Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W01A11_6
         (507 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17564954|ref|NP_504651.1| MOlybdenum Cofactor biosynthesis (1...   332   2e-90
gi|7508737|pir||T29649 hypothetical protein W01A11.6 - Caenorhab...   318   4e-86
gi|7503569|pir||T33961 hypothetical protein F46E10.5 - Caenorhab...   267   6e-71
gi|39594315|emb|CAE71893.1| Hypothetical protein CBG18951 [Caeno...   172   2e-42
gi|15242124|ref|NP_197599.1| molybdopterin biosynthesis CNX1 pro...   142   2e-33
gi|1263314|gb|AAA97413.1| molybdenum cofactor biosynthesis enzym...   142   2e-33
gi|29726984|pdb|1O8Q|A Chain A, The Active Site Of The Molybdenu...   141   7e-33
gi|28948325|pdb|1O8N|A Chain A, The Active Site Of The Molybdenu...   140   1e-32
gi|40889164|pdb|1O8O|A Chain A, The Active Site Of The Molybdenu...   140   2e-32
gi|32489033|emb|CAE04830.1| OSJNBa0084K01.2 [Oryza sativa (japon...   138   4e-32
gi|17942762|pdb|1EAV|A Chain A, Crystal Structures Of Human Geph...   137   8e-32
gi|8118717|gb|AAF73075.1| molybdenum cofactor biosynthesis prote...   136   2e-31
gi|49257222|gb|AAH71153.1| Unknown (protein for MGC:83148) [Xeno...   135   3e-31
gi|15988244|pdb|1JLJ|A Chain A, 1.6 Angstrom Crystal Structure O...   135   4e-31
gi|14277808|pdb|1IHC|A Chain A, X-Ray Structure Of Gephyrin N-Te...   135   4e-31
gi|49899139|gb|AAH76865.1| Unknown (protein for MGC:84626) [Xeno...   135   4e-31
gi|27370466|ref|NP_766540.1| gephyrin [Mus musculus] >gnl|BL_ORD...   135   4e-31
gi|5733818|gb|AAD49748.1| gephyrin [Gallus gallus]                    135   4e-31
gi|10880983|ref|NP_065857.1| gephyrin; gephryin [Homo sapiens] >...   135   4e-31
gi|16605466|emb|CAC81240.1| gephyrin [Homo sapiens]                   135   4e-31
gi|12408326|ref|NP_074056.1| gephyrin [Rattus norvegicus] >gnl|B...   135   4e-31
gi|13431554|sp|Q9NQX3|GEPH_HUMAN Gephyrin >gnl|BL_ORD_ID|11289 g...   135   4e-31
gi|7243151|dbj|BAA92623.1| KIAA1385 protein [Homo sapiens]            135   4e-31
gi|50748990|ref|XP_426434.1| PREDICTED: similar to gephyrin [Gal...   129   3e-29
gi|31206325|ref|XP_312114.1| ENSANGP00000016755 [Anopheles gambi...   129   3e-29
gi|47224562|emb|CAG03546.1| unnamed protein product [Tetraodon n...   129   4e-29
gi|23831075|sp|Q03555|GEPH_RAT Gephyrin (Putative glycine recept...   126   2e-28
gi|1079093|pir||S47896 probable molybdopterin biosynthesis prote...   124   1e-27
gi|17136978|ref|NP_477030.1| CG2945-PA [Drosophila melanogaster]...   124   1e-27
gi|49235139|ref|ZP_00329213.1| COG0521: Molybdopterin biosynthes...   123   1e-27
gi|23113172|ref|ZP_00098573.1| COG0521: Molybdopterin biosynthes...   121   6e-27
gi|14250939|emb|CAC39235.1| Mog protein [Eubacterium acidaminoph...   120   1e-26
gi|34420588|gb|AAQ67536.1| cinnamon [Drosophila melanogaster]         119   3e-26
gi|17380356|sp|P39205|CIN_DROME Molybdenum cofactor synthesis pr...   119   4e-26
gi|34420544|gb|AAQ67514.1| cinnamon [Drosophila melanogaster] >g...   118   5e-26
gi|34420584|gb|AAQ67534.1| cinnamon [Drosophila melanogaster] >g...   118   5e-26
gi|34420592|gb|AAQ67538.1| cinnamon [Drosophila simulans] >gnl|B...   118   5e-26
gi|29375962|ref|NP_815116.1| molybdenum cofactor biosynthesis fa...   110   1e-23
