Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T28H10_5
(481 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17564884|ref|NP_506137.1| hemoglobinase-type cysteine protein... 335 3e-91
gi|39592285|emb|CAE75506.1| Hypothetical protein CBG23516 [Caeno... 302 2e-81
gi|6650219|gb|AAF21773.1| hemoglobinase-type cysteine proteinase... 242 2e-63
gi|47550797|ref|NP_999924.1| zgc:76953 [Danio rerio] >gnl|BL_ORD... 167 8e-41
gi|49523231|gb|AAH75316.1| Unknown (protein for MGC:88980) [Xeno... 161 4e-39
gi|22001735|sp|Q9R0J8|LGMN_RAT Legumain precursor (Asparaginyl e... 159 3e-38
gi|31543514|ref|NP_071562.2| legumain; protease, cysteine, 1 (le... 159 3e-38
gi|34783855|gb|AAH56842.1| MGC64351 protein [Xenopus laevis] 158 5e-38
gi|7242187|ref|NP_035305.1| legumain; protease, cysteine, 1; pre... 158 5e-38
gi|27806555|ref|NP_776526.1| legumain [Bos taurus] >gnl|BL_ORD_I... 154 5e-37
gi|50748618|ref|XP_421328.1| PREDICTED: similar to legumain [Gal... 152 2e-36
gi|15221556|ref|NP_176458.1| vacuolar processing enzyme beta / b... 152 3e-36
gi|2129767|pir||S60050 vacuolar processing enzyme (EC 3.4.22.-) ... 152 3e-36
gi|2842759|sp|Q99538|LGMN_HUMAN Legumain precursor (Asparaginyl ... 151 4e-36
gi|21914881|ref|NP_005597.2| legumain; protease, cysteine, 1 (le... 151 4e-36
gi|28070982|emb|CAD61872.1| unnamed protein product [Homo sapiens] 151 4e-36
gi|28071028|emb|CAD61895.1| unnamed protein product [Homo sapiens] 151 4e-36
gi|47221316|emb|CAG13252.1| unnamed protein product [Tetraodon n... 150 7e-36
gi|1890050|dbj|BAA09530.1| cysteine protease [Homo sapiens] 150 1e-35
gi|48146929|emb|CAG33687.1| LGMN [Homo sapiens] 149 3e-35
gi|46411100|gb|AAS94231.1| legumain-like protease precursor [Ixo... 148 4e-35
gi|34530959|dbj|BAC86022.1| unnamed protein product [Homo sapiens] 144 7e-34
gi|9622221|gb|AAF89679.1| asparaginyl endopeptidase [Sesamum ind... 143 1e-33
gi|27544008|dbj|BAC54828.1| vacuolar processing enzyme-1b [Nicot... 143 1e-33
gi|48475140|gb|AAT44209.1| unknown protein [Oryza sativa (japoni... 143 1e-33
gi|5640113|emb|CAB51545.1| vacuolar processing enzyme [Lycopersi... 143 1e-33
gi|4589396|dbj|BAA76744.1| asparaginyl endopeptidase (VmPE-1) [V... 142 3e-33
gi|21536495|gb|AAM60827.1| vacuolar processing enzyme/asparaginy... 142 3e-33
gi|15231080|ref|NP_188656.1| vacuolar processing enzyme, putativ... 142 3e-33
gi|1351411|sp|P49044|VPE_VICSA Vacuolar processing enzyme precur... 142 3e-33
gi|729709|sp|P09841|HGLB_SCHMA Hemoglobinase precursor (Antigen ... 141 6e-33
gi|15233996|ref|NP_195020.1| vacuolar processing enzyme gamma / ... 140 8e-33
gi|6851050|emb|CAB71158.1| asparaginyl endopeptidase [Schistosom... 140 8e-33
gi|14916737|sp|Q39119|VPEG_ARATH Vacuolar processing enzyme, gam... 140 8e-33
gi|1170271|sp|P42665|HGLB_SCHJA Hemoglobinase precursor (Antigen... 140 1e-32
gi|11558854|emb|CAC18100.1| putative legumain [Zea mays] 140 1e-32
gi|4154281|gb|AAD04883.1| C13 endopeptidase NP1 precursor [Zea m... 140 1e-32
