Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W01G7_2
(369 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536663|ref|NP_496942.1| polymerase II (13.7 kD) (2O351) [Ca... 246 8e-65
gi|39591340|emb|CAE73393.1| Hypothetical protein CBG20834 [Caeno... 231 3e-60
gi|5453932|ref|NP_006225.1| DNA directed RNA polymerase II polyp... 154 3e-37
gi|6755362|ref|NP_035423.1| polymerase (RNA) II (DNA directed) p... 154 3e-37
gi|21704272|ref|NP_116581.2| DNA directed RNA polymerase II poly... 152 2e-36
gi|21704274|ref|NP_663165.1| DNA directed RNA polymerase II poly... 152 2e-36
gi|47211212|emb|CAF90169.1| unnamed protein product [Tetraodon n... 152 2e-36
gi|11595478|emb|CAC18331.1| RPB11b2alpha protein [Homo sapiens] ... 151 3e-36
gi|19401711|gb|AAL87672.1| DNA-directed RNA polymerase II subuni... 151 3e-36
gi|11595485|emb|CAC18368.1| RPB11a protein [Homo sapiens] 150 6e-36
gi|33359678|gb|AAP97076.1| RNA polymerase II subunit [Branchiost... 149 2e-35
gi|31239143|ref|XP_319985.1| ENSANGP00000016837 [Anopheles gambi... 146 1e-34
gi|19921456|ref|NP_609836.1| CG6840-PA [Drosophila melanogaster]... 145 1e-34
gi|42658298|ref|XP_379819.1| similar to DNA directed RNA polymer... 142 2e-33
gi|40226460|gb|AAH17341.2| MGC13098 protein [Homo sapiens] 142 2e-33
gi|33878913|gb|AAH17250.1| MGC13098 protein [Homo sapiens] 142 2e-33
gi|38571609|gb|AAH62722.1| MGC13098 protein [Homo sapiens] 140 8e-33
gi|25012186|gb|AAN71209.1| GM15177p [Drosophila melanogaster] 134 3e-31
gi|745556|prf||2016335A RNA polymerase II:SUBUNIT=14kD 134 3e-31
gi|50758100|ref|XP_415760.1| PREDICTED: similar to Ras GTPase-ac... 132 2e-30
gi|28828983|gb|AAO51563.1| similar to DNA-directed RNA polymeras... 116 9e-26
gi|34394446|dbj|BAC83620.1| putative DNA-directed RNA polymerase... 112 1e-24
gi|15231127|ref|NP_190777.1| DNA-directed RNA polymerase II 13.6... 108 3e-23
gi|50424419|ref|XP_460797.1| unnamed protein product [Debaryomyc... 107 7e-23
gi|50259796|gb|EAL22464.1| hypothetical protein CNBB3430 [Crypto... 104 4e-22
gi|49071300|ref|XP_399939.1| hypothetical protein UM02324.1 [Ust... 103 1e-21
gi|49093890|ref|XP_408406.1| hypothetical protein AN4269.2 [Aspe... 101 3e-21
gi|6324569|ref|NP_014638.1| RNA polymerase II core subunit; Rpb1... 97 8e-20
gi|50286733|ref|XP_445796.1| unnamed protein product [Candida gl... 96 2e-19
gi|50551669|ref|XP_503309.1| hypothetical protein [Yarrowia lipo... 94 5e-19
gi|19114245|ref|NP_593333.1| dna-directed rna polymerase ii 14.1... 94 6e-19
gi|50305029|ref|XP_452472.1| unnamed protein product [Kluyveromy... 94 8e-19
gi|45185683|ref|NP_983399.1| ACL005Cp [Eremothecium gossypii] >g... 94 8e-19
gi|12718487|emb|CAC28816.1| related to DNA-directed RNA polymera... 87 8e-17
gi|32404940|ref|XP_323083.1| hypothetical protein ( (AL513466) r... 80 1e-14
gi|46124881|ref|XP_386994.1| hypothetical protein FG06818.1 [Gib... 74 5e-13
gi|49069020|ref|XP_398799.1| hypothetical protein UM01184.1 [Ust... 73 2e-12
gi|6324215|ref|NP_014286.1| RNA polymerase subunit, common to RN... 72 2e-12
gi|46431930|gb|EAK91447.1| hypothetical protein CaO19.7805 [Cand... 72 3e-12
gi|14702175|ref|NP_116580.1| DNA directed RNA polymerase II poly... 71 4e-12
gi|50409649|ref|XP_456893.1| unnamed protein product [Debaryomyc... 70 8e-12
gi|42658567|ref|XP_379908.1| similar to DNA directed RNA polymer... 70 1e-11