gi|18311068|ref|NP_563002.1| molybdopterin biosynthesis protein ...   110   1e-23
gi|46579384|ref|YP_010192.1| molybdenum cofactor biosynthesis pr...   109   3e-23
gi|23475949|ref|ZP_00131204.1| COG0521: Molybdopterin biosynthes...   107   1e-22
gi|24371665|ref|NP_715707.1| molybdenum cofactor biosynthesis pr...   104   7e-22
gi|39997799|ref|NP_953750.1| molybdenum cofactor biosynthesis pr...   104   7e-22
gi|46915741|emb|CAG22512.1| putative molybdenum cofactor biosynt...   103   1e-21
gi|48845176|ref|ZP_00299462.1| COG0521: Molybdopterin biosynthes...   103   1e-21
gi|50877286|emb|CAG37126.1| probable molybdopterin biosynthesis ...   102   3e-21
gi|29830213|ref|NP_824847.1| putative molybdopterin biosynthesis...   101   6e-21
gi|15895292|ref|NP_348641.1| Molybdopterin biosynthesis enzyme, ...   101   6e-21
gi|46199944|ref|YP_005611.1| molybdopterin biosynthesis mog prot...   100   1e-20
gi|21221615|ref|NP_627394.1| molybdenum cofactor biosynthesis pr...   100   1e-20
gi|48835671|ref|ZP_00292670.1| COG0521: Molybdopterin biosynthes...   100   2e-20
gi|15605657|ref|NP_213032.1| molybdenum cofactor biosynthesis MO...   100   2e-20
gi|49080634|ref|XP_403813.1| hypothetical protein UM06198.1 [Ust...   100   2e-20
gi|34557568|ref|NP_907383.1| MOLYBDENUM COFACTOR BIOSYNTHESIS MO...    94   1e-18
gi|37520235|ref|NP_923612.1| molybdopterin biosynthesis protein ...    94   2e-18
gi|22959680|ref|ZP_00007328.1| COG0521: Molybdopterin biosynthes...    92   4e-18
gi|32265548|ref|NP_859580.1| molybdopterin biosynthesis enzyme M...    91   8e-18
gi|15792074|ref|NP_281897.1| molybdopterin biosynthesis protein ...    91   1e-17
gi|23013673|ref|ZP_00053542.1| COG0521: Molybdopterin biosynthes...    91   1e-17
gi|23009948|ref|ZP_00050809.1| COG0521: Molybdopterin biosynthes...    91   1e-17
gi|15608005|ref|NP_215380.1| mog [Mycobacterium tuberculosis H37...    89   3e-17
gi|50841997|ref|YP_055224.1| molybdenum cofactor biosynthesis pr...    89   4e-17
gi|48855078|ref|ZP_00309238.1| COG0315: Molybdenum cofactor bios...    88   9e-17
gi|38106709|gb|EAA52981.1| hypothetical protein MG06109.4 [Magna...    87   1e-16
gi|33151331|ref|NP_872684.1| molybdopterin biosynthesis protein ...    87   1e-16
gi|17989118|ref|NP_541751.1| MOLYBDOPTERIN BIOSYNTHESIS MOG PROT...    87   2e-16
gi|15611802|ref|NP_223453.1| MOLYBDOPTERIN BIOSYNTHESIS PROTEIN ...    86   3e-16
gi|34498654|ref|NP_902869.1| molybdopterin biosynthesis Mog prot...    86   3e-16
gi|47574364|ref|ZP_00244400.1| COG0521: Molybdopterin biosynthes...    86   4e-16
gi|50122806|ref|YP_051973.1| molybdopterin biosynthesis protein ...    85   6e-16
gi|15645418|ref|NP_207592.1| molybdopterin biosynthesis protein ...    85   6e-16
gi|32030413|ref|ZP_00133269.1| COG0521: Molybdopterin biosynthes...    85   6e-16
gi|23467121|ref|ZP_00122705.1| COG0521: Molybdopterin biosynthes...    85   6e-16
gi|16272288|ref|NP_438500.1| molybdopeterin biosynthesis protein...    85   8e-16
gi|16120793|ref|NP_404106.1| molybdopterin biosynthesis protein ...    84   1e-15
gi|46362832|ref|ZP_00225664.1| COG0521: Molybdopterin biosynthes...    84   1e-15
gi|49092908|ref|XP_407915.1| hypothetical protein AN3778.2 [Aspe...    84   1e-15
gi|46121843|ref|XP_385475.1| hypothetical protein FG05299.1 [Gib...    84   1e-15
