domain/Band 7 family domain pr... 32 3.9
gi|50746299|ref|XP_420431.1| PREDICTED: similar to U6 snRNA-asso... 32 3.9
gi|27667342|ref|XP_224630.1| similar to RIKEN cDNA 2310034K10 [R... 32 3.9
gi|5901998|ref|NP_009011.1| Sm protein F [Homo sapiens] >gnl|BL_... 32 3.9
gi|46108998|ref|XP_381557.1| hypothetical protein FG01381.1 [Gib... 32 3.9
gi|9837172|gb|AAG00460.1| Sm-G [Trypanosoma brucei] 32 3.9
gi|15239727|ref|NP_199698.1| small nuclear ribonucleoprotein, pu... 31 5.0
gi|31212689|ref|XP_315329.1| ENSANGP00000021121 [Anopheles gambi... 31 5.0
gi|32420717|ref|XP_330802.1| hypothetical protein [Neurospora cr... 31 5.0
gi|46915822|emb|CAG22593.1| putative ABC transporter, permease p... 31 5.0
gi|20861373|ref|XP_134104.1| RIKEN cDNA 2410088K19 [Mus musculus] 31 5.0
gi|50549605|ref|XP_502273.1| hypothetical protein [Yarrowia lipo... 31 6.6
gi|39595458|emb|CAE60496.1| Hypothetical protein CBG04114 [Caeno... 31 6.6
gi|50421459|ref|XP_459280.1| unnamed protein product [Debaryomyc... 31 6.6
gi|41690132|ref|ZP_00146664.1| COG1281: Disulfide bond chaperone... 31 6.6
gi|39589389|emb|CAE74418.1| Hypothetical protein CBG22150 [Caeno... 30 8.6
gi|29468365|gb|AAO85522.1| putative U6 snRNA-associated Sm-like ... 30 8.6
gi|17510579|ref|NP_490883.1| u6 snRNA-associated Sm-like protein... 30 8.6
gi|48716974|dbj|BAD23667.1| putative Sm protein F [Oryza sativa ... 30 8.6
gi|45331345|gb|AAS57926.1| Lsm4p [Trypanosoma brucei] 30 8.6
>gi|17536583|ref|NP_495306.1| small nuclear ribonucleoprotein, small
nuclear ribonucleoprotein SNR-3 (13.6 kD) (snr-3)
[Caenorhabditis elegans]
gi|2833218|sp|Q10013|SMD1_CAEEL Probable small nuclear
ribonucleoprotein Sm D1 (snRNP core protein D1) (Sm-D1)
gi|7508672|pir||T16952 hypothetical protein T28D9.10 -
Caenorhabditis elegans
gi|861268|gb|AAA68313.1| Small nuclear ribonucleoprotein protein 3
[Caenorhabditis elegans]
Length = 126
Score = 173 bits (439), Expect = 6e-43
Identities = 88/88 (100%), Positives = 88/88 (100%)
Frame = -1
Query: 381 MKLVRFLMKLSHETVNIELKNGTQVSGTIMGVDVAMNTHLRAVSMTVKNKEPVKLDTLSI 202
MKLVRFLMKLSHETVNIELKNGTQVSGTIMGVDVAMNTHLRAVSMTVKNKEPVKLDTLSI
Sbjct: 1 MKLVRFLMKLSHETVNIELKNGTQVSGTIMGVDVAMNTHLRAVSMTVKNKEPVKLDTLSI 60
Query: 201 RGNNIRYIILPDPLALDTLLIDDEPRKK 118
RGNNIRYIILPDPLALDTLLIDDEPRKK
Sbjct: 61 RGNNIRYIILPDPLALDTLLIDDEPRKK 88