Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W02A11_1
(632 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17509459|ref|NP_493229.1| translational repressor like (1N322... 425 e-118
gi|39581461|emb|CAE67991.1| Hypothetical protein CBG13601 [Caeno... 391 e-108
gi|27503341|gb|AAH42219.1| MGC53312 protein [Xenopus laevis] 209 4e-53
gi|49904009|gb|AAH76660.1| Unknown (protein for MGC:79558) [Xeno... 207 1e-52
gi|50539710|ref|NP_001002321.1| zgc:86657 [Danio rerio] >gnl|BL_... 207 1e-52
gi|40643016|emb|CAD91434.1| hypotheitcal protein [Crassostrea gi... 207 2e-52
gi|14603441|gb|AAH10167.1| FLJ40452 protein [Homo sapiens] 200 2e-50
gi|22748679|ref|NP_689520.1| hypothetical protein FLJ40452 [Homo... 200 2e-50
gi|26339804|dbj|BAC33565.1| unnamed protein product [Mus musculus] 199 4e-50
gi|47216772|emb|CAG03776.1| unnamed protein product [Tetraodon n... 199 5e-50
gi|28893533|ref|NP_796348.1| RIKEN cDNA 6720458F09 gene [Mus mus... 197 1e-49
gi|29881568|gb|AAH51186.1| RIKEN cDNA 6720458F09 gene [Mus muscu... 197 1e-49
gi|27717347|ref|XP_234552.1| similar to RIKEN cDNA 6720458F09 ge... 196 2e-49
gi|31230609|ref|XP_318417.1| ENSANGP00000002760 [Anopheles gambi... 179 3e-44
gi|24650257|ref|NP_651461.1| CG14544-PA [Drosophila melanogaster... 175 6e-43
gi|19114479|ref|NP_593567.1| putative translational repressor [S... 165 8e-40
gi|46438094|gb|EAK97430.1| hypothetical protein CaO19.7291 [Cand... 160 2e-38
gi|11358041|pir||T48633 hypothetical protein T15N1.90 - Arabidop... 159 3e-38
gi|18417421|ref|NP_568302.1| expressed protein [Arabidopsis thal... 159 3e-38
gi|50255138|gb|EAL17877.1| hypothetical protein CNBL1390 [Crypto... 158 7e-38
gi|50309259|ref|XP_454636.1| unnamed protein product [Kluyveromy... 154 1e-36
gi|50413274|ref|XP_457237.1| unnamed protein product [Debaryomyc... 151 1e-35
gi|45198307|ref|NP_985336.1| AFL214Cp [Eremothecium gossypii] >g... 151 1e-35
gi|38344774|emb|CAE01500.2| OSJNBb0026L04.5 [Oryza sativa (japon... 150 2e-35
gi|38569141|emb|CAE05670.3| OSJNBb0033P05.9 [Oryza sativa (japon... 149 4e-35
gi|50293211|ref|XP_449017.1| unnamed protein product [Candida gl... 147 2e-34
gi|50556710|ref|XP_505763.1| hypothetical protein [Yarrowia lipo... 146 3e-34
gi|6322336|ref|NP_012410.1| Subunit of tRNA (1-methyladenosine) ... 142 5e-33
gi|28828995|gb|AAO51570.1| similar to Xenopus laevis (African cl... 135 5e-31
gi|50748744|ref|XP_421386.1| PREDICTED: similar to MGC53312 prot... 130 3e-29
gi|29247915|gb|EAA39463.1| GLP_26_3571_2519 [Giardia lamblia ATC... 117 2e-25
gi|46227020|gb|EAK87970.1| GCD14 RNA methylase [Cryptosporidium ... 112 6e-24
gi|50405002|ref|YP_054094.1| tRNA methyltransferase, putative [P... 109 5e-23
gi|32405846|ref|XP_323536.1| hypothetical protein [Neurospora cr... 108 8e-23
gi|21622346|emb|CAD37046.1| related to GCN4 translational repres... 108 8e-23
gi|38105796|gb|EAA52179.1| hypothetical protein MG04871.4 [Magna... 107 1e-22
gi|46123173|ref|XP_386140.1| hypothetical protein FG05964.1 [Gib... 106 3e-22
gi|34189572|gb|AAH16033.2| FLJ40452 protein [Homo sapiens] 101 1e-20
gi|49068440|ref|XP_398509.1| hypothetical protein UM00894.1 [Ust... 98 1e-19