gi|42630636|ref|ZP_00156175.1| COG0521: Molybdopterin biosynthes...    84   1e-15
gi|41406901|ref|NP_959737.1| Mog [Mycobacterium avium subsp. par...    84   1e-15
gi|41407017|ref|NP_959853.1| MoaB2 [Mycobacterium avium subsp. p...    84   1e-15
gi|42629798|ref|ZP_00155343.1| COG0521: Molybdopterin biosynthes...    84   1e-15
gi|15799689|ref|NP_285701.1| required for the efficient incorpor...    84   2e-15
gi|6980503|pdb|1DI6|A Chain A, 1.45 A Crystal Structure Of The M...    84   2e-15
gi|26245930|ref|NP_751969.1| Molybdopterin biosynthesis mog prot...    84   2e-15
gi|24111459|ref|NP_705969.1| Mog, required for the efficient inc...    84   2e-15
gi|16759001|ref|NP_454618.1| molybdopterin biosynthesis Mog prot...    83   2e-15
gi|15840409|ref|NP_335446.1| molybdopterin biosynthesis protein ...    83   3e-15
gi|15608124|ref|NP_215499.1| moaB2 [Mycobacterium tuberculosis H...    83   3e-15
gi|15826990|ref|NP_301253.1| putative molybdenum cofactor biosyn...    83   3e-15
gi|13476170|ref|NP_107740.1| molybdopterin biosynthesis, protein...    83   3e-15
gi|16763398|ref|NP_459013.1| putative molybdochetalase [Salmonel...    83   3e-15
gi|32034922|ref|ZP_00135013.1| COG0521: Molybdopterin biosynthes...    82   4e-15
gi|27377622|ref|NP_769151.1| molybdopterin biosynthesis protein ...    82   5e-15
gi|48831755|ref|ZP_00288808.1| COG0521: Molybdopterin biosynthes...    82   6e-15
gi|15603868|ref|NP_246942.1| Mog [Pasteurella multocida Pm70] >g...    81   8e-15
gi|41722922|ref|ZP_00149888.1| COG0521: Molybdopterin biosynthes...    81   8e-15
gi|15887972|ref|NP_353653.1| AGR_C_1121p [Agrobacterium tumefaci...    81   1e-14
gi|37524575|ref|NP_927919.1| molybdopterin biosynthesis protein ...    80   1e-14
gi|32419905|ref|XP_330396.1| hypothetical protein [Neurospora cr...    79   3e-14
gi|47220100|emb|CAF99013.1| unnamed protein product [Tetraodon n...    79   3e-14
gi|25027854|ref|NP_737908.1| putative molybdopterin biosynthesis...    79   4e-14
gi|21323958|dbj|BAB98584.1| Molybdopterin biosynthesis enzymes [...    79   4e-14
gi|39934103|ref|NP_946379.1| molybdopterin biosynthesis, protein...    79   4e-14
gi|38233115|ref|NP_938882.1| Putative molybdenum cofactor biosyn...    79   4e-14
gi|19552415|ref|NP_600417.1| molybdopterin biosynthesis enzyme [...    79   4e-14
gi|19551461|ref|NP_599463.1| molybdopterin biosynthesis enzyme [...    79   4e-14
gi|45519524|ref|ZP_00171075.1| COG0521: Molybdopterin biosynthes...    79   5e-14
gi|2497963|sp|Q56208|MOCB_SYNP7 Molybdenum cofactor biosynthesis...    78   7e-14
gi|25026741|ref|NP_736795.1| putative molybdopterin biosynthesis...    78   7e-14
gi|46129789|ref|ZP_00202149.1| COG0521: Molybdopterin biosynthes...    78   7e-14
gi|21322974|dbj|BAB97603.1| Molybdopterin biosynthesis enzymes [...    78   9e-14
gi|21674152|ref|NP_662217.1| molybdenum cofactor biosynthesis pr...    77   1e-13
gi|23102015|ref|ZP_00088547.1| COG0521: Molybdopterin biosynthes...    77   2e-13
gi|33595853|ref|NP_883496.1| molybdopterin biosynthesis protein ...    77   2e-13
gi|33600382|ref|NP_887942.1| molybdopterin biosynthesis protein ...    77   2e-13
gi|25027507|ref|NP_737561.1| putative molybdopterin biosynthesis...    77   2e-13
gi|33592162|ref|NP_879806.1| molybdopterin biosynthesis protein ...    76   3e-13