gi|161019|gb|AAA29895.1| hemoglobinase 140 1e-32
gi|34914086|ref|NP_918390.1| asparaginyl endopeptidase [Oryza sa... 140 1e-32
gi|39753981|gb|AAR30508.1| SJ32 [Schistosoma japonicum] 139 2e-32
gi|1346432|sp|P49046|LEGU_CANEN Legumain precursor (Asparaginyl ... 139 2e-32
gi|7739789|gb|AAF69014.1| cysteine protease [Ipomoea batatas] 139 3e-32
gi|1351408|sp|P49043|VPE_CITSI Vacuolar processing enzyme precur... 138 4e-32
gi|11558852|emb|CAC18099.1| putative legumain [Zea mays] 138 4e-32
gi|1351409|sp|P49042|VPE_RICCO Vacuolar processing enzyme precur... 138 4e-32
gi|27544006|dbj|BAC54827.1| vacuolar processing enzyme-1a [Nicot... 138 4e-32
gi|27544010|dbj|BAC54829.1| vacuolar processing enzyme-2 [Nicoti... 138 4e-32
gi|27544012|dbj|BAC54830.1| vacuolar processing enzyme-3 [Nicoti... 138 5e-32
gi|15225226|ref|NP_180165.1| vacuolar processing enzyme alpha / ... 137 6e-32
gi|40809674|emb|CAB42650.2| putative preprolegumain [Nicotiana t... 137 6e-32
gi|38567871|emb|CAE03020.3| OSJNBa0091D06.13 [Oryza sativa (japo... 137 8e-32
gi|30465961|dbj|BAC76418.1| vacuolar processing enzyme [Oryza sa... 137 8e-32
gi|26006020|dbj|BAC41386.1| asparaginyl endopeptidase REP-2 [Ory... 137 1e-31
gi|48474249|sp|O24326|VPE2_PHAVU Vacuolar processing enzyme prec... 136 1e-31
gi|1351410|sp|P49045|VPE_SOYBN Vacuolar processing enzyme precur... 136 1e-31
gi|40809676|emb|CAB42651.2| putative preprolegumain [Nicotiana t... 135 2e-31
gi|6634703|emb|CAB64544.1| legumain-like protease [Zea mays] 134 9e-31
gi|6634705|emb|CAB64545.1| legumain-like protease [Zea mays] 133 1e-30
gi|34897734|ref|NP_910213.1| Similar to Phaseolus vulgaris Molda... 132 3e-30
gi|9622155|gb|AAF89646.1| seed maturation protein PM40 [Glycine ... 132 4e-30
gi|4589398|dbj|BAA76745.1| asparaginyl endopeptidase (VmPE-1A) [... 132 4e-30
gi|13183095|gb|AAK15049.1| asparaginyl endopeptidase [Vigna radi... 131 5e-30
gi|2414681|emb|CAB16318.1| cysteine proteinase precursor [Vicia ... 130 8e-30
gi|14594819|emb|CAC43295.1| putative vacuolar processing enzyme ... 130 1e-29
gi|48429177|sp|O24325|VPE1_PHAVU Vacuolar processing enzyme prec... 130 1e-29
gi|25344843|pir||C96652 protein F23N19.7 [imported] - Arabidopsi... 129 2e-29
gi|40643267|emb|CAC85636.1| legumain like precursor [Fasciola he... 126 2e-28
gi|7488870|pir||T10944 cysteine proteinase (EC 3.4.22.-) precurs... 126 2e-28
gi|39748726|emb|CAE84598.1| putative legumain [Nicotiana tabacum] 116 2e-25
gi|4154279|gb|AAD04882.1| C13 endopeptidase NP1 precursor [Horde... 108 4e-23
gi|4803733|emb|CAB42655.1| putative preprolegumain [Vicia narbon... 108 4e-23
gi|37654532|gb|AAQ93040.1| legumain-like cysteine proteinase 2 [... 107 7e-23
gi|17864752|gb|AAL40390.1| C13 cysteine proteinase precursor [Or... 104 6e-22
gi|50293979|ref|XP_449401.1| unnamed protein product [Candida gl... 94 1e-18
gi|50425733|ref|XP_461463.1| unnamed protein product [Debaryomyc... 91 7e-18
gi|50309421|ref|XP_454718.1| unnamed protein product [Kluyveromy... 91 1e-17