gi|19114031|ref|NP_593119.1| DNA-directed RNA polymerase I and I... 70 1e-11
gi|2500635|sp|Q09177|RPC9_SCHPO DNA-directed RNA polymerases I a... 70 1e-11
gi|30172700|gb|AAP22341.1| unknown [Homo sapiens] 70 1e-11
gi|50293019|ref|XP_448942.1| unnamed protein product [Candida gl... 70 1e-11
gi|50312213|ref|XP_456138.1| unnamed protein product [Kluyveromy... 69 2e-11
gi|38108468|gb|EAA54478.1| hypothetical protein MG02463.4 [Magna... 69 2e-11
gi|45198301|ref|NP_985330.1| AFL220Cp [Eremothecium gossypii] >g... 69 2e-11
gi|29791497|gb|AAH50405.1| Similar to DNA directed RNA polymeras... 69 3e-11
gi|50259889|gb|EAL22557.1| hypothetical protein CNBB4340 [Crypto... 68 5e-11
gi|50554135|ref|XP_504476.1| hypothetical protein [Yarrowia lipo... 68 5e-11
gi|32403784|ref|XP_322505.1| hypothetical protein [Neurospora cr... 66 2e-10
gi|49098727|ref|XP_410695.1| hypothetical protein AN6558.2 [Aspe... 65 3e-10
gi|23618985|ref|NP_704947.1| DNA-directed RNA polymerase 2, puta... 65 3e-10
gi|21842229|gb|AAM77741.1| RNA polymerase II subunit Rpb11 [Giar... 65 3e-10
gi|38110653|gb|EAA56340.1| hypothetical protein MG06311.4 [Magna... 64 7e-10
gi|39590793|emb|CAE65166.1| Hypothetical protein CBG10036 [Caeno... 64 9e-10
gi|7705740|ref|NP_057056.1| RNA polymerase I 16 kDa subunit [Hom... 62 2e-09
gi|23509371|ref|NP_702038.1| RNA polymerase small subunit, putat... 61 6e-09
gi|50746102|ref|XP_426271.1| PREDICTED: similar to DNA-directed ... 60 8e-09
gi|6677791|ref|NP_033113.1| RNA polymerase 1-3; RIKEN cDNA 11100... 60 1e-08
gi|17553746|ref|NP_499132.1| rna polymerase (16.6 kD) (3K718) [C... 59 3e-08
gi|15922592|ref|NP_378261.1| 93aa long hypothetical DNA-directed... 58 4e-08
gi|23489608|gb|EAA21618.1| RNA polymerases L / 13 to 16 kDa subu... 58 4e-08
gi|29250803|gb|EAA42291.1| GLP_440_20098_20403 [Giardia lamblia ... 57 7e-08
gi|15897236|ref|NP_341841.1| DNA-directed RNA polymerase, subuni... 57 7e-08
gi|46125119|ref|XP_387113.1| hypothetical protein FG06937.1 [Gib... 56 1e-07
gi|31232297|ref|XP_318678.1| ENSANGP00000022241 [Anopheles gambi... 56 2e-07
gi|49619017|gb|AAT68093.1| RNA polymerase I polypeptide D [Danio... 55 3e-07
gi|13811975|ref|NP_113104.1| dna directed RNA polymerase II 13.6... 54 1e-06
gi|24585154|ref|NP_609950.1| CG10685-PA [Drosophila melanogaster... 52 2e-06
gi|23479513|gb|EAA16320.1| RNA polymerases L / 13 to 16 kDa subu... 52 2e-06
gi|1173166|sp|P46217|RPOL_SULAC DNA-directed RNA polymerase subu... 51 5e-06
gi|47187235|emb|CAG14790.1| unnamed protein product [Tetraodon n... 50 8e-06
gi|25453545|pir||JC4847 DNA-directed RNA polymerase (EC 2.7.7.6)... 50 1e-05
gi|15227556|ref|NP_180514.1| DNA-directed RNA polymerase I(A) an... 50 1e-05
gi|19173564|ref|NP_597367.1| DNA-DIRECTED RNA POLYMERASE II [Enc... 44 8e-04
gi|18976422|ref|NP_577779.1| DNA-directed RNA polymerase subunit... 41 0.006
gi|14591738|ref|NP_142060.1| DNA-directed RNA polymerase, subuni... 40 0.011
gi|41719083|ref|ZP_00148016.1| COG1761: DNA-directed RNA polymer... 40 0.011
gi|9628220|ref|NP_042806.1| RNA polymerase subunit 3 [African sw... 39 0.025
gi|14520268|ref|NP_125743.1| DNA-directed RNA polymerase, subuni... 38 0.042
gi|450713|emb|CAA50821.1| RNA polymerase subunit 10kDa [African ... 38 0.055
gi|15668563|ref|NP_247361.1| DNA-directed RNA polymerase, subuni... 36 0.21
gi|11497823|ref|NP_069045.1| DNA-directed RNA polymerase, subuni... 35 0.46
