Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W02B12_9
         (939 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17536687|ref|NP_496447.1| mitochondrial solute carrier (34.1 ...   611   e-174
gi|39597270|emb|CAE59498.1| Hypothetical protein CBG02884 [Caeno...   580   e-164
gi|1518458|gb|AAB19037.1| mitochondrial solute carrier                376   e-103
gi|1518456|gb|AAB19036.1| mitochondrial solute carrier                338   1e-91
gi|47085863|ref|NP_998284.1| zgc:64212 [Danio rerio] >gnl|BL_ORD...   304   2e-81
gi|47223331|emb|CAF98715.1| unnamed protein product [Tetraodon n...   303   5e-81
gi|17158033|ref|NP_080607.2| mitochondrial solute carrier protei...   296   6e-79
gi|50759536|ref|XP_417682.1| PREDICTED: similar to mitochondrial...   292   6e-78
gi|12666720|emb|CAC27996.1| mitochondrial RNA splicing protein 3...   292   8e-78
gi|28703800|gb|AAH47312.1| SLC25A28 protein [Homo sapiens]            292   8e-78
gi|21309945|gb|AAM46110.1| MRS3/4 [Mus musculus]                      291   1e-77
gi|21553115|ref|NP_660138.1| solute carrier family 25, member 28...   291   1e-77
gi|34863024|ref|XP_215249.2| similar to putative mitochondrial s...   282   9e-75
gi|21357737|ref|NP_651600.1| CG4963-PA [Drosophila melanogaster]...   276   6e-73
gi|31215685|ref|XP_316075.1| ENSANGP00000022876 [Anopheles gambi...   276   6e-73
gi|7706150|ref|NP_057696.1| mitochondrial solute carrier protein...   256   5e-67
gi|8132784|gb|AAF73387.1| unknown [Drosophila melanogaster]           252   7e-66
gi|34874384|ref|XP_224361.2| similar to mitochondrial solute car...   250   3e-65
gi|50749663|ref|XP_421702.1| PREDICTED: similar to Solute carrie...   250   4e-65
gi|47215306|emb|CAG01611.1| unnamed protein product [Tetraodon n...   223   6e-57
gi|32421511|ref|XP_331199.1| hypothetical protein [Neurospora cr...   222   1e-56
gi|38105554|gb|EAA51969.1| hypothetical protein MG03564.4 [Magna...   217   3e-55
gi|27803005|emb|CAD60708.1| unnamed protein product [Podospora a...   215   1e-54
gi|22034628|gb|AAL13117.1| putative inner membrane solute transp...   211   1e-53
gi|49068770|ref|XP_398674.1| hypothetical protein UM01059.1 [Ust...   200   3e-50
gi|45185946|ref|NP_983662.1| ACR260Wp [Eremothecium gossypii] >g...   199   6e-50
gi|19115195|ref|NP_594283.1| mitochondial carrier protein; putat...   199   1e-49
gi|49092732|ref|XP_407827.1| hypothetical protein AN3690.2 [Aspe...   197   4e-49
gi|50419171|ref|XP_458108.1| unnamed protein product [Debaryomyc...   196   6e-49
gi|50547439|ref|XP_501189.1| hypothetical protein [Yarrowia lipo...   196   8e-49
gi|46437608|gb|EAK96951.1| hypothetical protein CaO19.9724 [Cand...   194   2e-48
gi|7688677|gb|AAF67479.1| mitochondrial solute carrier [Homo sap...   192   9e-48
gi|12854235|dbj|BAB29969.1| unnamed protein product [Mus musculu...   192   1e-47
gi|50292295|ref|XP_448580.1| unnamed protein product [Candida gl...   190   5e-47
gi|6322328|ref|NP_012402.1| Mitochondrial iron transporter of th...   187   3e-46
gi|3994|emb|CAA39830.1| MRS3 protein [Saccharomyces cerevisiae]       187   3e-46
gi|50293227|ref|XP_449025.1| unnamed protein product [Candida gl...   187   4e-46
gi|25406950|pir||A86205 hypothetical protein [imported] - Arabid...   184   2e-45
gi|15222270|ref|NP_172184.1| mitochondrial substrate carrier fam...   183   6e-45
gi|3991|emb|CAA29582.1| unnamed protein product [Saccharomyces c...   182   1e-44
gi|21553549|gb|AAM62642.1| putative mitochondrial carrier protei...   181   2e-44
gi|6322905|ref|NP_012978.1| Mitochondrial iron transporter of th...   180   4e-44
gi|15227718|ref|NP_180577.1| mitochondrial substrate carrier fam...   180   4e-44
gi|50309281|ref|XP_454647.1| unnamed protein product [Kluyveromy...   179   8e-44
gi|3378495|emb|CAA07568.1| Mitochondrial carrier protein [Ribes ...   179   8e-44
gi|19923634|ref|NP_112489.2| solute carrier family 25, member 28...   176   9e-43
gi|21309943|gb|AAM46109.1| MRS3/4 [Mus musculus]                      175   2e-42
gi|18606248|gb|AAH23172.1| Slc25a28 protein [Mus musculus]            174   2e-42
gi|12006035|gb|AAG44723.1| NPD016 [Homo sapiens]                      165   1e-39
gi|48102006|ref|XP_395269.1| similar to ENSANGP00000022634 [Apis...   137   3e-31
gi|46136667|ref|XP_390025.1| hypothetical protein FG09849.1 [Gib...   124   3e-27
gi|28466987|ref|NP_061049.2| mitochondrial solute carrier protei...   115   1e-24
gi|49256480|gb|AAH74495.1| Unknown (protein for MGC:84819) [Xeno...   108   1e-22
gi|33465827|ref|NP_084330.2| mitochondrial solute carrier protei...   107   4e-22
gi|26388648|dbj|BAC25649.1| unnamed protein product [Mus musculus]    107   4e-22
gi|47228784|emb|CAG07516.1| unnamed protein product [Tetraodon n...   100   8e-20
gi|18399114|ref|NP_564436.1| mitochondrial substrate carrier fam...    99   1e-19
gi|15238301|ref|NP_199028.1| mitochondrial substrate carrier fam...    99   1e-19
gi|31208625|ref|XP_313279.1| ENSANGP00000011068 [Anopheles gambi...    97   4e-19
gi|24650120|ref|NP_651415.1| CG4743-PA [Drosophila melanogaster]...    96   9e-19
gi|34394981|dbj|BAC84529.1| mitochondrial aspartate-glutamate ca...    96   1e-18
gi|47777469|gb|AAT38102.1| putative mitochondrial carrier protei...    95   3e-18
gi|6325278|ref|NP_015346.1| Mitochondrial transporter, acts both...    95   3e-18
gi|14150082|ref|NP_115691.1| mitochondrial carrier protein MGC43...    94   3e-18