gi|45188173|ref|NP_984396.1| ADR299Wp [Eremothecium gossypii] >g... 90 2e-17
gi|6320538|ref|NP_010618.1| ER membrane glycoprotein subunit of ... 90 2e-17
gi|46433063|gb|EAK92519.1| hypothetical protein CaO19.2799 [Cand... 90 2e-17
gi|46805856|dbj|BAD17190.1| putative GPI-anchor transamidase pre... 87 1e-16
gi|50555447|ref|XP_505132.1| hypothetical protein [Yarrowia lipo... 85 5e-16
gi|46136239|ref|XP_389811.1| hypothetical protein FG09635.1 [Gib... 85 6e-16
gi|161061|gb|AAA29916.1| protease 85 6e-16
gi|49388653|dbj|BAD25788.1| putative asparaginyl endopeptidase R... 84 8e-16
gi|38099449|gb|EAA46796.1| hypothetical protein MG10490.4 [Magna... 84 1e-15
gi|32414131|ref|XP_327545.1| hypothetical protein [Neurospora cr... 84 1e-15
gi|18390936|ref|NP_563825.1| GPI-anchor transamidase, putative [... 84 1e-15
gi|21537105|gb|AAM61446.1| putative GPI-anchor transamidase [Ara... 84 1e-15
gi|39573850|gb|AAQ93039.1| legumain-like cysteine proteinase 1 [... 84 1e-15
gi|50257599|gb|EAL20304.1| hypothetical protein CNBF1160 [Crypto... 84 1e-15
gi|39593710|emb|CAE62002.1| Hypothetical protein CBG06010 [Caeno... 84 1e-15
gi|17542212|ref|NP_502076.1| phosphatidylinositol glycan class (... 82 3e-15
gi|49085832|ref|XP_405008.1| hypothetical protein AN0871.2 [Aspe... 81 9e-15
gi|49079334|ref|XP_403324.1| hypothetical protein UM05709.1 [Ust... 80 2e-14
gi|48095841|ref|XP_394531.1| similar to ENSANGP00000013498 [Apis... 80 2e-14
gi|19075698|ref|NP_588198.1| putative gpi-anchor transamidase [S... 77 1e-13
gi|50751426|ref|XP_422392.1| PREDICTED: similar to GPI-anchor tr... 77 1e-13
gi|1518259|emb|CAA68871.1| gpi8 [Homo sapiens] 76 2e-13
gi|23199983|ref|NP_005473.1| phosphatidylinositol glycan, class ... 76 2e-13
gi|7511896|pir||T13411 hypothetical protein 133E12.3 - fruit fly... 75 4e-13
gi|24639234|ref|NP_569968.2| CG4406-PA [Drosophila melanogaster]... 75 4e-13
gi|29789447|ref|NP_821135.1| phosphatidylinositol glycan, class ... 75 5e-13
gi|26335483|dbj|BAC31442.1| unnamed protein product [Mus musculus] 74 9e-13
gi|31209217|ref|XP_313575.1| ENSANGP00000013498 [Anopheles gambi... 74 9e-13
gi|29788753|ref|NP_079938.1| phosphatidylinositol glycan, class ... 74 9e-13
gi|50344954|ref|NP_001002149.1| zgc:86702 [Danio rerio] >gnl|BL_... 74 1e-12
gi|22553078|emb|CAD44992.1| GPI transamidase 8 [Toxoplasma gondii] 72 6e-12
gi|22001631|sp|Q9CXY9|GPI8_MOUSE GPI-anchor transamidase precurs... 69 5e-11
gi|5834624|emb|CAB55340.1| GPI:protein transamidase [Leishmania ... 67 1e-10
gi|9802563|gb|AAF99765.1| F22O13.24 [Arabidopsis thaliana] 61 1e-08
gi|7485988|pir||T00731 hypothetical protein F22O13.26 - Arabidop... 60 1e-08
gi|19173230|ref|NP_597033.1| putative PEPTIDASE [Encephalitozoon... 57 1e-07
gi|46227592|gb|EAK88527.1| glycosylphosphatidylinositol transami... 57 2e-07
gi|15485606|emb|CAC67556.1| Gpi8 transamidase [Trypanosoma bruce... 56 2e-07
gi|23508489|ref|NP_701158.1| GPI8p transamidase [Plasmodium falc... 56 3e-07