gi|48768937|ref|ZP_00273285.1| COG0521: Molybdopterin biosynthes...    76   4e-13
gi|15893575|ref|NP_346924.1| Molybdopterin biosynthesis protein ...    75   5e-13
gi|17545662|ref|NP_519064.1| PROBABLE MOLYBDOCHETALASE IN MOLYBD...    75   8e-13
gi|46322184|ref|ZP_00222555.1| COG0521: Molybdopterin biosynthes...    75   8e-13
gi|38233105|ref|NP_938872.1| Putative bifunctional molybdopterim...    74   1e-12
gi|16124271|ref|NP_418835.1| molybdenum cofactor biosynthesis pr...    74   1e-12
gi|46316681|ref|ZP_00217260.1| COG0521: Molybdopterin biosynthes...    74   1e-12
gi|15806310|ref|NP_295016.1| molybdenum cofactor biosynthesis pr...    74   1e-12
gi|38605095|sp|Q9ZIN3|MOAB_STACA Molybdenum cofactor biosynthesi...    74   2e-12
gi|14590425|ref|NP_142491.1| molybdenum cofactor biosynthesis pr...    73   3e-12
gi|15964596|ref|NP_384949.1| PROBABLE MOLYBDENUM COFACTOR BIOSYN...    72   5e-12
gi|50085043|ref|YP_046553.1| bifunctional protein [Includes: mol...    71   9e-12
gi|19552103|ref|NP_600105.1| molybdopterin biosynthesis enzyme [...    71   9e-12
gi|46106401|ref|ZP_00199972.1| COG0521: Molybdopterin biosynthes...    71   1e-11
gi|45915435|ref|ZP_00197088.1| COG0521: Molybdopterin biosynthes...    71   1e-11
gi|48784718|ref|ZP_00281023.1| COG0521: Molybdopterin biosynthes...    70   2e-11
gi|49484490|ref|YP_041714.1| putative molybdenum cofactor biosyn...    70   2e-11
gi|18976744|ref|NP_578101.1| molybdenum cofactor biosynthesis pr...    70   2e-11
gi|48763691|ref|ZP_00268245.1| COG0521: Molybdopterin biosynthes...    70   3e-11
gi|45507663|ref|ZP_00160006.1| COG0521: Molybdopterin biosynthes...    70   3e-11
gi|38233454|ref|NP_939221.1| Putative molybdopterin biosynthesis...    69   4e-11
gi|17228295|ref|NP_484843.1| molybdopterin precursor biosynthesi...    69   4e-11
gi|11497881|ref|NP_069103.1| molybdenum cofactor biosynthesis pr...    68   7e-11
gi|14521726|ref|NP_127202.1| molybdenum cofactor biosynthesis pr...    68   7e-11
gi|49081612|gb|AAT50206.1| PA3029 [synthetic construct]                68   1e-10
gi|28869549|ref|NP_792168.1| molybdenum cofactor biosynthesis pr...    68   1e-10
gi|15598225|ref|NP_251719.1| molybdopterin biosynthetic protein ...    68   1e-10
gi|48728712|ref|ZP_00262467.1| COG0521: Molybdopterin biosynthes...    68   1e-10
gi|23468807|ref|ZP_00124142.1| COG0521: Molybdopterin biosynthes...    68   1e-10
gi|48863473|ref|ZP_00317367.1| COG0521: Molybdopterin biosynthes...    67   2e-10
gi|21321900|dbj|BAB96587.1| Molybdopterin biosynthesis Mog prote...    67   2e-10
gi|26988846|ref|NP_744271.1| molybdenum cofactor biosynthesis pr...    67   2e-10
gi|21283922|ref|NP_647010.1| molybdopterin precursor biosynthesi...    66   3e-10
gi|15925265|ref|NP_372799.1| molybdopterin precursor biosynthesi...    66   4e-10
gi|45359048|ref|NP_988605.1| Molybdenum cofactor biosynthesis pr...    66   4e-10
gi|23126197|ref|ZP_00108101.1| COG0521: Molybdopterin biosynthes...    65   6e-10
gi|30022831|ref|NP_834462.1| Molybdenum cofactor biosynthesis pr...    65   6e-10
gi|15679849|ref|NP_276967.1| molybdenum cofactor biosynthesis Mo...    65   6e-10
gi|15668339|ref|NP_247135.1| molybdenum cofactor biosynthesis pr...    65   8e-10
gi|47565191|ref|ZP_00236234.1| molybdopterin precursor biosynthe...    65   8e-10