gi|41200918|ref|XP_370619.1| similar to mitochondrial carrier pr...    94   3e-18
gi|50759281|ref|XP_417600.1| PREDICTED: similar to mitochondrial...    93   7e-18
gi|15030091|gb|AAH11293.1| 5730438N18Rik protein [Mus musculus]        93   1e-17
gi|18420458|ref|NP_568060.1| mitochondrial substrate carrier fam...    92   1e-17
gi|45187824|ref|NP_984047.1| ADL049Wp [Eremothecium gossypii] >g...    92   2e-17
gi|47224840|emb|CAG06410.1| unnamed protein product [Tetraodon n...    92   2e-17
gi|38107122|gb|EAA53339.1| hypothetical protein MG07616.4 [Magna...    92   2e-17
gi|34784032|gb|AAH56716.1| Zgc:65787 protein [Danio rerio] >gnl|...    92   2e-17
gi|50251364|dbj|BAD28391.1| mitochondrial substrate carrier prot...    91   5e-17
gi|34872487|ref|XP_216577.2| similar to 5730438N18Rik protein [R...    90   6e-17
gi|50287747|ref|XP_446303.1| unnamed protein product [Candida gl...    90   8e-17
gi|31200401|ref|XP_309148.1| ENSANGP00000018542 [Anopheles gambi...    90   8e-17
gi|6523177|emb|CAB62169.1| ARALAR 1 protein [Drosophila melanoga...    89   1e-16
gi|34905862|ref|NP_914278.1| P0458E05.7 [Oryza sativa (japonica ...    89   1e-16
gi|20270293|ref|NP_620095.1| RIKEN cDNA C330005L02 [Mus musculus...    89   2e-16
gi|45552009|ref|NP_733366.2| CG2139-PB [Drosophila melanogaster]...    89   2e-16
gi|24651389|ref|NP_651795.2| CG2139-PA [Drosophila melanogaster]...    89   2e-16
gi|24651387|ref|NP_733364.1| CG2139-PC [Drosophila melanogaster]...    89   2e-16
gi|7486053|pir||T09362 hypothetical protein F23K16.90 - Arabidop...    88   2e-16
gi|50307047|ref|XP_453501.1| unnamed protein product [Kluyveromy...    88   2e-16
gi|50754517|ref|XP_414419.1| PREDICTED: similar to S-adenosylmet...    88   2e-16
gi|50291791|ref|XP_448328.1| unnamed protein product [Candida gl...    88   3e-16
gi|47216429|emb|CAG01980.1| unnamed protein product [Tetraodon n...    87   4e-16
gi|50540402|ref|NP_001002667.1| zgc:92447 [Danio rerio] >gnl|BL_...    87   5e-16
gi|18395659|ref|NP_564233.1| mitochondrial substrate carrier fam...    87   5e-16
gi|50752052|ref|XP_422631.1| PREDICTED: similar to Hypothetical ...    87   7e-16
gi|38111079|gb|EAA56711.1| hypothetical protein MG07066.4 [Magna...    87   7e-16
gi|49129632|ref|XP_412922.1| hypothetical protein AN8785.2 [Aspe...    86   9e-16
gi|50732900|ref|XP_418818.1| PREDICTED: similar to Hypothetical ...    86   1e-15
gi|49075982|ref|XP_402014.1| hypothetical protein UM04399.1 [Ust...    86   1e-15
gi|38106744|gb|EAA53013.1| hypothetical protein MG06141.4 [Magna...    86   1e-15
gi|50258204|gb|EAL20898.1| hypothetical protein CNBE2590 [Crypto...    86   2e-15
gi|39581897|emb|CAE72859.1| Hypothetical protein CBG20158 [Caeno...    85   2e-15
gi|27754081|ref|NP_080531.2| solute carrier family 25 (mitochond...    85   3e-15
gi|50554747|ref|XP_504782.1| hypothetical protein [Yarrowia lipo...    85   3e-15
gi|30699000|ref|NP_177564.2| mitochondrial substrate carrier fam...    85   3e-15
gi|396595|emb|CAA80973.1| ACR1-protein [Saccharomyces cerevisiae]      85   3e-15
gi|18407372|ref|NP_566102.1| mitochondrial substrate carrier fam...    85   3e-15
gi|32412508|ref|XP_326734.1| hypothetical protein ( (AL513442) p...    84   3e-15
gi|6322555|ref|NP_012629.1| Mitochondrial succinate-fumarate tra...    84   3e-15
gi|39979123|emb|CAE85498.1| probable succinate-fumarate transpor...    84   5e-15
gi|32418256|ref|XP_329606.1| hypothetical protein [Neurospora cr...    84   5e-15
gi|45190968|ref|NP_985222.1| AER366Wp [Eremothecium gossypii] >g...    84   5e-15
gi|15559393|gb|AAH14064.1| Hypothetical protein FLJ10618 [Homo s...    83   8e-15
gi|50256826|gb|EAL19544.1| hypothetical protein CNBG1730 [Crypto...    83   8e-15
gi|45198325|ref|NP_985354.1| AFL196Wp [Eremothecium gossypii] >g...    83   8e-15
gi|25406327|pir||G96770 hypothetical protein F1O17.9 [imported] ...    83   8e-15
gi|15341990|gb|AAH13194.1| Hypothetical protein FLJ20551 [Homo s...    83   1e-14
gi|50427783|ref|XP_462504.1| unnamed protein product [Debaryomyc...    82   1e-14
gi|7496088|pir||T19322 hypothetical protein C16C10.1 - Caenorhab...    82   1e-14
gi|30425020|ref|NP_780542.1| RIKEN cDNA 4933406J04 [Mus musculus...    82   1e-14
gi|32564671|ref|NP_497836.2| mitochondrial substrate carrier (40...    82   1e-14
gi|50729450|ref|XP_416521.1| PREDICTED: similar to mitochondrial...    82   2e-14
gi|50419543|ref|XP_458298.1| unnamed protein product [Debaryomyc...    81   3e-14
gi|41351486|emb|CAE45652.1| S-adenosylmethionine carrier protein...    81   3e-14
gi|8922551|ref|NP_060625.1| hypothetical protein FLJ10618 [Homo ...    81   3e-14
gi|21450145|ref|NP_659042.1| cDNA sequence BC010801 [Mus musculu...    81   4e-14
gi|48096652|ref|XP_392496.1| similar to ENSANGP00000018542 [Apis...    81   4e-14
gi|46123689|ref|XP_386398.1| hypothetical protein FG06222.1 [Gib...    81   4e-14
gi|31238945|ref|XP_319886.1| ENSANGP00000010634 [Anopheles gambi...    80   5e-14
gi|24663275|ref|NP_729802.1| CG32103-PB [Drosophila melanogaster...    80   5e-14
gi|13879465|gb|AAH06711.1| Solute carrier family 25 (mitochondri...    80   5e-14
gi|24663279|ref|NP_729803.1| CG32103-PC [Drosophila melanogaster...    80   5e-14
gi|46125507|ref|XP_387307.1| hypothetical protein FG07131.1 [Gib...    80   5e-14
gi|50553226|ref|XP_504023.1| hypothetical protein [Yarrowia lipo...    80   7e-14