gi|23483693|gb|EAA19279.1| similar to CG14544 gene product, puta... 97 3e-19
gi|15897357|ref|NP_341962.1| Protein L-isoaspartate methyltransf... 96 7e-19
gi|48100205|ref|XP_394982.1| similar to ENSANGP00000002760 [Apis... 95 1e-18
gi|49129856|ref|XP_412936.1| hypothetical protein AN8799.2 [Aspe... 95 1e-18
gi|46581456|ref|YP_012264.1| conserved hypothetical protein [Des... 92 8e-18
gi|23619104|ref|NP_705066.1| hypothetical protein, conserved [Pl... 87 3e-16
gi|15920572|ref|NP_376241.1| 257aa long conserved hypothetical p... 84 3e-15
gi|14520646|ref|NP_126121.1| protein-l-isoaspartate methyltransf... 78 2e-13
gi|18978268|ref|NP_579625.1| l-isoaspartyl protein carboxyl meth... 78 2e-13
gi|23475407|ref|ZP_00130694.1| COG2519: tRNA(1-methyladenosine) ... 76 5e-13
gi|14602095|ref|NP_148643.1| beta-aspartate metyltransferase [Ae... 75 1e-12
gi|14591605|ref|NP_143687.1| hypothetical protein PH1858 [Pyroco... 74 2e-12
gi|2145817|pir||S72844 beta-aspartate methyltransferase pimT - M... 73 5e-12
gi|15827681|ref|NP_301944.1| conserved hypothetical protein [Myc... 72 9e-12
gi|46364577|ref|ZP_00199185.2| COG2519: tRNA(1-methyladenosine) ... 70 3e-11
gi|41407940|ref|NP_960776.1| hypothetical protein MAP1842c [Myco... 69 7e-11
gi|38233837|ref|NP_939604.1| Conserved hypothetical protein [Cor... 69 1e-10
gi|48837251|ref|ZP_00294246.1| COG2519: tRNA(1-methyladenosine) ... 69 1e-10
gi|50739017|ref|XP_419362.1| PREDICTED: similar to hypothetical ... 68 1e-10
gi|29833216|ref|NP_827850.1| hypothetical protein SAV6674 [Strep... 68 2e-10
gi|21220147|ref|NP_625926.1| conserved hypothetical protein SCI4... 67 2e-10
gi|34810490|pdb|1O54|A Chain A, Crystal Structure Of Hypothetica... 67 2e-10
gi|15643511|ref|NP_228557.1| conserved hypothetical protein [The... 67 2e-10
gi|3790599|gb|AAC68688.1| unknown [Rhodococcus erythropolis] 66 6e-10
gi|15679413|ref|NP_276530.1| protein-L-isoaspartate methyltransf... 65 1e-09
gi|18313149|ref|NP_559816.1| beta-aspartate methyltransferase (p... 64 2e-09
gi|50842681|ref|YP_055908.1| putative methyltransferase [Propion... 64 2e-09
gi|15609255|ref|NP_216634.1| hypothetical protein Rv2118c [Mycob... 63 5e-09
gi|19552712|ref|NP_600714.1| predicted SAM-dependent methyltrans... 62 7e-09
gi|25028183|ref|NP_738237.1| conserved hypothetical protein [Cor... 60 3e-08
gi|20806980|ref|NP_622151.1| predicted SAM-dependent methyltrans... 59 1e-07
gi|48853261|ref|ZP_00307441.1| COG2519: tRNA(1-methyladenosine) ... 58 2e-07
gi|13435383|ref|NP_060380.2| hypothetical protein FLJ20628 [Homo... 55 8e-07
gi|12052902|emb|CAB66624.1| hypothetical protein [Homo sapiens] ... 55 8e-07
gi|7020859|dbj|BAA91300.1| unnamed protein product [Homo sapiens] 55 8e-07
gi|23465376|ref|NP_695979.1| hypothetical protein with similarit... 54 2e-06
gi|23335055|ref|ZP_00120293.1| COG2519: tRNA(1-methyladenosine) ... 54 2e-06
gi|28493285|ref|NP_787446.1| protein-L-isoaspartate methyltransf... 53 4e-06
gi|46198552|ref|YP_004219.1| tRNA (adenine-N(1)-)-methyltransfer... 53 4e-06
gi|25188060|emb|CAD56705.2| tRNA (adenine-N(1)-)-methyltransfera... 53 4e-06
gi|16081906|ref|NP_394311.1| conserved hypothetical protein [The... 50 5e-05