gi|50312335|ref|XP_456201.1| unnamed protein product [Kluyveromy... 35 0.46
gi|48103131|ref|XP_395508.1| similar to CG10685-PA [Apis mellifera] 34 0.60
gi|47224984|emb|CAF97399.1| unnamed protein product [Tetraodon n... 33 1.0
gi|47216069|emb|CAG04808.1| unnamed protein product [Tetraodon n... 33 1.3
gi|17558288|ref|NP_505566.1| AdaPTin or adaptin-related protein ... 33 1.8
gi|30682907|ref|NP_188012.2| expressed protein [Arabidopsis thal... 33 1.8
gi|11994367|dbj|BAB02326.1| unnamed protein product [Arabidopsis... 33 1.8
gi|18313007|ref|NP_559674.1| DNA-directed RNA polymerase subunit... 33 1.8
gi|28628302|gb|AAO38707.1| cation diffusion facilitator 8 [Stylo... 32 2.3
gi|15609112|ref|NP_216491.1| hypothetical protein Rv1975 [Mycoba... 32 3.0
gi|48840448|ref|ZP_00297375.1| COG1761: DNA-directed RNA polymer... 32 3.0
gi|23612336|ref|NP_703916.1| hypothetical protein [Plasmodium fa... 32 3.9
gi|50755539|ref|XP_414786.1| PREDICTED: similar to hypothetical ... 32 3.9
gi|22762042|dbj|BAC11803.1| Ste12-like transcription factor [Col... 32 3.9
gi|41409820|ref|NP_962656.1| hypothetical protein MAP3722 [Mycob... 31 5.1
gi|17228493|ref|NP_485041.1| putative catalase [Nostoc sp. PCC 7... 31 5.1
gi|34897258|ref|NP_909975.1| unknown protein [Oryza sativa (japo... 31 5.1
gi|19074859|ref|NP_586365.1| DNA-DIRECTED RNA POLYMERASE I AND I... 31 5.1
gi|29247124|gb|EAA38697.1| GLP_516_37620_40541 [Giardia lamblia ... 31 5.1
gi|1216147|emb|CAA93802.1| nucleic acid binding protein [Girardi... 31 5.1
gi|46981187|emb|CAD30840.2| ste12-like transcription factor [Col... 31 5.1
gi|44889469|gb|AAS48370.1| hepatocyte growth factor activator [C... 31 6.7
gi|47682223|gb|AAH69935.1| Unknown (protein for MGC:78233) [Mus ... 31 6.7
gi|49094872|ref|XP_408897.1| hypothetical protein AN4760.2 [Aspe... 31 6.7
gi|13195692|ref|NP_077243.1| ribosome binding protein 1 isoform ... 31 6.7
gi|13094681|gb|AAK11965.1| ribosome receptor isoform mRRp41 [Mus... 31 6.7
gi|15611404|ref|NP_223055.1| putative [Helicobacter pylori J99] ... 31 6.7
gi|19112629|ref|NP_595837.1| putative amino acid starvation resp... 31 6.7
gi|19482168|ref|NP_598329.1| ribosome binding protein 1 isoform ... 31 6.7
gi|23822106|sp|Q99PL5|RRB1_MOUSE Ribosome-binding protein 1 (Rib... 31 6.7
gi|45357824|ref|NP_987381.1| DNA directed RNA polymerase; subuni... 30 8.7
gi|4097549|gb|AAD09508.1| ATFP4 [Arabidopsis thaliana] 30 8.7
>gi|17536663|ref|NP_496942.1| polymerase II (13.7 kD) (2O351)
[Caenorhabditis elegans]
gi|11387118|sp|Q9XVH6|RPBY_CAEEL Probable DNA-directed RNA
polymerase II 13.3 kDa polypeptide (RPB11)
gi|7508782|pir||T26065 hypothetical protein W01G7.3 -
Caenorhabditis elegans
gi|3924901|emb|CAB03455.1| Hypothetical protein W01G7.3
[Caenorhabditis elegans]
Length = 122
Score = 246 bits (628), Expect = 8e-65
Identities = 122/122 (100%), Positives = 122/122 (100%)
Frame = +1
Query: 1 MNAPAAFESFLLLDDKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGY 180
MNAPAAFESFLLLDDKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGY
Sbjct: 1 MNAPAAFESFLLLDDKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGY 60
Query: 181 KNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIKKCTQSGDQERG 360
KNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIKKCTQSGDQERG
Sbjct: 61 KNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIKKCTQSGDQERG 120
Query: 361 YN 366
YN
Sbjct: 121 YN 122