gi|45200786|ref|NP_986356.1| AGL311Cp [Eremothecium gossypii] >g...    80   7e-14
gi|8923520|ref|NP_060345.1| hypothetical protein FLJ20551 [Homo ...    80   7e-14
gi|46124377|ref|XP_386742.1| conserved hypothetical protein [Gib...    80   9e-14
gi|49250406|gb|AAH74600.1| Unknown (protein for MGC:69323) [Xeno...    80   9e-14
gi|34867789|ref|XP_234550.2| similar to chromosome 14 open readi...    80   9e-14
gi|34857703|ref|XP_342727.1| similar to RIKEN cDNA 4930433D19 [R...    79   1e-13
gi|50556378|ref|XP_505597.1| hypothetical protein [Yarrowia lipo...    79   1e-13
gi|31044469|ref|NP_851845.1| solute carrier family 25, member 29...    79   1e-13
gi|50309099|ref|XP_454555.1| unnamed protein product [Kluyveromy...    79   1e-13
gi|34882294|ref|XP_217311.2| similar to hypothetical protein MGC...    79   1e-13
gi|28828299|gb|AAO50963.1| similar to Mus musculus (Mouse). Calc...    79   1e-13
gi|45187865|ref|NP_984088.1| ADL009Wp [Eremothecium gossypii] >g...    79   1e-13
gi|27694811|gb|AAH43993.1| LOC398474 protein [Xenopus laevis]          79   1e-13
gi|48476342|ref|NP_077008.2| solute carrier family 25 (mitochond...    79   2e-13
gi|16549529|dbj|BAB70825.1| unnamed protein product [Homo sapiens]     79   2e-13
gi|34865800|ref|XP_236557.2| similar to RIKEN cDNA C330005L02 [R...    79   2e-13
gi|46137559|ref|XP_390471.1| hypothetical protein FG10295.1 [Gib...    79   2e-13
gi|32417012|ref|XP_328984.1| hypothetical protein [Neurospora cr...    78   2e-13
gi|6323818|ref|NP_013889.1| Hypothetical ORF; Ymr166cp [Saccharo...    78   2e-13
gi|46122469|ref|XP_385788.1| hypothetical protein FG05612.1 [Gib...    78   3e-13
gi|21593290|gb|AAM65239.1| unknown [Arabidopsis thaliana]              78   3e-13
gi|15240954|ref|NP_195754.1| mitochondrial substrate carrier fam...    78   3e-13
gi|46136699|ref|XP_390041.1| conserved hypothetical protein [Gib...    78   3e-13
gi|50289063|ref|XP_446961.1| unnamed protein product [Candida gl...    78   3e-13
gi|11067279|gb|AAG28807.1| unknown protein [Arabidopsis thaliana]      78   3e-13
gi|46444126|gb|EAL03403.1| hypothetical protein CaO19.4966 [Cand...    77   4e-13
gi|46434016|gb|EAK93438.1| hypothetical protein CaO19.4159 [Cand...    77   4e-13
gi|46390391|dbj|BAD15855.1| putative Mcsc-pending-prov protein [...    77   4e-13
gi|31217942|ref|XP_316535.1| ENSANGP00000009995 [Anopheles gambi...    77   4e-13
gi|31340019|sp|Q8N8R3|CACL_HUMAN Mitchondrial carnitine/acylcarn...    77   6e-13
gi|7770165|gb|AAF69618.1| PRO2163 [Homo sapiens]                       77   6e-13
gi|28193150|emb|CAD62317.1| unnamed protein product [Homo sapiens]     77   6e-13
gi|50549063|ref|XP_502002.1| hypothetical protein [Yarrowia lipo...    77   6e-13
gi|44890495|gb|AAH66998.1| Slc25a25 protein [Mus musculus]             77   6e-13
gi|50757414|ref|XP_415513.1| PREDICTED: similar to mitochondrial...    77   6e-13
gi|19115553|ref|NP_594641.1| agpet8 protein. [Schizosaccharomyce...    77   6e-13
gi|38104109|gb|EAA50724.1| hypothetical protein MG04483.4 [Magna...    77   6e-13
gi|20137934|sp|Q9BZJ4|CG69_HUMAN Mitochondrial carrier protein C...    77   6e-13
gi|18043565|gb|AAH19978.1| Slc25a25 protein [Mus musculus] >gnl|...    77   6e-13
gi|11359936|pir||T43493 hypothetical protein DKFZp434C119.1 - hu...    77   6e-13
gi|28972868|dbj|BAC65850.1| mKIAA1896 protein [Mus musculus]           77   6e-13
gi|26340134|dbj|BAC33730.1| unnamed protein product [Mus musculu...    77   6e-13
gi|31560754|ref|NP_666230.2| mitochondrial Ca2+-dependent solute...    77   6e-13
gi|34866642|ref|XP_217295.2| similar to hypothetical protein MGC...    77   7e-13
gi|50551655|ref|XP_503302.1| hypothetical protein [Yarrowia lipo...    77   7e-13
gi|50419735|ref|XP_458396.1| unnamed protein product [Debaryomyc...    77   7e-13
gi|47230041|emb|CAG10455.1| unnamed protein product [Tetraodon n...    77   7e-13
gi|46443782|gb|EAL03061.1| hypothetical protein CaO19.3931 [Cand...    76   9e-13
gi|49069642|ref|XP_399110.1| hypothetical protein UM01495.1 [Ust...    76   9e-13
gi|49075766|ref|XP_401926.1| hypothetical protein UM04311.1 [Ust...    76   9e-13
gi|50750910|ref|XP_422180.1| PREDICTED: similar to Solute carrie...    76   9e-13
gi|33417112|gb|AAH56033.1| MGC68982 protein [Xenopus laevis]           76   9e-13
gi|50260360|gb|EAL23019.1| hypothetical protein CNBA7860 [Crypto...    76   1e-12
gi|31202109|ref|XP_310002.1| ENSANGP00000015067 [Anopheles gambi...    76   1e-12
gi|50259074|gb|EAL21751.1| hypothetical protein CNBC4530 [Crypto...    76   1e-12
gi|21728406|ref|NP_663710.1| mitochondrial Ca2+-dependent solute...    75   2e-12
gi|7706306|ref|NP_057100.1| CGI-69 protein [Homo sapiens] >gnl|B...    75   2e-12
gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697) [Caenorhab...    75   2e-12
gi|50427569|ref|XP_462397.1| unnamed protein product [Debaryomyc...    75   2e-12
gi|21361103|ref|NP_003696.2| solute carrier family 25 (mitochond...    75   2e-12
gi|19075818|ref|NP_588318.1| putative mitochondrial carrier prot...    75   2e-12
gi|34873898|ref|XP_340915.1| similar to RIKEN cDNA 3010027G13 [R...    75   2e-12
gi|27369517|ref|NP_765990.1| mitochondrial folate transporter/ca...    75   2e-12
gi|49619157|gb|AAT68163.1| DKFZp586G0123-like [Danio rerio]            75   2e-12
gi|49274632|ref|NP_080153.2| RIKEN cDNA 2310067G05 [Mus musculus...    75   3e-12