gi|14325201|dbj|BAB60126.1| protein-L-isoaspartate methyltransfe... 49 8e-05
gi|13541786|ref|NP_111474.1| Predicted SAM-dependent methyltrans... 49 8e-05
gi|15605836|ref|NP_213213.1| putative protein [Aquifex aeolicus ... 48 1e-04
gi|15668304|ref|NP_247100.1| L-isoaspartyl protein carboxyl meth... 47 2e-04
gi|47220107|emb|CAF99020.1| unnamed protein product [Tetraodon n... 47 3e-04
gi|45358938|ref|NP_988495.1| SAM (and some other nucleotide) bin... 47 4e-04
gi|48478413|ref|YP_024119.1| protein-L-isoaspartate O-methyltran... 46 7e-04
gi|15678847|ref|NP_275964.1| L-isoaspartyl protein carboxyl meth... 45 0.001
gi|46199459|ref|YP_005126.1| putative methyltransferase [Thermus... 42 0.007
gi|37677324|ref|NP_937720.1| tRNA and rRNA cytosine-C5-methylase... 42 0.010
gi|20094473|ref|NP_614320.1| Precorrin-6B methylase [Methanopyru... 42 0.013
gi|27367523|ref|NP_763050.1| tRNA and rRNA cytosine-C5-methylase... 40 0.028
gi|24373769|ref|NP_717812.1| sun protein, putative [Shewanella o... 40 0.048
gi|20094851|ref|NP_614698.1| Predicted SAM-dependent methyltrans... 39 0.063
gi|21225216|ref|NP_630995.1| putative O-methyltransferase. [Stre... 39 0.063
gi|20807438|ref|NP_622609.1| Ribosomal protein L11 methylase [Th... 39 0.11
gi|32473470|ref|NP_866464.1| conserved hypothetical protein-puta... 38 0.18
gi|14521455|ref|NP_126931.1| proliferating-cell nucleolar antige... 37 0.24
gi|23016738|ref|ZP_00056491.1| COG0144: tRNA and rRNA cytosine-C... 37 0.24
gi|18977038|ref|NP_578395.1| nol1-nop2-sun family putative nucle... 37 0.41
gi|48840329|ref|ZP_00297256.1| COG2518: Protein-L-isoaspartate c... 36 0.53
gi|48865753|ref|ZP_00319611.1| COG0144: tRNA and rRNA cytosine-C... 36 0.53
gi|23128008|ref|ZP_00109865.1| COG0144: tRNA and rRNA cytosine-C... 36 0.53
gi|14590712|ref|NP_142782.1| fmu protein [Pyrococcus horikoshii ... 36 0.53
gi|49473837|ref|YP_031879.1| SUN protein (FMU protein) [Bartonel... 36 0.70
gi|49070900|ref|XP_399739.1| hypothetical protein UM02124.1 [Ust... 36 0.70
gi|25346512|pir||E84060 hypothetical protein BH3285 [imported] -... 35 0.91
gi|15615847|ref|NP_244151.1| BH3285~unknown conserved protein [B... 35 0.91
gi|45188220|ref|NP_984443.1| ADR347Cp [Eremothecium gossypii] >g... 35 1.2
gi|50258986|gb|EAL21667.1| hypothetical protein CNBC7030 [Crypto... 35 1.2
gi|46106031|ref|ZP_00186449.2| COG0500: SAM-dependent methyltran... 35 1.2
gi|14601138|ref|NP_147666.1| hypothetical protein-L-isoaspartate... 35 1.6
gi|45510112|ref|ZP_00162444.1| COG0144: tRNA and rRNA cytosine-C... 34 2.0
gi|49235330|ref|ZP_00329400.1| COG0275: Predicted S-adenosylmeth... 34 2.0
gi|15672085|ref|NP_266259.1| methyltransferase [Lactococcus lact... 34 2.0
gi|27380103|ref|NP_771632.1| bll4992 [Bradyrhizobium japonicum U... 34 2.0
gi|48870419|ref|ZP_00323142.1| COG0275: Predicted S-adenosylmeth... 34 2.0
gi|45517532|ref|ZP_00169083.1| COG4107: ABC-type phosphonate tra... 34 2.0
gi|37533450|ref|NP_921027.1| putative polyprotein [Oryza sativa ... 34 2.6
gi|29249085|gb|EAA40604.1| GLP_23_3561_2578 [Giardia lamblia ATC... 34 2.6
gi|37535078|ref|NP_921841.1| putative gag-pol precursor [Oryza s... 34 2.6
gi|2833323|sp|Q24957|FBRL_GIALA Fibrillarin >gnl|BL_ORD_ID|76355... 34 2.6
