Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W02A11_1
         (632 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17509459|ref|NP_493229.1| translational repressor like (1N322...   425   e-118
gi|39581461|emb|CAE67991.1| Hypothetical protein CBG13601 [Caeno...   391   e-108
gi|27503341|gb|AAH42219.1| MGC53312 protein [Xenopus laevis]          209   4e-53
gi|49904009|gb|AAH76660.1| Unknown (protein for MGC:79558) [Xeno...   207   1e-52
gi|50539710|ref|NP_001002321.1| zgc:86657 [Danio rerio] >gnl|BL_...   207   1e-52
gi|40643016|emb|CAD91434.1| hypotheitcal protein [Crassostrea gi...   207   2e-52
gi|14603441|gb|AAH10167.1| FLJ40452 protein [Homo sapiens]            200   2e-50
gi|22748679|ref|NP_689520.1| hypothetical protein FLJ40452 [Homo...   200   2e-50
gi|26339804|dbj|BAC33565.1| unnamed protein product [Mus musculus]    199   4e-50
gi|47216772|emb|CAG03776.1| unnamed protein product [Tetraodon n...   199   5e-50
gi|28893533|ref|NP_796348.1| RIKEN cDNA 6720458F09 gene [Mus mus...   197   1e-49
gi|29881568|gb|AAH51186.1| RIKEN cDNA 6720458F09 gene [Mus muscu...   197   1e-49
gi|27717347|ref|XP_234552.1| similar to RIKEN cDNA 6720458F09 ge...   196   2e-49
gi|31230609|ref|XP_318417.1| ENSANGP00000002760 [Anopheles gambi...   179   3e-44
gi|24650257|ref|NP_651461.1| CG14544-PA [Drosophila melanogaster...   175   6e-43
gi|19114479|ref|NP_593567.1| putative translational repressor [S...   165   8e-40
gi|46438094|gb|EAK97430.1| hypothetical protein CaO19.7291 [Cand...   160   2e-38
gi|11358041|pir||T48633 hypothetical protein T15N1.90 - Arabidop...   159   3e-38
gi|18417421|ref|NP_568302.1| expressed protein [Arabidopsis thal...   159   3e-38
gi|50255138|gb|EAL17877.1| hypothetical protein CNBL1390 [Crypto...   158   7e-38
gi|50309259|ref|XP_454636.1| unnamed protein product [Kluyveromy...   154   1e-36
gi|50413274|ref|XP_457237.1| unnamed protein product [Debaryomyc...   151   1e-35
gi|45198307|ref|NP_985336.1| AFL214Cp [Eremothecium gossypii] >g...   151   1e-35
gi|38344774|emb|CAE01500.2| OSJNBb0026L04.5 [Oryza sativa (japon...   150   2e-35
gi|38569141|emb|CAE05670.3| OSJNBb0033P05.9 [Oryza sativa (japon...   149   4e-35
gi|50293211|ref|XP_449017.1| unnamed protein product [Candida gl...   147   2e-34
gi|50556710|ref|XP_505763.1| hypothetical protein [Yarrowia lipo...   146   3e-34
gi|6322336|ref|NP_012410.1| Subunit of tRNA (1-methyladenosine) ...   142   5e-33
gi|28828995|gb|AAO51570.1| similar to Xenopus laevis (African cl...   135   5e-31
gi|50748744|ref|XP_421386.1| PREDICTED: similar to MGC53312 prot...   130   3e-29
gi|29247915|gb|EAA39463.1| GLP_26_3571_2519 [Giardia lamblia ATC...   117   2e-25
gi|46227020|gb|EAK87970.1| GCD14 RNA methylase [Cryptosporidium ...   112   6e-24
gi|50405002|ref|YP_054094.1| tRNA methyltransferase, putative [P...   109   5e-23
gi|32405846|ref|XP_323536.1| hypothetical protein [Neurospora cr...   108   8e-23
gi|21622346|emb|CAD37046.1| related to GCN4 translational repres...   108   8e-23
gi|38105796|gb|EAA52179.1| hypothetical protein MG04871.4 [Magna...   107   1e-22
gi|46123173|ref|XP_386140.1| hypothetical protein FG05964.1 [Gib...   106   3e-22
gi|34189572|gb|AAH16033.2| FLJ40452 protein [Homo sapiens]            101   1e-20
gi|49068440|ref|XP_398509.1| hypothetical protein UM00894.1 [Ust...    98   1e-19
gi|23483693|gb|EAA19279.1| similar to CG14544 gene product, puta...    97   3e-19