gi|23477976|gb|EAA15187.1| GPI8p transamidase-related [Plasmodiu... 55 7e-07
gi|34860971|ref|XP_215723.2| similar to DKFZP564I052 protein [Ra... 43 0.002
gi|47157049|gb|AAT12403.1| putative peptidase-like protein [Anto... 36 0.26
gi|47204719|emb|CAF93106.1| unnamed protein product [Tetraodon n... 35 0.45
gi|16923219|gb|AAL29895.1| GPI8 transamidase [Paramecium tetraur... 35 0.59
gi|1346288|sp|P80527|HGL1_FASHE Hemoglobinase-like protein 1 (Ne... 34 1.0
gi|32471388|ref|NP_864381.1| hypothetical protein RB1372 [Pirell... 34 1.0
gi|22652790|gb|AAN03817.1| dihydrolipoamide dehydrogenase [Methy... 33 2.2
gi|12667278|gb|AAK01372.1| putative membrane protein [Carassius ... 32 3.8
gi|22036478|gb|AAM89659.1| IcsA [Shigella sonnei] 32 3.8
gi|42524147|ref|NP_969527.1| dihydrolipoamide dehydrogenase [Bde... 32 3.8
gi|16805124|ref|NP_473152.1| hypothetical protein, conserved [Pl... 32 3.8
gi|32420211|ref|XP_330549.1| hypothetical protein [Neurospora cr... 32 5.0
gi|2924421|emb|CAA12088.1| peptide synthetase [uncultured cyanob... 32 6.5
gi|28558947|ref|NP_788207.1| RC220 [Ruegeria sp. PR1b] >gnl|BL_O... 31 8.5
gi|15987936|gb|AAL12800.1| LktB [Mannheimia glucosida] 31 8.5
gi|15987940|gb|AAL12803.1| LktB [Mannheimia glucosida] 31 8.5
gi|15987932|gb|AAL12797.1| LktB [Mannheimia glucosida] >gnl|BL_O... 31 8.5
gi|15987944|gb|AAL12806.1| LktB [Mannheimia glucosida] 31 8.5
gi|15987916|gb|AAL12785.1| LktB [Mannheimia haemolytica] 31 8.5
gi|1708223|sp|P55122|HLYB_PASSP Leukotoxin secretion/processing ... 31 8.5
gi|23489953|gb|EAA21840.1| hypothetical protein [Plasmodium yoel... 31 8.5
gi|15669586|ref|NP_248399.1| M. jannaschii predicted coding regi... 31 8.5
gi|1346289|sp|P80530|HGL2_FASHE Hemoglobinase-like protein 2 (Ne... 31 8.5
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 31 8.5
>gi|17564884|ref|NP_506137.1| hemoglobinase-type cysteine proteinase
family C13, legumain (53.2 kD) (5M993) [Caenorhabditis
elegans]
gi|7511553|pir||T19231 probable cysteine proteinase (EC 3.4.22.-)
T28H10.3, precursor [similarity] - Caenorhabditis
elegans
gi|3874284|emb|CAB01126.1| Hypothetical protein T28H10.3
[Caenorhabditis elegans]
gi|3880362|emb|CAA99935.1| Hypothetical protein T28H10.3
[Caenorhabditis elegans]
Length = 462
Score = 335 bits (858), Expect = 3e-91
Identities = 160/160 (100%), Positives = 160/160 (100%)
Frame = +1
Query: 1 MRPLALLICIIVLFLVTEARYNPRKGLAAGRQRKHKYQDEGEAFVVLVAGSNGWYNYRHQ 180
MRPLALLICIIVLFLVTEARYNPRKGLAAGRQRKHKYQDEGEAFVVLVAGSNGWYNYRHQ
Sbjct: 1 MRPLALLICIIVLFLVTEARYNPRKGLAAGRQRKHKYQDEGEAFVVLVAGSNGWYNYRHQ 60
Query: 181 ADVAHAYHTLRNHGIPEENIITMMYDDVANNPLNPYKGKLFNRPHGKDLYKGLKIDYKGA 360
ADVAHAYHTLRNHGIPEENIITMMYDDVANNPLNPYKGKLFNRPHGKDLYKGLKIDYKGA
Sbjct: 61 ADVAHAYHTLRNHGIPEENIITMMYDDVANNPLNPYKGKLFNRPHGKDLYKGLKIDYKGA 120
Query: 361 SVTPENFLNVLKGNASGIDGGNGRVLETNDNDRVFVYFTD 480
SVTPENFLNVLKGNASGIDGGNGRVLETNDNDRVFVYFTD
Sbjct: 121 SVTPENFLNVLKGNASGIDGGNGRVLETNDNDRVFVYFTD 160