gi|34222668|sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporte...    75   3e-12
gi|34866087|ref|XP_235359.2| similar to mitochondrial folate tra...    75   3e-12
gi|50290719|ref|XP_447792.1| unnamed protein product [Candida gl...    75   3e-12
gi|32421779|ref|XP_331333.1| hypothetical protein [Neurospora cr...    75   3e-12
gi|50414031|ref|XP_457354.1| unnamed protein product [Debaryomyc...    74   4e-12
gi|50310411|ref|XP_455225.1| unnamed protein product [Kluyveromy...    74   4e-12
gi|50554819|ref|XP_504818.1| hypothetical protein [Yarrowia lipo...    74   4e-12
gi|13124050|sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial c...    74   5e-12
gi|15620851|dbj|BAB67789.1| KIAA1896 protein [Homo sapiens]            74   5e-12
gi|47223864|emb|CAG06041.1| unnamed protein product [Tetraodon n...    74   5e-12
gi|39930485|ref|NP_443133.1| solute carrier family 25 (mitochond...    74   5e-12
gi|48290293|emb|CAF04495.1| small calcium-binding mitochondrial ...    74   5e-12
gi|48374379|gb|AAT42021.1| mitochondrial folate transporter [Cri...    74   5e-12
gi|48290295|emb|CAF04496.1| small calcium-binding mitochondrial ...    74   5e-12
gi|13386046|ref|NP_080818.1| similar to human CGI-69 protein [Mu...    74   5e-12
gi|48290299|emb|CAF04498.1| small calcium-binding mitochondrial ...    74   5e-12
gi|15233381|ref|NP_192883.1| mitochondrial substrate carrier fam...    74   5e-12
gi|47109344|emb|CAF04060.1| mitochondrial ATP-Mg/Pi carrier [Hom...    74   5e-12
gi|38197071|gb|AAH05163.2| SLC25A25 protein [Homo sapiens]             74   5e-12
gi|19113980|ref|NP_593068.1| putative mitochondrial carrier [Sch...    74   5e-12
gi|18381035|gb|AAH22156.1| AW491445 protein [Mus musculus]             74   6e-12
gi|21312602|ref|NP_081736.1| RIKEN cDNA 5730438N18 [Mus musculus...    74   6e-12
gi|23956272|ref|NP_598915.1| expressed sequence AW491445 [Mus mu...    74   6e-12
gi|6322185|ref|NP_012260.1| Pvruvate transporter of the mitochon...    74   6e-12
gi|29244360|ref|NP_808477.1| hypothetical protein E230025K15 [Mu...    74   6e-12
gi|27369581|ref|NP_766024.1| solute carrier family 25 (mitochond...    74   6e-12
gi|50307419|ref|XP_453688.1| unnamed protein product [Kluyveromy...    73   8e-12
gi|47211393|emb|CAF90629.1| unnamed protein product [Tetraodon n...    73   8e-12
gi|11545417|gb|AAG37834.1| folate transporter/carrier [Homo sapi...    73   8e-12
gi|38106800|gb|EAA53065.1| hypothetical protein MG06193.4 [Magna...    73   8e-12
gi|49106417|ref|XP_411424.1| hypothetical protein AN7287.2 [Aspe...    73   8e-12
gi|49084592|ref|XP_404483.1| hypothetical protein AN0346.2 [Aspe...    73   1e-11
gi|39586413|emb|CAE74071.1| Hypothetical protein CBG21724 [Caeno...    73   1e-11
gi|49100028|ref|XP_410827.1| hypothetical protein AN6690.2 [Aspe...    73   1e-11
gi|50414715|gb|AAH77266.1| Unknown (protein for MGC:80014) [Xeno...    73   1e-11
gi|21537040|gb|AAM61381.1| contains similarity to peroxisomal me...    73   1e-11
gi|46442822|gb|EAL02108.1| hypothetical protein CaO19.804 [Candi...    72   1e-11
gi|21358315|ref|NP_649731.1| CG2616-PA [Drosophila melanogaster]...    72   1e-11
gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21 ...    72   2e-11
gi|22477391|gb|AAH36869.1| LOC283130 protein [Homo sapiens]            72   2e-11
gi|21618784|gb|AAH31671.1| MGC34725 protein [Homo sapiens]             72   2e-11
gi|48734648|gb|AAH72270.1| Unknown (protein for IMAGE:4408521) [...    72   2e-11
gi|12833101|dbj|BAB22390.1| unnamed protein product [Mus musculus]     72   2e-11
gi|49084042|ref|XP_404252.1| hypothetical protein AN0115.2 [Aspe...    72   2e-11
gi|50288641|ref|XP_446750.1| unnamed protein product [Candida gl...    71   3e-11
gi|47225418|emb|CAG11901.1| unnamed protein product [Tetraodon n...    71   3e-11
gi|47227640|emb|CAG09637.1| unnamed protein product [Tetraodon n...    71   3e-11
gi|34222684|sp|Q95J75|MFTC_MACFA Mitochondrial folate transporte...    71   3e-11
gi|47086479|ref|NP_997947.1| solute carrier family 25 (mitochond...    71   3e-11
gi|37748220|gb|AAH59349.1| MGC69168 protein [Xenopus laevis]           71   4e-11
gi|7657583|ref|NP_056644.1| solute carrier family 25 (mitochondr...    71   4e-11
gi|31198539|ref|XP_308217.1| ENSANGP00000009305 [Anopheles gambi...    71   4e-11
gi|19920528|ref|NP_608615.1| CG18317-PA [Drosophila melanogaster...    71   4e-11
gi|45201049|ref|NP_986619.1| AGL047Cp [Eremothecium gossypii] >g...    71   4e-11
gi|50748696|ref|XP_421366.1| PREDICTED: similar to Mitchondrial ...    71   4e-11
gi|49096956|ref|XP_409938.1| hypothetical protein AN5801.2 [Aspe...    71   4e-11
gi|16741519|gb|AAH16571.1| Slc25a13 protein [Mus musculus]             71   4e-11
gi|13676520|dbj|BAB41176.1| hypothetical protein [Macaca fascicu...    71   4e-11
gi|19111931|ref|NP_595139.1| mitochondrial carrier protein; puta...    71   4e-11
gi|12849571|dbj|BAB28397.1| unnamed protein product [Mus musculu...    71   4e-11
gi|14042724|dbj|BAB55368.1| unnamed protein product [Homo sapiens]     70   5e-11
gi|50554631|ref|XP_504724.1| hypothetical protein [Yarrowia lipo...    70   5e-11
gi|32405390|ref|XP_323308.1| hypothetical protein [Neurospora cr...    70   7e-11
gi|11360341|pir||T50686 peroxisomal Ca-dependent solute carrier ...    70   7e-11
gi|50294652|ref|XP_449737.1| unnamed protein product [Candida gl...    70   7e-11
gi|21314739|ref|NP_110407.2| mitochondrial folate transporter/ca...    70   7e-11