gi|15897357|ref|NP_341962.1| Protein L-isoaspartate methyltransf...    96   7e-19
gi|48100205|ref|XP_394982.1| similar to ENSANGP00000002760 [Apis...    95   1e-18
gi|49129856|ref|XP_412936.1| hypothetical protein AN8799.2 [Aspe...    95   1e-18
gi|46581456|ref|YP_012264.1| conserved hypothetical protein [Des...    92   8e-18
gi|23619104|ref|NP_705066.1| hypothetical protein, conserved [Pl...    87   3e-16
gi|15920572|ref|NP_376241.1| 257aa long conserved hypothetical p...    84   3e-15
gi|14520646|ref|NP_126121.1| protein-l-isoaspartate methyltransf...    78   2e-13
gi|18978268|ref|NP_579625.1| l-isoaspartyl protein carboxyl meth...    78   2e-13
gi|23475407|ref|ZP_00130694.1| COG2519: tRNA(1-methyladenosine) ...    76   5e-13
gi|14602095|ref|NP_148643.1| beta-aspartate metyltransferase [Ae...    75   1e-12
gi|14591605|ref|NP_143687.1| hypothetical protein PH1858 [Pyroco...    74   2e-12
gi|2145817|pir||S72844 beta-aspartate methyltransferase pimT - M...    73   5e-12
gi|15827681|ref|NP_301944.1| conserved hypothetical protein [Myc...    72   9e-12
gi|46364577|ref|ZP_00199185.2| COG2519: tRNA(1-methyladenosine) ...    70   3e-11
gi|41407940|ref|NP_960776.1| hypothetical protein MAP1842c [Myco...    69   7e-11
gi|38233837|ref|NP_939604.1| Conserved hypothetical protein [Cor...    69   1e-10
gi|48837251|ref|ZP_00294246.1| COG2519: tRNA(1-methyladenosine) ...    69   1e-10
gi|50739017|ref|XP_419362.1| PREDICTED: similar to hypothetical ...    68   1e-10
gi|29833216|ref|NP_827850.1| hypothetical protein SAV6674 [Strep...    68   2e-10
gi|21220147|ref|NP_625926.1| conserved hypothetical protein SCI4...    67   2e-10
gi|34810490|pdb|1O54|A Chain A, Crystal Structure Of Hypothetica...    67   2e-10
gi|15643511|ref|NP_228557.1| conserved hypothetical protein [The...    67   2e-10
gi|3790599|gb|AAC68688.1| unknown [Rhodococcus erythropolis]           66   6e-10
gi|15679413|ref|NP_276530.1| protein-L-isoaspartate methyltransf...    65   1e-09
gi|18313149|ref|NP_559816.1| beta-aspartate methyltransferase (p...    64   2e-09
gi|50842681|ref|YP_055908.1| putative methyltransferase [Propion...    64   2e-09
gi|15609255|ref|NP_216634.1| hypothetical protein Rv2118c [Mycob...    63   5e-09
gi|19552712|ref|NP_600714.1| predicted SAM-dependent methyltrans...    62   7e-09
gi|25028183|ref|NP_738237.1| conserved hypothetical protein [Cor...    60   3e-08
gi|20806980|ref|NP_622151.1| predicted SAM-dependent methyltrans...    59   1e-07
gi|48853261|ref|ZP_00307441.1| COG2519: tRNA(1-methyladenosine) ...    58   2e-07
gi|13435383|ref|NP_060380.2| hypothetical protein FLJ20628 [Homo...    55   8e-07
gi|12052902|emb|CAB66624.1| hypothetical protein [Homo sapiens] ...    55   8e-07
gi|7020859|dbj|BAA91300.1| unnamed protein product [Homo sapiens]      55   8e-07
gi|23465376|ref|NP_695979.1| hypothetical protein with similarit...    54   2e-06
gi|23335055|ref|ZP_00120293.1| COG2519: tRNA(1-methyladenosine) ...    54   2e-06
gi|28493285|ref|NP_787446.1| protein-L-isoaspartate methyltransf...    53   4e-06
gi|46198552|ref|YP_004219.1| tRNA (adenine-N(1)-)-methyltransfer...    53   4e-06
gi|25188060|emb|CAD56705.2| tRNA (adenine-N(1)-)-methyltransfera...    53   4e-06
gi|16081906|ref|NP_394311.1| conserved hypothetical protein [The...    50   5e-05
gi|14325201|dbj|BAB60126.1| protein-L-isoaspartate methyltransfe...    49   8e-05