gi|27468766|ref|NP_765403.1| molybdopterin precursor biosynthesi...    64   1e-09
gi|15615584|ref|NP_243888.1| molybdopterin precursor biosynthesi...    64   1e-09
gi|21230339|ref|NP_636256.1| molybdopterin biosynthesis protein ...    64   1e-09
gi|42783955|ref|NP_981202.1| molybdenum cofactor biosynthesis pr...    64   2e-09
gi|32474979|ref|NP_867973.1| molybdopterin precursor biosynthesi...    63   2e-09
gi|26991284|ref|NP_746709.1| molybdenum cofactor biosynthesis pr...    63   3e-09
gi|21402809|ref|NP_658794.1| MoCF_biosynth, Molybdenum cofactor ...    62   4e-09
gi|21241712|ref|NP_641294.1| molybdopterin biosynthesis protein ...    62   5e-09
gi|16759727|ref|NP_455344.1| molybdenum cofactor biosynthesis pr...    62   7e-09
gi|48731692|ref|ZP_00265436.1| COG0521: Molybdopterin biosynthes...    62   7e-09
gi|24112150|ref|NP_706660.1| molybdopterin biosynthesis, protein...    61   9e-09
gi|26246753|ref|NP_752793.1| Molybdenum cofactor biosynthesis pr...    61   9e-09
gi|15800533|ref|NP_286545.1| molybdopterin biosynthesis, protein...    61   9e-09
gi|27366355|ref|NP_761883.1| Molybdenum cofactor biosynthesis pr...    61   9e-09
gi|33867004|ref|NP_898563.1| molybdenum cofactor biosynthesis pr...    61   9e-09
gi|48891572|ref|ZP_00325065.1| COG0521: Molybdopterin biosynthes...    61   1e-08
gi|28898869|ref|NP_798474.1| molybdenum cofactor biosynthesis pr...    60   2e-08
gi|18312316|ref|NP_558983.1| molybdenum cofactor biosynthesis pr...    60   2e-08
gi|30749483|pdb|1MKZ|A Chain A, Crystal Structure Of Moab Protei...    60   2e-08
gi|15641038|ref|NP_230670.1| molybdenum cofactor biosynthesis pr...    59   3e-08
gi|15922647|ref|NP_378316.1| 178aa long hypothetical molybdenum ...    59   3e-08
gi|49258634|pdb|1R2K|B Chain B, Crystal Structure Of Moab From E...    59   3e-08
gi|48838845|ref|ZP_00295783.1| COG0521: Molybdopterin biosynthes...    59   3e-08
gi|15599110|ref|NP_252604.1| molybdopterin biosynthetic protein ...    59   4e-08
gi|46164556|ref|ZP_00205108.1| COG0521: Molybdopterin biosynthes...    59   4e-08
gi|49081788|gb|AAT50294.1| PA3915 [synthetic construct]                59   4e-08
gi|48849462|ref|ZP_00303705.1| COG0521: Molybdopterin biosynthes...    58   8e-08
gi|20089085|ref|NP_615160.1| molybdenum cofactor biosynthesis pr...    58   1e-07
gi|22972809|ref|ZP_00019666.1| hypothetical protein [Chloroflexu...    58   1e-07
gi|15895264|ref|NP_348613.1| Molybdopterin biosynthesis enzyme, ...    57   1e-07
gi|46907280|ref|YP_013669.1| molybdenum cofactor biosynthesis pr...    57   1e-07
gi|16803088|ref|NP_464573.1| similar to molybdenum cofactor bios...    57   2e-07
gi|47096136|ref|ZP_00233736.1| molybdenum cofactor biosynthesis ...    57   2e-07
gi|45531348|ref|ZP_00182402.1| COG0521: Molybdopterin biosynthes...    57   2e-07
gi|33595786|ref|NP_883429.1| molybdenum cofactor biosynthesis pr...    56   3e-07
gi|21227580|ref|NP_633502.1| Molybdenum cofactor biosynthesis pr...    55   5e-07
gi|50121740|ref|YP_050907.1| molybdenum cofactor biosynthesis pr...    55   5e-07
gi|16800109|ref|NP_470377.1| similar to molybdenum cofactor bios...    55   5e-07
gi|16079998|ref|NP_390824.1| molybdopterin precursor biosynthesi...    55   8e-07
gi|33593672|ref|NP_881316.1| molybdenum cofactor biosynthesis pr...    55   8e-07