gi|50555990|ref|XP_505403.1| hypothetical protein [Yarrowia lipo...    70   7e-11
gi|28571261|ref|NP_788934.1| CG33075-PA [Drosophila melanogaster...    70   7e-11
gi|21753279|dbj|BAC04318.1| unnamed protein product [Homo sapiens]     70   9e-11
gi|6523256|emb|CAB62206.1| aralar2 [Homo sapiens]                      70   9e-11
gi|21687151|ref|NP_660348.1| mitochondrial solute carrier protei...    70   9e-11
gi|27694792|gb|AAH43834.1| Mcsc-pending-prov protein [Xenopus la...    70   9e-11
gi|22002963|emb|CAD43091.1| mitochondrial aspartate-glutamate ca...    69   1e-10
gi|6324796|ref|NP_014865.1| Mitochondrial inner membrane transpo...    69   1e-10
gi|17554004|ref|NP_497274.1| solute carrier family 25 member 13 ...    69   1e-10
gi|50755142|ref|XP_414625.1| PREDICTED: similar to hypothetical ...    69   1e-10
gi|10048462|ref|NP_065266.1| carnitine/acylcarnitine translocase...    69   1e-10
gi|7487567|pir||T00435 probable mitochondrial carrier protein [i...    69   1e-10
gi|45361479|ref|NP_989316.1| hypothetical protein MGC76123 [Xeno...    69   1e-10
gi|18425065|ref|NP_569032.1| mitochondrial substrate carrier fam...    69   1e-10
gi|46130654|ref|XP_389107.1| hypothetical protein FG08931.1 [Gib...    69   1e-10
gi|7657581|ref|NP_055066.1| solute carrier family 25, member 13 ...    69   1e-10
gi|27735043|ref|NP_775908.1| hypothetical protein MGC34725 [Homo...    69   2e-10
gi|50539780|ref|NP_001002360.1| zgc:92520 [Danio rerio] >gnl|BL_...    69   2e-10
gi|34854043|ref|XP_216078.2| similar to mitochondrial carrier fa...    69   2e-10
gi|46117020|ref|XP_384528.1| hypothetical protein FG04352.1 [Gib...    69   2e-10
gi|6324325|ref|NP_014395.1| S-adenosylmethionine transporter of ...    69   2e-10
gi|27369998|ref|NP_766273.1| calcium-binding transporter; solute...    69   2e-10
gi|33286910|gb|AAH55369.1| Calcium-binding transporter [Mus musc...    69   2e-10
gi|19920986|ref|NP_609270.1| CG9582-PA [Drosophila melanogaster]...    69   2e-10
gi|41053634|ref|NP_956780.1| hypothetical protein MGC63736 [Dani...    69   2e-10
gi|26337655|dbj|BAC32513.1| unnamed protein product [Mus musculu...    69   2e-10
gi|47156872|gb|AAT12275.1| plastidial ADP-glucose transporter [H...    69   2e-10
gi|48843809|gb|AAT47068.1| putative peroxisomal Ca-dependent sol...    69   2e-10
gi|47218543|emb|CAF98075.1| unnamed protein product [Tetraodon n...    69   2e-10
gi|30520231|ref|NP_848881.1| mitochondrial carrier family protei...    68   3e-10
gi|47219162|emb|CAG01825.1| unnamed protein product [Tetraodon n...    68   3e-10
gi|50556988|ref|XP_505902.1| hypothetical protein [Yarrowia lipo...    68   3e-10
gi|31127297|gb|AAH52871.1| Carnitine/acylcarnitine translocase [...    68   3e-10
gi|39722382|emb|CAE84416.1| putative DIC1 protein [Pichia angusta]     68   3e-10
gi|47086085|ref|NP_998422.1| zgc:77454 [Danio rerio] >gnl|BL_ORD...    68   3e-10
gi|41053768|ref|NP_956550.1| hypothetical protein MGC55610 [Dani...    68   3e-10
gi|21748556|dbj|BAC03415.1| FLJ00351 protein [Homo sapiens]            68   3e-10
gi|47214965|emb|CAG10787.1| unnamed protein product [Tetraodon n...    68   3e-10
gi|31226914|ref|XP_317791.1| ENSANGP00000018102 [Anopheles gambi...    68   3e-10
gi|16758854|ref|NP_446417.1| solute carrier family 25 (carnitine...    68   3e-10
gi|38086109|ref|XP_110743.3| similar to mitochondrial solute car...    68   3e-10
gi|34860155|ref|XP_227597.2| similar to calcium-binding transpor...    67   4e-10
gi|9758516|dbj|BAB08924.1| carnitine/acylcarnitine translocase-l...    67   4e-10
gi|38100630|gb|EAA47731.1| hypothetical protein MG02974.4 [Magna...    67   4e-10
gi|18422718|ref|NP_568670.1| mitochondrial carnitine/acyl carrie...    67   4e-10
gi|17561410|ref|NP_505970.1| solute carrier (5M253) [Caenorhabdi...    67   4e-10
gi|27662946|ref|XP_216993.1| similar to PMP34 protein [Rattus no...    67   6e-10
gi|50306613|ref|XP_453280.1| unnamed protein product [Kluyveromy...    67   6e-10
gi|46249805|gb|AAH68561.1| Solute carrier family 25 member 24, i...    67   6e-10
gi|45710075|gb|AAH14519.1| Solute carrier family 25 member 24, i...    67   6e-10
gi|50539802|ref|NP_001002367.1| zgc:92090 [Danio rerio] >gnl|BL_...    67   6e-10
gi|13449279|ref|NP_085134.1| solute carrier family 25 (mitochond...    67   6e-10
gi|49522572|gb|AAH75377.1| Unknown (protein for MGC:89095) [Xeno...    67   6e-10
gi|47458041|ref|NP_998816.1| solute carrier family 25 member 24 ...    67   6e-10
gi|50256740|gb|EAL19460.1| hypothetical protein CNBG4070 [Crypto...    67   6e-10
gi|46094065|ref|NP_061331.2| mitochondrial carrier family protei...    67   8e-10
gi|50728698|ref|XP_416242.1| PREDICTED: similar to Peroxisomal m...    67   8e-10
gi|49079674|ref|XP_403456.1| hypothetical protein UM05841.1 [Ust...    67   8e-10
gi|39592080|emb|CAE75300.1| Hypothetical protein CBG23270 [Caeno...    66   1e-09
gi|6324674|ref|NP_014743.1| Mitochondrial inner membrane carniti...    66   1e-09
gi|34895726|ref|NP_909212.1| putative peroxisomal Ca-dependent s...    66   1e-09
gi|21483338|gb|AAM52644.1| GH25190p [Drosophila melanogaster]          66   1e-09
gi|46435410|gb|EAK94792.1| hypothetical protein CaO19.4447 [Cand...    66   1e-09
gi|46442238|gb|EAL01529.1| hypothetical protein CaO19.7082 [Cand...    66   1e-09
gi|24652037|ref|NP_724769.1| CG8026-PA [Drosophila melanogaster]...    66   1e-09