gi|13541786|ref|NP_111474.1| Predicted SAM-dependent methyltrans...    49   8e-05
gi|15605836|ref|NP_213213.1| putative protein [Aquifex aeolicus ...    48   1e-04
gi|15668304|ref|NP_247100.1| L-isoaspartyl protein carboxyl meth...    47   2e-04
gi|47220107|emb|CAF99020.1| unnamed protein product [Tetraodon n...    47   3e-04
gi|45358938|ref|NP_988495.1| SAM (and some other nucleotide) bin...    47   4e-04
gi|48478413|ref|YP_024119.1| protein-L-isoaspartate O-methyltran...    46   7e-04
gi|15678847|ref|NP_275964.1| L-isoaspartyl protein carboxyl meth...    45   0.001
gi|46199459|ref|YP_005126.1| putative methyltransferase [Thermus...    42   0.007
gi|37677324|ref|NP_937720.1| tRNA and rRNA cytosine-C5-methylase...    42   0.010
gi|20094473|ref|NP_614320.1| Precorrin-6B methylase [Methanopyru...    42   0.013
gi|27367523|ref|NP_763050.1| tRNA and rRNA cytosine-C5-methylase...    40   0.028
gi|24373769|ref|NP_717812.1| sun protein, putative [Shewanella o...    40   0.048
gi|20094851|ref|NP_614698.1| Predicted SAM-dependent methyltrans...    39   0.063
gi|21225216|ref|NP_630995.1| putative O-methyltransferase. [Stre...    39   0.063
gi|20807438|ref|NP_622609.1| Ribosomal protein L11 methylase [Th...    39   0.11
gi|32473470|ref|NP_866464.1| conserved hypothetical protein-puta...    38   0.18
gi|14521455|ref|NP_126931.1| proliferating-cell nucleolar antige...    37   0.24
gi|23016738|ref|ZP_00056491.1| COG0144: tRNA and rRNA cytosine-C...    37   0.24
gi|18977038|ref|NP_578395.1| nol1-nop2-sun family putative nucle...    37   0.41
gi|48840329|ref|ZP_00297256.1| COG2518: Protein-L-isoaspartate c...    36   0.53
gi|48865753|ref|ZP_00319611.1| COG0144: tRNA and rRNA cytosine-C...    36   0.53
gi|23128008|ref|ZP_00109865.1| COG0144: tRNA and rRNA cytosine-C...    36   0.53
gi|14590712|ref|NP_142782.1| fmu protein [Pyrococcus horikoshii ...    36   0.53
gi|49473837|ref|YP_031879.1| SUN protein (FMU protein) [Bartonel...    36   0.70
gi|49070900|ref|XP_399739.1| hypothetical protein UM02124.1 [Ust...    36   0.70
gi|25346512|pir||E84060 hypothetical protein BH3285 [imported] -...    35   0.91
gi|15615847|ref|NP_244151.1| BH3285~unknown conserved protein [B...    35   0.91
gi|45188220|ref|NP_984443.1| ADR347Cp [Eremothecium gossypii] >g...    35   1.2
gi|50258986|gb|EAL21667.1| hypothetical protein CNBC7030 [Crypto...    35   1.2
gi|46106031|ref|ZP_00186449.2| COG0500: SAM-dependent methyltran...    35   1.2
gi|14601138|ref|NP_147666.1| hypothetical protein-L-isoaspartate...    35   1.6
gi|45510112|ref|ZP_00162444.1| COG0144: tRNA and rRNA cytosine-C...    34   2.0
gi|49235330|ref|ZP_00329400.1| COG0275: Predicted S-adenosylmeth...    34   2.0
gi|15672085|ref|NP_266259.1| methyltransferase [Lactococcus lact...    34   2.0
gi|27380103|ref|NP_771632.1| bll4992 [Bradyrhizobium japonicum U...    34   2.0
gi|48870419|ref|ZP_00323142.1| COG0275: Predicted S-adenosylmeth...    34   2.0
gi|45517532|ref|ZP_00169083.1| COG4107: ABC-type phosphonate tra...    34   2.0
gi|37533450|ref|NP_921027.1| putative polyprotein [Oryza sativa ...    34   2.6
gi|29249085|gb|EAA40604.1| GLP_23_3561_2578 [Giardia lamblia ATC...    34   2.6
gi|37535078|ref|NP_921841.1| putative gag-pol precursor [Oryza s...    34   2.6
gi|2833323|sp|Q24957|FBRL_GIALA Fibrillarin >gnl|BL_ORD_ID|76355...    34   2.6