gi|20093991|ref|NP_613838.1| Molybdopterin biosynthesis enzyme [...    54   2e-06
gi|15896991|ref|NP_341596.1| Molybdenum cofactor biosynthesis pr...    53   2e-06
gi|28378211|ref|NP_785103.1| molybdopterin biosynthesis protein ...    53   3e-06
gi|45521304|ref|ZP_00172825.1| COG0521: Molybdopterin biosynthes...    51   1e-05
gi|15790729|ref|NP_280553.1| molybdenum cofactor biosynthesis pr...    50   2e-05
gi|49237109|ref|ZP_00331164.1| COG0303: Molybdopterin biosynthes...    45   5e-04
gi|14600431|ref|NP_146945.1| molybdopterin biosynthesis mog prot...    45   9e-04
gi|15789930|ref|NP_279754.1| competence-damage protein CinA-like...    43   0.003
gi|33598062|ref|NP_885705.1| conserved hypothetical protein [Bor...    42   0.004
gi|33594319|ref|NP_881963.1| conserved hypothetical protein [Bor...    42   0.004
gi|48478132|ref|YP_023838.1| molybdenum cofactor biosynthesis pr...    42   0.006
gi|32470829|ref|NP_863822.1| molybdopterin biosynthesis protein ...    42   0.006
gi|34557564|ref|NP_907379.1| PUTATIVE MOLYBDOPTERIN BIOSYNTHESIS...    42   0.007
gi|16081611|ref|NP_393971.1| molybdopterin biosynthesis protein ...    40   0.022
gi|13541582|ref|NP_111270.1| Molybdopterin biosynthesis enzyme [...    40   0.028
gi|11499832|ref|NP_071076.1| competence-damage protein, putative...    40   0.028
gi|18312241|ref|NP_558908.1| competence damage protein, conjectu...    40   0.028
gi|16121501|ref|NP_404814.1| conserved hypothetical protein [Yer...    40   0.028
gi|46579364|ref|YP_010172.1| molybdopterin biosynthesis MoeA pro...    39   0.037
gi|48846247|ref|ZP_00300512.1| COG1058: Predicted nucleotide-uti...    39   0.063
gi|15679368|ref|NP_276485.1| molybdenum cofactor biosynthesis Mo...    38   0.11
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno...    37   0.18
gi|48787848|ref|ZP_00283827.1| COG1058: Predicted nucleotide-uti...    37   0.18
gi|15425702|dbj|BAB64328.1| polymerase [Hepatitis B virus]             37   0.24
gi|48850968|ref|ZP_00305210.1| COG1058: Predicted nucleotide-uti...    36   0.31
gi|15679021|ref|NP_276138.1| molybdenum cofactor biosynthesis pr...    36   0.31
gi|45517437|ref|ZP_00168988.1| COG0303: Molybdopterin biosynthes...    36   0.41
gi|19552420|ref|NP_600422.1| molybdopterin biosynthesis enzyme [...    36   0.41
gi|41325420|emb|CAF19900.1| MOLYBDOPTERIN BIOSYNTHESIS PROTEIN [...    36   0.41
gi|30148490|ref|XP_087593.2| KIAA1430 protein [Homo sapiens]           35   0.53
gi|14591417|ref|NP_143497.1| molybdopterin biosynthesis moeA pro...    35   0.53
gi|49114274|ref|XP_412021.1| hypothetical protein AN7884.2 [Aspe...    35   0.53
gi|7243241|dbj|BAA92668.1| KIAA1430 protein [Homo sapiens]             35   0.53
gi|48871121|ref|ZP_00323837.1| COG1058: Predicted nucleotide-uti...    35   0.53
gi|20988137|gb|AAH30535.1| KIAA1430 protein [Homo sapiens]             35   0.53
gi|24375799|ref|NP_719842.1| RTX toxin, putative [Shewanella one...    35   0.53
gi|46562170|ref|YP_009125.1| conserved hypothetical protein [Des...    35   0.69
gi|15789416|ref|NP_279240.1| molybdenum cofactor biosynthesis pr...    35   0.69
gi|46312167|ref|ZP_00212766.1| COG1058: Predicted nucleotide-uti...    35   0.69
gi|45520593|ref|ZP_00172121.1| COG0303: Molybdopterin biosynthes...    35   0.69