gi|15236783|ref|NP_194966.1| mitochondrial substrate carrier fam...    66   1e-09
gi|25010055|gb|AAN71193.1| GH24658p [Drosophila melanogaster]          66   1e-09
gi|19921062|ref|NP_609380.1| CG4995-PA [Drosophila melanogaster]...    66   1e-09
gi|47027964|gb|AAT09000.1| hypothetical protein [Homo sapiens]         66   1e-09
gi|49092678|ref|XP_407800.1| hypothetical protein AN3663.2 [Aspe...    66   1e-09
gi|24583352|ref|NP_723565.1| CG4995-PC [Drosophila melanogaster]...    66   1e-09
gi|49118246|gb|AAH73249.1| Unknown (protein for MGC:80594) [Xeno...    65   2e-09
gi|29789024|ref|NP_035529.1| solute carrier family 25 (mitochond...    65   2e-09
gi|10946712|ref|NP_067351.1| peroxisomal integral membrane prote...    65   2e-09
gi|24648424|ref|NP_650891.1| CG4241-PA [Drosophila melanogaster]...    65   2e-09
gi|4557403|ref|NP_000378.1| carnitine/acylcarnitine translocase;...    65   2e-09
gi|5851675|emb|CAB55356.1| carnitine/acylcarnitine translocase [...    65   2e-09
gi|23574715|dbj|BAC20586.1| mitochondrial carnitine/acylcarnitin...    65   2e-09
gi|49094126|ref|XP_408524.1| hypothetical protein AN4387.2 [Aspe...    65   2e-09
gi|46436245|gb|EAK95611.1| hypothetical protein CaO19.8971 [Cand...    65   2e-09
gi|19921888|ref|NP_610468.1| CG8026-PB [Drosophila melanogaster]...    65   2e-09
gi|5453918|ref|NP_006349.1| solute carrier family 25 (mitochondr...    65   2e-09
gi|48141294|ref|XP_393549.1| similar to CG8026-PA [Apis mellifera]     65   2e-09
gi|46436144|gb|EAK95512.1| hypothetical protein CaO19.1393 [Cand...    65   2e-09
gi|15236140|ref|NP_194348.1| mitochondrial substrate carrier fam...    65   2e-09
gi|49899706|gb|AAH76734.1| Unknown (protein for MGC:81365) [Xeno...    65   2e-09
gi|49096066|ref|XP_409493.1| hypothetical protein AN5356.2 [Aspe...    65   3e-09
gi|50424283|ref|XP_460728.1| unnamed protein product [Debaryomyc...    65   3e-09
gi|50426841|ref|XP_462018.1| unnamed protein product [Debaryomyc...    65   3e-09
gi|46442747|gb|EAL02034.1| hypothetical protein CaO19.13885 [Can...    65   3e-09
gi|23479653|gb|EAA16422.1| Mitochondrial carrier protein, putati...    65   3e-09
gi|50748698|ref|XP_421367.1| PREDICTED: similar to AI132487 prot...    65   3e-09
gi|50732673|ref|XP_425987.1| PREDICTED: similar to Calcium-bindi...    65   3e-09
gi|4138581|emb|CAA67107.1| mitochondrial energy transfer protein...    65   3e-09
gi|47218080|emb|CAG09952.1| unnamed protein product [Tetraodon n...    64   4e-09
gi|23574792|dbj|BAC20608.1| solute carrier family 25 member 13 [...    64   4e-09
gi|50748440|ref|XP_421247.1| PREDICTED: similar to solute carrie...    64   4e-09
gi|50754473|ref|XP_414400.1| PREDICTED: similar to Slc25a20-prov...    64   4e-09
gi|39593720|emb|CAE62012.1| Hypothetical protein CBG06020 [Caeno...    64   4e-09
gi|15225602|ref|NP_181526.1| peroxisomal membrane protein (PMP36...    64   4e-09
gi|21593883|gb|AAM65850.1| putative peroxisomal membrane carrier...    64   4e-09
gi|45551937|ref|NP_732519.2| CG4241-PB [Drosophila melanogaster]...    64   5e-09
gi|12804493|gb|AAH01656.1| SLC25A23 protein [Homo sapiens]             64   5e-09
gi|6324704|ref|NP_014773.1| Ornithine transporter of the mitocho...    64   5e-09
gi|28551967|emb|CAD55563.1| putative calcium binding transporter...    64   5e-09
gi|26331858|dbj|BAC29659.1| unnamed protein product [Mus musculu...    64   5e-09
gi|45184810|ref|NP_982528.1| AAL014Cp [Eremothecium gossypii] >g...    64   5e-09
gi|37534064|ref|NP_921334.1| putative Tricarboxylate transport p...    64   6e-09
gi|46434312|gb|EAK93725.1| hypothetical protein CaO19.11975 [Can...    64   6e-09
gi|11277067|pir||T45934 hypothetical protein F5K20.240 - Arabido...    64   6e-09
gi|6563262|gb|AAF17225.1| mitochondrial carrier family protein [...    64   6e-09
gi|47214999|emb|CAG03139.1| unnamed protein product [Tetraodon n...    64   6e-09
gi|15220023|ref|NP_178108.1| mitochondrial substrate carrier fam...    64   6e-09
gi|34882292|ref|XP_217310.2| similar to putative calcium binding...    64   6e-09
gi|27369824|ref|NP_766165.1| solute carrier family 25 (mitochond...    64   6e-09
gi|31203391|ref|XP_310644.1| ENSANGP00000007451 [Anopheles gambi...    64   6e-09
gi|50549725|ref|XP_502333.1| hypothetical protein [Yarrowia lipo...    64   6e-09
gi|18424512|ref|NP_568940.1| mitochondrial substrate carrier fam...    63   8e-09
gi|34914648|ref|NP_918671.1| OSJNBa0054L14.23 [Oryza sativa (jap...    63   8e-09
gi|231654|sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast pre...    63   8e-09
gi|1668788|emb|CAA60862.1| ARG11 protein [Saccharomyces cerevisiae]    63   8e-09
gi|19114749|ref|NP_593837.1| mitochondrial carrier protein [Schi...    63   8e-09
gi|50547779|ref|XP_501359.1| hypothetical protein [Yarrowia lipo...    63   8e-09
gi|48106631|ref|XP_396134.1| similar to ENSANGP00000018102 [Apis...    63   8e-09
gi|33598954|ref|NP_037518.2| solute carrier family 25 member 24 ...    63   8e-09
gi|42570054|ref|NP_680566.2| mitochondrial substrate carrier fam...    63   8e-09
gi|49072264|ref|XP_400421.1| hypothetical protein UM02806.1 [Ust...    63   8e-09
gi|50731821|ref|XP_425937.1| PREDICTED: similar to mitochondrial...    63   8e-09
gi|19113000|ref|NP_596208.1| putative mitochondrial phosphate ca...    63   1e-08
gi|47196594|emb|CAF87322.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|37537070|ref|NP_922837.1| putative carnitine/acylcarnitine tr...    63   1e-08