gi|50427675|ref|XP_462450.1| unnamed protein product [Debaryomyc...    34   2.6
gi|7442144|pir||T04098 CBP20 preproprotein - common tobacco >gnl...    33   3.5
gi|32487411|emb|CAE05745.1| OSJNBb0017I01.25 [Oryza sativa (japo...    33   3.5
gi|7522605|pir||T31687 suface antigen - Paramecium primaurelia >...    33   3.5
gi|18977629|ref|NP_578986.1| putative nol1-nop2-sun family nucle...    33   3.5
gi|11497832|ref|NP_069054.1| L-isoaspartyl protein carboxyl meth...    33   3.5
gi|23099626|ref|NP_693092.1| pyruvate kinase [Oceanobacillus ihe...    33   4.5
gi|23470152|ref|ZP_00125485.1| COG0765: ABC-type amino acid tran...    33   4.5
gi|28868348|ref|NP_790967.1| amino acid ABC transporter, permeas...    33   4.5
gi|50511389|gb|AAT77312.1| putative polyprotein [Oryza sativa (j...    33   4.5
gi|17228315|ref|NP_484863.1| sun protein [Nostoc sp. PCC 7120] >...    33   5.9
gi|18312114|ref|NP_558781.1| protein-L-isoaspartate(D-aspartate)...    33   5.9
gi|11497950|ref|NP_069174.1| type II secretion system protein (g...    33   5.9
gi|25148771|ref|NP_503559.2| o-methyltransferase family member (...    33   5.9
gi|21227808|ref|NP_633730.1| Protein-L-isoaspartate O-methyltran...    33   5.9
gi|20093312|ref|NP_619387.1| conserved hypothetical protein [Met...    33   5.9
gi|48848262|ref|ZP_00302508.1| COG0500: SAM-dependent methyltran...    33   5.9
gi|48849487|ref|ZP_00303730.1| COG0144: tRNA and rRNA cytosine-C...    33   5.9
gi|14591177|ref|NP_143253.1| proliferating-cell nucleolar protei...    33   5.9
gi|20089432|ref|NP_615507.1| protein-L-isoaspartate (D-aspartate...    33   5.9
gi|46322358|ref|ZP_00222728.1| COG2226: Methylase involved in ub...    32   7.7
gi|45359164|ref|NP_988721.1| Putative RNA methylase [Methanococc...    32   7.7
gi|45510021|ref|ZP_00162353.1| COG0500: SAM-dependent methyltran...    32   7.7
gi|34809569|pdb|1IXK|A Chain A, Crystal Structure Analysis Of Me...    32   7.7
gi|26989248|ref|NP_744673.1| O-acetylhomoserine sulfhydrylase [P...    32   7.7
gi|16125079|ref|NP_419643.1| conserved hypothetical protein [Cau...    32   7.7


>gi|17509459|ref|NP_493229.1| translational repressor like (1N322)
           [Caenorhabditis elegans]
 gi|7508787|pir||T24625 hypothetical protein W02A11.1 -
           Caenorhabditis elegans
 gi|3879583|emb|CAB04711.1| Hypothetical protein W02A11.1
           [Caenorhabditis elegans]
 gi|3880444|emb|CAB04894.1| Hypothetical protein W02A11.1
           [Caenorhabditis elegans]
          Length = 312

 Score =  425 bits (1092), Expect = e-118
 Identities = 210/210 (100%), Positives = 210/210 (100%)
 Frame = -1

Query: 632 MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ 453
           MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ
Sbjct: 1   MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ 60

Query: 452 RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL 273
           RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL
Sbjct: 61  RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL 120

Query: 272 SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG 93
           SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG
Sbjct: 121 SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG 180

Query: 92  VFLDVPAPWEAIPFAAKSIFRARGGRLVSF 3
           VFLDVPAPWEAIPFAAKSIFRARGGRLVSF
Sbjct: 181 VFLDVPAPWEAIPFAAKSIFRARGGRLVSF 210




[DB home][top]