gi|39995254|ref|NP_951205.1| competence/damage-inducible protein...    35   0.69
gi|46321422|ref|ZP_00221799.1| COG1058: Predicted nucleotide-uti...    35   0.90
gi|18978155|ref|NP_579512.1| molybdenum cofactor biosynthesis pr...    35   0.90
gi|18311560|ref|NP_563494.1| gamma-glutamyl phosphate reductase ...    34   1.2
gi|21226932|ref|NP_632854.1| Molybdopterin biosynthesis MoeA pro...    34   1.2
gi|15922363|ref|NP_378032.1| 388aa long hypothetical molybdopter...    34   1.2
gi|29375963|ref|NP_815117.1| molybdenum cofactor biosynthesis fa...    34   1.2
gi|20092880|ref|NP_618955.1| molybdenum cofactor biosynthesis pr...    34   1.2
gi|33239741|ref|NP_874683.1| CinA ortholog, predicted molybdopte...    34   1.2
gi|5354190|gb|AAD42399.1| hypothetical competence-damage protein...    34   1.5
gi|28210113|ref|NP_781057.1| putative competence-damage protein ...    34   1.5
gi|23010325|ref|ZP_00051052.1| COG0303: Molybdopterin biosynthes...    34   1.5
gi|39582247|emb|CAE64198.1| Hypothetical protein CBG08827 [Caeno...    34   1.5
gi|46142330|ref|ZP_00148425.2| COG1831: Predicted metal-dependen...    33   2.0
gi|33864112|ref|NP_895672.1| Molybdenum cofactor biosynthesis pr...    33   2.0
gi|50545882|ref|XP_500479.1| hypothetical protein [Yarrowia lipo...    33   2.0
gi|7305389|ref|NP_038658.1| polycystin-1 [Mus musculus] >gnl|BL_...    33   2.0
gi|38092558|ref|XP_126551.3| RIKEN cDNA 9930033H14 gene [Mus mus...    31   2.2
gi|41148032|ref|XP_374501.1| similar to intestinal mucin 3 [Homo...    33   2.6
gi|48768622|ref|ZP_00272971.1| COG0443: Molecular chaperone [Ral...    33   2.6
gi|17545975|ref|NP_519377.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...    33   2.6
gi|34500584|gb|AAQ73824.1| intestinal mucin MUC3A precursor [Hom...    33   2.6
gi|3122003|sp|O33522|DNAK_ALCEU Chaperone protein dnaK (Heat sho...    33   2.6
gi|17562024|ref|NP_504291.1| heat shock protein (70.8 kD) (hsp-6...    33   2.6
gi|29830215|ref|NP_824849.1| putative molybdopterin biosynthesis...    33   2.6
gi|41147654|ref|XP_168578.4| mucin 3B [Homo sapiens]                   33   2.6
gi|22971904|ref|ZP_00018818.1| hypothetical protein [Chloroflexu...    33   2.6
gi|47574813|ref|ZP_00244848.1| COG0443: Molecular chaperone [Rub...    33   3.4
gi|46323543|ref|ZP_00223907.1| COG0303: Molybdopterin biosynthes...    33   3.4
gi|18314087|ref|NP_560754.1| molybdenum cofactor biosynthesis pr...    33   3.4
gi|17221128|gb|AAK58431.1| glycoprotein gp2 [Equine herpesvirus 4]     33   3.4
gi|39935247|ref|NP_947523.1| possible competence damage protein ...    33   3.4
gi|45358108|ref|NP_987665.1| Molybdenum cofactor biosynthesis pr...    33   3.4
gi|19223866|gb|AAL86368.1| unknown [Desulfovibrio gigas]               33   3.4
gi|24584895|ref|NP_724081.1| CG31742-PA [Drosophila melanogaster...    33   3.4
gi|13431453|sp|O68191|DNAK_BURPS Chaperone protein dnaK (Heat sh...    32   4.5
gi|49236412|ref|ZP_00330472.1| COG0303: Molybdopterin biosynthes...    32   4.5
gi|29250839|gb|EAA42327.1| GLP_440_73432_75480 [Giardia lamblia ...    32   4.5
gi|17987220|ref|NP_539854.1| PUTATIVE COMPETENCE-DAMAGE PROTEIN ...    32   4.5
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment...    32   4.5
gi|14520736|ref|NP_126211.1| molybdenum cofactor biosynthesis pr...    32   4.5