gi|46108312|ref|XP_381214.1| hypothetical protein FG01038.1 [Gib...    63   1e-08
gi|46390080|dbj|BAD15497.1| putative Brittle-1 protein, chloropl...    63   1e-08
gi|50254564|gb|EAL17313.1| hypothetical protein CNBN1400 [Crypto...    63   1e-08
gi|50545217|ref|XP_500146.1| hypothetical protein [Yarrowia lipo...    63   1e-08
gi|50582710|gb|AAT78780.1| mitochondrial carrier protein-like pr...    63   1e-08
gi|24638958|ref|NP_569856.2| CG5254-PA [Drosophila melanogaster]...    63   1e-08
gi|19424330|ref|NP_598298.1| solute carrier family 25 (mitochond...    63   1e-08
gi|50310009|ref|XP_455018.1| unnamed protein product [Kluyveromy...    62   1e-08
gi|19114979|ref|NP_594067.1| putative mitochondrial carrier prot...    62   1e-08
gi|24657533|ref|NP_728982.1| CG32250-PA [Drosophila melanogaster...    62   1e-08
gi|39590729|emb|CAE65099.1| Hypothetical protein CBG09959 [Caeno...    62   1e-08
gi|6320831|ref|NP_010910.1| Hypothetical ORF; Yel006wp [Saccharo...    62   1e-08
gi|7512351|pir||G01789 citrate transporter protein - human >gnl|...    62   2e-08
gi|21389315|ref|NP_005975.1| solute carrier family 25 (mitochond...    62   2e-08
gi|49079746|ref|XP_403484.1| hypothetical protein UM05869.1 [Ust...    62   2e-08
gi|34881277|ref|XP_228559.2| similar to hypothetical protein MGC...    62   2e-08
gi|48139318|ref|XP_396993.1| similar to CG4241-PA [Apis mellifera]     62   2e-08
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam...    62   2e-08
gi|38099451|gb|EAA46798.1| hypothetical protein MG10492.4 [Magna...    62   2e-08
gi|34933026|ref|XP_233310.2| similar to mitochondrial solute car...    62   2e-08
gi|49080904|ref|XP_403918.1| hypothetical protein UM06303.1 [Ust...    62   2e-08
gi|34875118|ref|XP_221118.2| similar to solute carrier family 25...    62   2e-08
gi|1785635|emb|CAA65633.1| mitochondrial citrate transport prote...    62   2e-08
gi|42569598|ref|NP_180938.2| mitochondrial substrate carrier fam...    62   2e-08
gi|50310545|ref|XP_455292.1| unnamed protein product [Kluyveromy...    62   2e-08
gi|45198664|ref|NP_985693.1| AFR146Wp [Eremothecium gossypii] >g...    62   2e-08
gi|15234063|ref|NP_192019.1| mitochondrial substrate carrier fam...    62   2e-08
gi|50554903|ref|XP_504860.1| hypothetical protein [Yarrowia lipo...    62   2e-08
gi|7484374|pir||T09109 envelope protein LIP-36G1, low CO2 induci...    62   2e-08
gi|47226681|emb|CAG07840.1| unnamed protein product [Tetraodon n...    62   2e-08
gi|50745467|ref|XP_420126.1| PREDICTED: similar to Mitochondrial...    62   2e-08
gi|49089122|ref|XP_406310.1| hypothetical protein AN2173.2 [Aspe...    62   2e-08
gi|15231063|ref|NP_190755.1| mitochondrial substrate carrier fam...    62   2e-08
gi|38102571|gb|EAA49393.1| hypothetical protein MG01051.4 [Magna...    62   2e-08
gi|25012556|gb|AAN71379.1| RE36975p [Drosophila melanogaster]          62   2e-08
gi|49109931|ref|XP_411706.1| hypothetical protein AN7569.2 [Aspe...    62   2e-08
gi|39596351|emb|CAE69989.1| Hypothetical protein CBG16392 [Caeno...    62   2e-08
gi|30687297|ref|NP_181325.2| mitochondrial substrate carrier fam...    61   3e-08
gi|46115020|ref|XP_383528.1| hypothetical protein FG03352.1 [Gib...    61   3e-08
gi|50307493|ref|XP_453726.1| unnamed protein product [Kluyveromy...    61   3e-08
gi|15228163|ref|NP_191123.1| mitochondrial substrate carrier fam...    61   3e-08
gi|23509092|ref|NP_701760.1| mitochondrial carrier protein, puta...    61   4e-08
gi|32416310|ref|XP_328633.1| hypothetical protein [Neurospora cr...    61   4e-08
gi|27694786|gb|AAH43827.1| Slc25a20-prov protein [Xenopus laevis]      61   4e-08
gi|45360847|ref|NP_989099.1| carnitine/acylcarnitine translocase...    61   4e-08
gi|46136235|ref|XP_389809.1| conserved hypothetical protein [Gib...    61   4e-08
gi|46126995|ref|XP_388051.1| conserved hypothetical protein [Gib...    61   4e-08
gi|32415055|ref|XP_328007.1| hypothetical protein ( (AL355930) r...    60   5e-08
gi|50552638|ref|XP_503729.1| hypothetical protein [Yarrowia lipo...    60   5e-08
gi|21593041|gb|AAM64990.1| putative carnitine/acylcarnitine tran...    60   5e-08
gi|21554682|gb|AAM63657.1| Ca-dependent solute carrier-like prot...    60   5e-08
gi|17554166|ref|NP_499187.1| solute carrier family 25 member 1 (...    60   5e-08
gi|31240849|ref|XP_320838.1| ENSANGP00000017957 [Anopheles gambi...    60   7e-08
gi|25403521|pir||G86383 probable mitochondrial carrier protein [...    60   7e-08
gi|27807191|ref|NP_777081.1| solute carrier family 25 (mitochond...    60   7e-08
gi|39593597|emb|CAE61889.1| Hypothetical protein CBG05880 [Caeno...    60   7e-08
gi|49131161|ref|XP_413018.1| hypothetical protein AN8881.2 [Aspe...    60   7e-08
gi|20137652|sp|Q9HC21|DNC_HUMAN Mitochondrial deoxynucleotide ca...    60   7e-08
gi|15240999|ref|NP_195770.1| mitochondrial substrate carrier fam...    60   7e-08
gi|38102594|gb|EAA49414.1| hypothetical protein MG01072.4 [Magna...    60   7e-08
gi|21592525|gb|AAM64475.1| putative carrier protein [Arabidopsis...    60   7e-08
gi|23619607|ref|NP_705569.1| mitochondrial carrier protein, puta...    60   9e-08
gi|46128223|ref|XP_388665.1| hypothetical protein FG08489.1 [Gib...    60   9e-08
gi|30686563|ref|NP_850252.1| mitochondrial substrate carrier fam...    60   9e-08
gi|21313024|ref|NP_080347.1| solute carrier family 25 (mitochond...    60   9e-08