gi|50427675|ref|XP_462450.1| unnamed protein product [Debaryomyc... 34 2.6
gi|7442144|pir||T04098 CBP20 preproprotein - common tobacco >gnl... 33 3.5
gi|32487411|emb|CAE05745.1| OSJNBb0017I01.25 [Oryza sativa (japo... 33 3.5
gi|7522605|pir||T31687 suface antigen - Paramecium primaurelia >... 33 3.5
gi|18977629|ref|NP_578986.1| putative nol1-nop2-sun family nucle... 33 3.5
gi|11497832|ref|NP_069054.1| L-isoaspartyl protein carboxyl meth... 33 3.5
gi|23099626|ref|NP_693092.1| pyruvate kinase [Oceanobacillus ihe... 33 4.5
gi|23470152|ref|ZP_00125485.1| COG0765: ABC-type amino acid tran... 33 4.5
gi|28868348|ref|NP_790967.1| amino acid ABC transporter, permeas... 33 4.5
gi|50511389|gb|AAT77312.1| putative polyprotein [Oryza sativa (j... 33 4.5
gi|17228315|ref|NP_484863.1| sun protein [Nostoc sp. PCC 7120] >... 33 5.9
gi|18312114|ref|NP_558781.1| protein-L-isoaspartate(D-aspartate)... 33 5.9
gi|11497950|ref|NP_069174.1| type II secretion system protein (g... 33 5.9
gi|25148771|ref|NP_503559.2| o-methyltransferase family member (... 33 5.9
gi|21227808|ref|NP_633730.1| Protein-L-isoaspartate O-methyltran... 33 5.9
gi|20093312|ref|NP_619387.1| conserved hypothetical protein [Met... 33 5.9
gi|48848262|ref|ZP_00302508.1| COG0500: SAM-dependent methyltran... 33 5.9
gi|48849487|ref|ZP_00303730.1| COG0144: tRNA and rRNA cytosine-C... 33 5.9
gi|14591177|ref|NP_143253.1| proliferating-cell nucleolar protei... 33 5.9
gi|20089432|ref|NP_615507.1| protein-L-isoaspartate (D-aspartate... 33 5.9
gi|46322358|ref|ZP_00222728.1| COG2226: Methylase involved in ub... 32 7.7
gi|45359164|ref|NP_988721.1| Putative RNA methylase [Methanococc... 32 7.7
gi|45510021|ref|ZP_00162353.1| COG0500: SAM-dependent methyltran... 32 7.7
gi|34809569|pdb|1IXK|A Chain A, Crystal Structure Analysis Of Me... 32 7.7
gi|26989248|ref|NP_744673.1| O-acetylhomoserine sulfhydrylase [P... 32 7.7
gi|16125079|ref|NP_419643.1| conserved hypothetical protein [Cau... 32 7.7
>gi|17509459|ref|NP_493229.1| translational repressor like (1N322)
[Caenorhabditis elegans]
gi|7508787|pir||T24625 hypothetical protein W02A11.1 -
Caenorhabditis elegans
gi|3879583|emb|CAB04711.1| Hypothetical protein W02A11.1
[Caenorhabditis elegans]
gi|3880444|emb|CAB04894.1| Hypothetical protein W02A11.1
[Caenorhabditis elegans]
Length = 312
Score = 425 bits (1092), Expect = e-118
Identities = 210/210 (100%), Positives = 210/210 (100%)
Frame = -1
Query: 632 MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ 453
MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ
Sbjct: 1 MTSSPPSFMSYEDRIQEGDTVIVYVTYGQMVPTIVKRGQTLMMKYGALRHEFIIGKRWGQ 60
Query: 452 RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL 273
RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL
Sbjct: 61 RLSATAGYVYILRPTSDLWTRALPRRTQILYTADCAQILSLLDAKPGSVICESGTGSGSL 120
Query: 272 SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG 93
SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG
Sbjct: 121 SHAIALTVAPTGHLYTHDIDETRTHKVLEEFKVHGLGSVTTAVVRNVCTSGFHVENAADG 180
Query: 92 VFLDVPAPWEAIPFAAKSIFRARGGRLVSF 3
VFLDVPAPWEAIPFAAKSIFRARGGRLVSF
Sbjct: 181 VFLDVPAPWEAIPFAAKSIFRARGGRLVSF 210