gi|39591011|emb|CAE58791.1| Hypothetical protein CBG01997 [Caeno...    32   4.5
gi|17547354|ref|NP_520756.1| PROBABLE HEAT SHOCK PROTEIN 70 (HSP...    32   5.9
gi|7522100|pir||T17411 polyketide synthase III - Streptomyces ve...    32   5.9
gi|15897297|ref|NP_341902.1| Molybdenum cofactor biosynthesis pr...    32   5.9
gi|28828927|gb|AAO51513.1| similar to Plasmodium falciparum (iso...    32   5.9
gi|16119254|ref|NP_395960.1| AGR_pAT_32p [Agrobacterium tumefaci...    32   5.9
gi|102482|pir||B32475 dnaK-type molecular chaperone hsp70F precu...    32   5.9
gi|50875454|emb|CAG35294.1| conserved hypothetical protein [Desu...    32   5.9
gi|24211654|sp|Q8XW40|DNAK_RALSO Chaperone protein dnaK (Heat sh...    32   5.9
gi|50120158|ref|YP_049325.1| putative molybdopterin binding prot...    32   5.9
gi|39578750|emb|CAE57157.1| Hypothetical protein CBG25091 [Caeno...    32   7.7
gi|38106758|gb|EAA53025.1| hypothetical protein MG06153.4 [Magna...    32   7.7
gi|15225496|ref|NP_181488.1| expressed protein [Arabidopsis thal...    32   7.7
gi|48894930|ref|ZP_00328039.1| COG0176: Transaldolase [Trichodes...    32   7.7
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens]                     32   7.7
gi|38233118|ref|NP_938885.1| Putative molybdopterin biosynthesis...    32   7.7
gi|34762121|ref|ZP_00143129.1| Competence-damage protein cinA [F...    32   7.7
gi|11320978|gb|AAG33986.1| Pkd1 [Rattus norvegicus]                    32   7.7
gi|45359182|ref|NP_988739.1| Molybdenum cofactor biosynthesis pr...    32   7.7
gi|19705234|ref|NP_602729.1| Competence-damage protein cinA [Fus...    32   7.7
gi|34870520|ref|XP_340766.1| polycystin-1 [Rattus norvegicus]          32   7.7
gi|39590902|emb|CAE58682.1| Hypothetical protein CBG01856 [Caeno...    32   7.7
gi|46105714|ref|ZP_00199647.1| COG0521: Molybdopterin biosynthes...    32   7.7
gi|47096662|ref|ZP_00234249.1| isoleucyl-tRNA synthetase [Lister...    32   7.7
gi|46908248|ref|YP_014637.1| isoleucyl-tRNA synthetase [Listeria...    32   7.7
gi|47093189|ref|ZP_00230963.1| isoleucyl-tRNA synthetase [Lister...    32   7.7
gi|16804058|ref|NP_465543.1| isoleucyl-tRNA synthetase [Listeria...    32   7.7
gi|16801193|ref|NP_471461.1| isoleucyl-tRNA synthetase [Listeria...    32   7.7


>gi|17564954|ref|NP_504651.1| MOlybdenum Cofactor biosynthesis (17.7
           kD) (moc-2) [Caenorhabditis elegans]
 gi|15617869|gb|AAB04971.3| Molybdenum cofactor biosynthesis protein
           2 [Caenorhabditis elegans]
          Length = 168

 Score =  332 bits (851), Expect = 2e-90
 Identities = 168/168 (100%), Positives = 168/168 (100%)
 Frame = -1

Query: 507 MRVCVITVSDTCSAGTRTDESGPKLVELVDTSAVVNATVNEGSPFVVPDDVTAIHDALVE 328
           MRVCVITVSDTCSAGTRTDESGPKLVELVDTSAVVNATVNEGSPFVVPDDVTAIHDALVE
Sbjct: 1   MRVCVITVSDTCSAGTRTDESGPKLVELVDTSAVVNATVNEGSPFVVPDDVTAIHDALVE 60

Query: 327 QSKFADVILTTGGTGFAPRDVTPEATLKVIDRRCSGLEIALHTASLKITSMAALSRAIVG 148
           QSKFADVILTTGGTGFAPRDVTPEATLKVIDRRCSGLEIALHTASLKITSMAALSRAIVG
Sbjct: 61  QSKFADVILTTGGTGFAPRDVTPEATLKVIDRRCSGLEIALHTASLKITSMAALSRAIVG 120

Query: 147 IRGGTLIVNMPGSVKAVKECWDTLEPLLNHGINLLKNTDDGSQHARMK 4
           IRGGTLIVNMPGSVKAVKECWDTLEPLLNHGINLLKNTDDGSQHARMK
Sbjct: 121 IRGGTLIVNMPGSVKAVKECWDTLEPLLNHGINLLKNTDDGSQHARMK 168




[DB home][top]