gi|19114613|ref|NP_593701.1| putative mitochondrial carrier prot...    59   1e-07
gi|34856875|ref|XP_215549.2| similar to osmotic stress protein [...    59   1e-07
gi|50256975|gb|EAL19693.1| hypothetical protein CNBG3210 [Crypto...    59   1e-07
gi|34394749|dbj|BAC84113.1| putative mitochondrial carrier prote...    59   1e-07
gi|22760110|dbj|BAC11071.1| unnamed protein product [Homo sapiens]     59   1e-07
gi|8394297|ref|NP_059003.1| solute carrier family 25, member 1 p...    59   1e-07
gi|49085830|ref|XP_405007.1| hypothetical protein AN0870.2 [Aspe...    59   1e-07
gi|6325315|ref|NP_015383.1| Putative mitochondrial inner membran...    59   1e-07
gi|31242839|ref|XP_321850.1| ENSANGP00000020264 [Anopheles gambi...    59   1e-07
gi|6325123|ref|NP_015191.1| Mitochondrial inner membrane transpo...    59   1e-07
gi|50405851|ref|XP_456566.1| unnamed protein product [Debaryomyc...    59   1e-07
gi|6746567|gb|AAF27626.1| hydrogenosomal membrane protein 31 pre...    59   2e-07
gi|50308145|ref|XP_454073.1| unnamed protein product [Kluyveromy...    59   2e-07
gi|41053632|ref|NP_957153.1| hypothetical protein MGC77760 [Dani...    59   2e-07
gi|37537072|ref|NP_922838.1| putative carnitine/acylcarnitine tr...    59   2e-07
gi|38083666|ref|XP_111757.2| mutant ornithine transporter 2 [Mus...    59   2e-07
gi|7484375|pir||T09110 envelope protein LIP-36G2, low CO2 induci...    59   2e-07
gi|13445630|gb|AAK26321.1| mutant ornithine transporter 2 [Mus m...    59   2e-07
gi|49250385|gb|AAH74516.1| Unknown (protein for MGC:69279) [Xeno...    59   2e-07
gi|21594326|gb|AAM65995.1| mitochondrial carrier-like protein [A...    59   2e-07
gi|20161078|dbj|BAB90009.1| putative mitochondrial carrier [Oryz...    59   2e-07
gi|31216089|ref|XP_316164.1| ENSANGP00000020391 [Anopheles gambi...    59   2e-07
gi|18424178|ref|NP_568894.1| uncoupling protein (UCP2) [Arabidop...    59   2e-07
gi|47217939|emb|CAG02222.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|6580521|emb|CAB63424.1| probably mitochondrial carrier protei...    59   2e-07
gi|34904170|ref|NP_913432.1| putative carnitine/acylcarnitine tr...    59   2e-07
gi|31543632|ref|NP_068380.2| solute carrier family 25 (mitochond...    59   2e-07
gi|26449572|dbj|BAC41912.1| putative mitochondrial carrier prote...    58   3e-07
gi|46117028|ref|XP_384532.1| hypothetical protein FG04356.1 [Gib...    58   3e-07
gi|15223820|ref|NP_172908.1| mitochondrial substrate carrier fam...    58   3e-07
gi|3885438|gb|AAC77879.1| ADP/ATP translocase [Dictyostelium dis...    58   3e-07
gi|4824|emb|CAA47602.1| mitochondrial carrier protein [Saccharom...    58   3e-07
gi|50308695|ref|XP_454351.1| unnamed protein product [Kluyveromy...    58   3e-07
gi|49071382|ref|XP_399980.1| hypothetical protein UM02365.1 [Ust...    58   3e-07
gi|50290697|ref|XP_447781.1| unnamed protein product [Candida gl...    58   3e-07
gi|50555253|ref|XP_505035.1| hypothetical protein [Yarrowia lipo...    58   3e-07
gi|14388376|dbj|BAB60743.1| hypothetical protein [Macaca fascicu...    58   3e-07
gi|7511491|pir||T29640 mitochondrial carrier protein DIF-1 homol...    58   3e-07
gi|39588024|emb|CAE57255.1| Hypothetical protein CBG00135 [Caeno...    58   3e-07
gi|31210049|ref|XP_313991.1| ENSANGP00000009911 [Anopheles gambi...    58   3e-07
gi|30409998|ref|NP_848473.1| RIKEN cDNA 1700034J06 [Mus musculus...    58   3e-07
gi|6841066|gb|AAF28888.1| calcium-binding transporter [Homo sapi...    58   3e-07
gi|17539560|ref|NP_501223.1| mitochondrial carrier protein famil...    58   3e-07
gi|50427043|ref|XP_462126.1| unnamed protein product [Debaryomyc...    57   5e-07


>gi|17536687|ref|NP_496447.1| mitochondrial solute carrier (34.1 kD)
           (2L760) [Caenorhabditis elegans]
 gi|7508812|pir||T26089 hypothetical protein W02B12.9 -
           Caenorhabditis elegans
 gi|3880433|emb|CAA91399.1| Hypothetical protein W02B12.9
           [Caenorhabditis elegans]
          Length = 312

 Score =  611 bits (1575), Expect = e-174
 Identities = 299/312 (95%), Positives = 299/312 (95%)
 Frame = -1

Query: 939 MGGGGEDEYESLPTHSVPVHLTAGALAGAVEHCVMFPFDSVKTRMQSLCPCPETKCPTPV 760
           MGGGGEDEYESLPTHSVPVHLTAGALAGAVEHCVMFPFDSVKTRMQSLCPCPETKCPTPV
Sbjct: 1   MGGGGEDEYESLPTHSVPVHLTAGALAGAVEHCVMFPFDSVKTRMQSLCPCPETKCPTPV 60

Query: 759 HSLMSIVKREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKGYLTGNSAGHSNTLAYGAS 580
           HSLMSIVKREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKGYLTGNSAGHSNTLAYGAS
Sbjct: 61  HSLMSIVKREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKGYLTGNSAGHSNTLAYGAS 120

Query: 579 GVVATLIHDAIMNPAEVVKQRMQMAFSPYGSSLECARCVYNREGVAAFYRSYTTQLAMNV 400
           GVVATLIHDAIMNPAEVVKQRMQMAFSPYGSSLECARCVYNREGVAAFYRSYTTQLAMNV
Sbjct: 121 GVVATLIHDAIMNPAEVVKQRMQMAFSPYGSSLECARCVYNREGVAAFYRSYTTQLAMNV 180

Query: 399 PFQAIHFMSYEFWQHVLNPEHKYDPKSHXXXXXXXXXXXXXLTTPMDCVKTVLNTQQAAE 220
           PFQAIHFMSYEFWQHVLNPEHKYDPKSH             LTTPMDCVKTVLNTQQAAE
Sbjct: 181 PFQAIHFMSYEFWQHVLNPEHKYDPKSHLIAGGLAGGLAAALTTPMDCVKTVLNTQQAAE 240

Query: 219 ADPANRRIFLQARYRYRGISDAVRTIYSQRGLSGFSCGLQARVIFQVPATALSWSVYELF 40
           ADPANRRIFLQARYRYRGISDAVRTIYSQRGLSGFSCGLQARVIFQVPATALSWSVYELF
Sbjct: 241 ADPANRRIFLQARYRYRGISDAVRTIYSQRGLSGFSCGLQARVIFQVPATALSWSVYELF 300

Query: 39  KFMLSFEGGHSS 4
           KFMLSFEGGHSS
Sbjct: 301 KFMLSFEGGHSS 312




[DB home][top]